Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0A01067g20219910391e-146
Kwal_47.192101811794421e-55
AFR249W1811753909e-48
YGL231C1901823562e-42
Scas_712.201861833212e-37
CAGL0H07953g1831763194e-37
Scas_703.927660670.84
ADL228C80558642.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A01067g
         (199 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A01067g complement(100259..100867) weakly similar to sp|P53...   404   e-146
Kwal_47.19210                                                         174   1e-55
AFR249W [3441] [Homologous to ScYGL231C - SH] complement(886552....   154   9e-48
YGL231C (YGL231C) [1767] chr7 complement(63047..63619) Protein o...   141   2e-42
Scas_712.20                                                           128   2e-37
CAGL0H07953g complement(776742..777293) similar to sp|P53073 Sac...   127   4e-37
Scas_703.9                                                             30   0.84 
ADL228C [1513] [Homologous to ScYNL041C (COD2) - SH] (302842..30...    29   2.3  

>KLLA0A01067g complement(100259..100867) weakly similar to sp|P53073
           Saccharomyces cerevisiae YGL231c singleton, start by
           similarity
          Length = 202

 Score =  404 bits (1039), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 199/199 (100%), Positives = 199/199 (100%)

Query: 1   MVKIYDFLKSEIGLIDKLQEGIMSEDIPQWAKDLKVDKVMRRNSVNGGKLPDPFGIKKLE 60
           MVKIYDFLKSEIGLIDKLQEGIMSEDIPQWAKDLKVDKVMRRNSVNGGKLPDPFGIKKLE
Sbjct: 1   MVKIYDFLKSEIGLIDKLQEGIMSEDIPQWAKDLKVDKVMRRNSVNGGKLPDPFGIKKLE 60

Query: 61  IEGQKPPKVIDHDAQNRIAKLTAERAWQISSEPLKSVPMNIIMSYMSGNSLQIIPIMTAV 120
           IEGQKPPKVIDHDAQNRIAKLTAERAWQISSEPLKSVPMNIIMSYMSGNSLQIIPIMTAV
Sbjct: 61  IEGQKPPKVIDHDAQNRIAKLTAERAWQISSEPLKSVPMNIIMSYMSGNSLQIIPIMTAV 120

Query: 121 MLVSNPIKSILGVKSKFQHLINKDNDVTPPVVAAMIMYVIYQLILMGIGLHKLNSMGLFP 180
           MLVSNPIKSILGVKSKFQHLINKDNDVTPPVVAAMIMYVIYQLILMGIGLHKLNSMGLFP
Sbjct: 121 MLVSNPIKSILGVKSKFQHLINKDNDVTPPVVAAMIMYVIYQLILMGIGLHKLNSMGLFP 180

Query: 181 TTSSDWLAWQQPTEYLYRT 199
           TTSSDWLAWQQPTEYLYRT
Sbjct: 181 TTSSDWLAWQQPTEYLYRT 199

>Kwal_47.19210
          Length = 181

 Score =  174 bits (442), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 124/179 (69%), Gaps = 3/179 (1%)

Query: 23  MSEDIPQWAKDL-KVDKVMRRNSVNGGKLPDPFGIKKLEIEGQKPPKVIDHDAQ-NRIAK 80
           MSE IP+WA++L   D V + N V    LP P G K L +   KP K   + A+   +A 
Sbjct: 1   MSEIIPEWAQNLCDPDYVQKINVVTSNSLPSPPGFKTLSVSTSKPSKKTSNSAEAENLAS 60

Query: 81  LTAERAWQISSEPLKSVPMNIIMSYMSGNSLQIIPIMTAVMLVSNPIKSILGVKSKFQHL 140
           L  ++AWQIS +P KS+PMN+I+SYMSG SLQII IMTA+M VSNPIKS++ ++  F+ +
Sbjct: 61  LMVQKAWQISFQPAKSIPMNMIVSYMSGTSLQIISIMTALMFVSNPIKSVINIRRTFKPV 120

Query: 141 INKDNDVTPPVVAAMIMYVIYQLILMGIGLHKLNSMGLFPTTSSDWLAWQQPTEYLYRT 199
           +  + +V P V++AMIM+V++Q +LMGIG+HKLNSMGL P T SDWL  ++P  Y  R+
Sbjct: 121 MG-NPEVQPQVLSAMIMFVVFQAMLMGIGIHKLNSMGLIPNTKSDWLFLEKPAIYKDRS 178

>AFR249W [3441] [Homologous to ScYGL231C - SH]
           complement(886552..887097) [546 bp, 181 aa]
          Length = 181

 Score =  154 bits (390), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 80/175 (45%), Positives = 112/175 (64%), Gaps = 3/175 (1%)

Query: 23  MSEDIPQWAKDLKVDKVMRRNSV-NGGKLPDPFGI-KKLEIEGQKPPKVIDHDAQNRIAK 80
           MS + P WA+ L   + ++  SV +   LP P G  KK + + +   K      + RI  
Sbjct: 1   MSSEAPTWARCLVEPEYLKSISVVSSNTLPQPPGFSKKQKSQTRSVSKEEGEANRERINA 60

Query: 81  LTAERAWQISSEPLKSVPMNIIMSYMSGNSLQIIPIMTAVMLVSNPIKSILGVKSKFQHL 140
           L  ++AWQ++ +P K++PMN  MSYMSG SLQIIPIMTA+ML++ P+KS+L V+S F+ L
Sbjct: 61  LQVKKAWQLAFQPSKAIPMNFFMSYMSGTSLQIIPIMTALMLLTGPVKSVLQVRSTFKGL 120

Query: 141 INKDNDVTPPVVAAMIMYVIYQLILMGIGLHKLNSMGLFPTTSSDWLAWQQPTEY 195
           +N +      V+AAM +YV +Q +LM IGL KLN+MGL P   SDWLAW+ P  Y
Sbjct: 121 LNNEAAYG-QVLAAMCLYVFFQAVLMAIGLQKLNAMGLLPNKHSDWLAWETPMAY 174

>YGL231C (YGL231C) [1767] chr7 complement(63047..63619) Protein of
           unknown function, has moderate similarity to
           uncharacterized S. pombe Spcc1281.03cp [573 bp, 190 aa]
          Length = 190

 Score =  141 bits (356), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 80/182 (43%), Positives = 108/182 (59%), Gaps = 10/182 (5%)

Query: 23  MSEDIP-QWAKDLKVDKVMRRNSV-NGGKLPDPFGIKKLEIEGQKPPKVIDHDAQ----- 75
           MSE  P +WAK L   K + + ++ N   LP P G +    +G    K  D  +Q     
Sbjct: 1   MSEQEPYEWAKHLLDTKYIEKYNIQNSNTLPSPPGFEGNSSKGNVTRKQQDATSQTTSLA 60

Query: 76  --NRIAKLTAERAWQISSEPLKSVPMNIIMSYMSGNSLQIIPIMTAVMLVSNPIKSILGV 133
             N+I  L  ++AWQI+ +P KS+PMNI MSYMSG SLQIIPIMTA+ML+S PIK+I   
Sbjct: 61  QKNQITVLQVQKAWQIALQPAKSIPMNIFMSYMSGTSLQIIPIMTALMLLSGPIKAIFST 120

Query: 134 KSKFQHLINKDNDVTPPVVAAMIMYVIYQLILMGIGLHKLNSMGLFPTTSSDWLAWQQPT 193
           +S F+ ++  +      V  AM MY+++Q +LM IG  KLNSMGL P    DWL W++  
Sbjct: 121 RSAFKPVLG-NKATQSQVQTAMFMYIVFQGVLMYIGYRKLNSMGLIPNAKGDWLPWERIA 179

Query: 194 EY 195
            Y
Sbjct: 180 HY 181

>Scas_712.20
          Length = 186

 Score =  128 bits (321), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 112/183 (61%), Gaps = 16/183 (8%)

Query: 23  MSEDIPQWA---KDLKVDKVMRRNSVNGGKLPDPFGIKKLEI-------EGQKPPKVIDH 72
           MS +  +WA    +LK ++    +++    LP P G   +E+       +G K  + I  
Sbjct: 1   MSVEPFEWAVKLCNLKEEEATDSSAIK--TLPSPPGYGVVEVGKNQHESQGNKATEAIRM 58

Query: 73  DAQNRIAKLTAERAWQISSEPLKSVPMNIIMSYMSGNSLQIIPIMTAVMLVSNPIKSILG 132
              N    L A++A  I+ +P KS+PMN+IMSYMSG SLQIIPIM A+ML+S P+K+I  
Sbjct: 59  KELNN---LLAQKAMSIAMQPAKSIPMNMIMSYMSGTSLQIIPIMAALMLLSGPLKAIFS 115

Query: 133 VKSKFQHLINKDNDVTPPVVAAMIMYVIYQLILMGIGLHKLNSMGLFPTTSSDWLAWQQP 192
           +++ F+ ++  + ++   V +AM +Y+++Q  LM IG+ KLN+MGL P T SDWL W+ P
Sbjct: 116 IRAAFKPVLG-NKEIQSQVNSAMFLYIVFQGALMYIGIRKLNAMGLIPNTKSDWLTWELP 174

Query: 193 TEY 195
            +Y
Sbjct: 175 VDY 177

>CAGL0H07953g complement(776742..777293) similar to sp|P53073
           Saccharomyces cerevisiae YGL231c, hypothetical start
          Length = 183

 Score =  127 bits (319), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 107/176 (60%), Gaps = 4/176 (2%)

Query: 22  IMSEDIPQWAKDLKVDKVMRRNSVNGGKLPDPFGIKKLEIEGQKPPKVIDHDAQNR--IA 79
           ++S +  +W ++L   ++++    +    P P G + L     +  K   +   N+  IA
Sbjct: 1   MVSANTEEWVENLLNPQIVKEWQQSTVNTPSPQGYQGLS-GSVRDKKNTSNKQVNKPDIA 59

Query: 80  KLTAERAWQISSEPLKSVPMNIIMSYMSGNSLQIIPIMTAVMLVSNPIKSILGVKSKFQH 139
            L  ++AW+I+ +P KS+PMN  MSYMSG SLQIIPIMTA+ML+S P+KSI  ++  F+ 
Sbjct: 60  NLQVQKAWEIALQPAKSIPMNFFMSYMSGTSLQIIPIMTALMLLSGPVKSIFTIRETFKP 119

Query: 140 LINKDNDVTPPVVAAMIMYVIYQLILMGIGLHKLNSMGLFPTTSSDWLAWQQPTEY 195
           ++         +   MI+YV +Q +LM IGL KLN MGL P  +SDW+AW++ T+Y
Sbjct: 120 VLGNPKSQN-QIYLMMILYVAFQGVLMFIGLKKLNDMGLIPNKTSDWMAWEKITDY 174

>Scas_703.9
          Length = 276

 Score = 30.4 bits (67), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 57  KKLEIEGQKPPKVIDHDAQNRIAKLTAERAWQ-ISSEPLKSVPMNIIMSYMSGNSLQIIP 115
           KKLE E ++P K  +HD  N + ++   R+W  + S+P  S     +   +S + ++I P
Sbjct: 83  KKLE-ENEEPVKPQEHDETNAVEEIDWYRSWHGVGSKPFGSPIQKALFQELSPDDIEIKP 141

>ADL228C [1513] [Homologous to ScYNL041C (COD2) - SH]
           (302842..305259) [2418 bp, 805 aa]
          Length = 805

 Score = 29.3 bits (64), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 103 MSYMSGNSLQIIPIMTAVMLVSNPIKSILGVKSKFQHLINKDNDVTPPVVAAMIMYVI 160
           M   S  +++++PI     LV +  + +    S FQHL+ K N+VT  V+   + +V+
Sbjct: 72  MEMYSELTVKLLPIQPG--LVRDIFEDVTPQSSDFQHLLKKGNNVTSAVLVKRLSHVL 127

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.136    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,736,478
Number of extensions: 271725
Number of successful extensions: 701
Number of sequences better than 10.0: 12
Number of HSP's gapped: 694
Number of HSP's successfully gapped: 12
Length of query: 199
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 103
Effective length of database: 13,272,781
Effective search space: 1367096443
Effective search space used: 1367096443
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)