Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0A01045g30928914290.0
AFR250C2772897242e-95
Kwal_47.192122662756902e-90
YGL232W2892916235e-80
Scas_712.192922866193e-79
CAGL0H07931g2652755469e-69
Sklu_2433.121441344769e-60
Kwal_23.471752789653.4
CAGL0M10527g249729636.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A01045g
         (304 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A01045g 99292..100221 similar to sp|P53072 Saccharomyces ce...   555   0.0  
AFR250C [3442] [Homologous to ScYGL232W - SH] (887185..888018) [...   283   2e-95
Kwal_47.19212                                                         270   2e-90
YGL232W (TAN1) [1766] chr7 (62074..62130,62189..63001) Protein c...   244   5e-80
Scas_712.19                                                           243   3e-79
CAGL0H07931g 775729..776526 similar to sp|P53072 Saccharomyces c...   214   9e-69
Sklu_2433.12 YGL232W, Contig c2433 21601-22035                        187   9e-60
Kwal_23.4717                                                           30   3.4  
CAGL0M10527g complement(1052421..1059914) similar to sp|P35194 S...    29   6.9  

>KLLA0A01045g 99292..100221 similar to sp|P53072 Saccharomyces
           cerevisiae YGL232w singleton, start by similarity
          Length = 309

 Score =  555 bits (1429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/289 (93%), Positives = 270/289 (93%)

Query: 1   MAKRSRKDSKGGIVKRYKVVKSTLDPNTSGIYITCARNKEKAAASEILSIFEEKVEEYYS 60
           MAKRSRKDSKGGIVKRYKVVKSTLDPNTSGIYITCARNKEKAAASEILSIFEEKVEEYYS
Sbjct: 1   MAKRSRKDSKGGIVKRYKVVKSTLDPNTSGIYITCARNKEKAAASEILSIFEEKVEEYYS 60

Query: 61  DELNAMNSASPDGSGSIEIESKEPVXXXXXXXXXXXXXXXXXXXGLKNHKTTIVDTKKNK 120
           DELNAMNSASPDGSGSIEIESKEPV                   GLKNHKTTIVDTKKNK
Sbjct: 61  DELNAMNSASPDGSGSIEIESKEPVTTESKKEISIEEELQQELEGLKNHKTTIVDTKKNK 120

Query: 121 PILEQLDLQTECLVFVKTRKPIVPEKFVHRIIRDLADPHDLRKRTRFVQKLTPITDSCHA 180
           PILEQLDLQTECLVFVKTRKPIVPEKFVHRIIRDLADPHDLRKRTRFVQKLTPITDSCHA
Sbjct: 121 PILEQLDLQTECLVFVKTRKPIVPEKFVHRIIRDLADPHDLRKRTRFVQKLTPITDSCHA 180

Query: 181 SMEELAKLCERVLPQHFHKEEMVPVKFAVEINKRNFSTMDKMEMIKYIAGFVGKQGSLEH 240
           SMEELAKLCERVLPQHFHKEEMVPVKFAVEINKRNFSTMDKMEMIKYIAGFVGKQGSLEH
Sbjct: 181 SMEELAKLCERVLPQHFHKEEMVPVKFAVEINKRNFSTMDKMEMIKYIAGFVGKQGSLEH 240

Query: 241 KVDLKNYDKLVLLQCFKNNIGMCVVDKDYRTDYKKYNVQELFEMKHKNK 289
           KVDLKNYDKLVLLQCFKNNIGMCVVDKDYRTDYKKYNVQELFEMKHKNK
Sbjct: 241 KVDLKNYDKLVLLQCFKNNIGMCVVDKDYRTDYKKYNVQELFEMKHKNK 289

>AFR250C [3442] [Homologous to ScYGL232W - SH] (887185..888018) [834
           bp, 277 aa]
          Length = 277

 Score =  283 bits (724), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 146/289 (50%), Positives = 193/289 (66%), Gaps = 14/289 (4%)

Query: 1   MAKRSRKDSKGGIVKRYKVVKSTLDPNTSGIYITCARNKEKAAASEILSIFEEKVEEYYS 60
           MAKR+R     G  K+YKVV +T+DPNTSGIY TCAR  EK A+ E++SI +EK EEYY 
Sbjct: 1   MAKRARSGDSSGPKKKYKVVHATIDPNTSGIYATCARRHEKQASRELMSILQEKAEEYYV 60

Query: 61  DELNAMNSASPDGSGSIEIESKEPVXXXXXXXXXXXXXXXXXXXGLKNHKTTIVDTKKNK 120
           DEL A+           E+ S +                     G     +  VDTKK K
Sbjct: 61  DELKAI--------AETELLSDKEDEEELSVEEQVQKELEQLKKG-----SGPVDTKK-K 106

Query: 121 PILEQLDLQTECLVFVKTRKPIVPEKFVHRIIRDLADPHDLRKRTRFVQKLTPITDSCHA 180
           P+L+++ L  EC+VF+KTR+PI PE FV R++++LA   +  K +R+VQ+LTPITDSC+A
Sbjct: 107 PVLQEIQLGCECMVFIKTRRPIKPECFVKRLVQELASSENTTKVSRYVQRLTPITDSCNA 166

Query: 181 SMEELAKLCERVLPQHFHKEEMVPVKFAVEINKRNFSTMDKMEMIKYIAGFVGKQGSLEH 240
           S+ EL KLC RVL  HFH ++ +  KFAVE+ KRNF+T+DKM++IK +A  VGK G L H
Sbjct: 167 SLTELEKLCRRVLAPHFHTDKEIKYKFAVEVVKRNFNTIDKMDIIKLVAKEVGKSGELGH 226

Query: 241 KVDLKNYDKLVLLQCFKNNIGMCVVDKDYRTDYKKYNVQELFEMKHKNK 289
            VDLK+YDKLV++QC+KNNIGM VVDKDY    KKYN+QE+++ K + K
Sbjct: 227 SVDLKDYDKLVIVQCYKNNIGMSVVDKDYSVALKKYNLQEIYDTKLQTK 275

>Kwal_47.19212
          Length = 266

 Score =  270 bits (690), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 142/275 (51%), Positives = 187/275 (68%), Gaps = 25/275 (9%)

Query: 16  RYKVVKSTLDPNTSGIYITCARNKEKAAASEILSIFEEKVEEYYSDELNAMNSAS---PD 72
           ++K    TL+P  SGIY TCAR  EK AA E+  +F+EK+EEYY+ EL  +N  S    D
Sbjct: 2   QHKFSSGTLEPCVSGIYATCARKHEKQAAQELSMLFQEKLEEYYAQELKELNDGSDSDTD 61

Query: 73  GSGSIEIESKEPVXXXXXXXXXXXXXXXXXXXGLKNHKTTIVDTKKNKPILEQLDLQTEC 132
              S+E   K+ +                    LK  KT      K K IL+ +DL  EC
Sbjct: 62  EDASVEDRIKKELD------------------SLKVKKTG----PKEKDILKFVDLNCEC 99

Query: 133 LVFVKTRKPIVPEKFVHRIIRDLADPHDLRKRTRFVQKLTPITDSCHASMEELAKLCERV 192
           +VF KTR+PIVPEKFVHR++ + ADP   +KRTR++QKLTP+T SC+AS+ EL+KL +RV
Sbjct: 100 VVFCKTRRPIVPEKFVHRLMEEFADPKVTQKRTRYIQKLTPVTFSCNASLPELSKLAQRV 159

Query: 193 LPQHFHKEEMVPVKFAVEINKRNFSTMDKMEMIKYIAGFVGKQGSLEHKVDLKNYDKLVL 252
           L  HFH++ + P+KFAVE+ +RNF+T+DKM++IK +A  VGK G LEHKVDLKNYDKLVL
Sbjct: 160 LKSHFHEDGVKPLKFAVEVTRRNFNTIDKMDIIKEVAKEVGKGGELEHKVDLKNYDKLVL 219

Query: 253 LQCFKNNIGMCVVDKDYRTDYKKYNVQELFEMKHK 287
           ++CFKNNIGM VVD DY   ++KYNVQ+++E K K
Sbjct: 220 VECFKNNIGMSVVDSDYLKLFRKYNVQQIYEAKIK 254

>YGL232W (TAN1) [1766] chr7 (62074..62130,62189..63001) Protein
           containing a thiouridine synthase, methylase, or
           pseudouridine synthase (THUMP) domain, which may bind
           RNA, has moderate similarity to uncharacterized C.
           albicans Orf6.8082p [870 bp, 289 aa]
          Length = 289

 Score =  244 bits (623), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 135/291 (46%), Positives = 181/291 (62%), Gaps = 24/291 (8%)

Query: 4   RSRKDSKGGIVKRYKVVKSTLDPNTSGIYITCARNKEKAAASEILSIFEEKVEEYYSDEL 63
           R+ KD+     K++KV    LDP TSGIY TC+R  E+ AA E+  +FEEK +E Y D  
Sbjct: 7   RNGKDANSQNRKKFKVSSGFLDPGTSGIYATCSRRHERQAAQELQLLFEEKFQELYGDIK 66

Query: 64  NAMNSASPDGSGSIEIESKEPVXXXXXXXXXXXXXXXXXXXGLKNHKT----TIVDTKKN 119
              + +  D    + IE +                       LK  +T    +  +TKK 
Sbjct: 67  EGEDESENDEKKDLSIEDQ----------------IKKELQELKGEETGKDLSSGETKKK 110

Query: 120 KPILEQLDLQTECLVFVKTRKPIVPEKFVHRIIRDLADPHDLRKRTRFVQKLTPITDSCH 179
            P L  +DL  EC+ F KTRKPIVPE+FV  I++DLADP ++ KRTR+VQKLTPIT SC+
Sbjct: 111 DP-LAFIDLNCECVTFCKTRKPIVPEEFVLSIMKDLADPKNMVKRTRYVQKLTPITYSCN 169

Query: 180 ASMEELAKLCERVLPQHFHKEEMVP--VKFAVEINKRNFSTMDKMEMIKYIAGFVGKQGS 237
           A ME+L KL   V+  HFH    V    KFAVE+ +RNF+T+++M++I  +   V K+GS
Sbjct: 170 AKMEQLIKLANLVIGPHFHDPSNVKKNYKFAVEVTRRNFNTIERMDIINQVVKLVNKEGS 229

Query: 238 -LEHKVDLKNYDKLVLLQCFKNNIGMCVVDKDYRTDYKKYNVQELFEMKHK 287
              H VDLKNYDKL+L++CFK+NIGMCVVD DY+T Y+KYNVQ+L+E K +
Sbjct: 230 EFNHTVDLKNYDKLILVECFKSNIGMCVVDGDYKTKYRKYNVQQLYESKFR 280

>Scas_712.19
          Length = 292

 Score =  243 bits (619), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 130/286 (45%), Positives = 178/286 (62%), Gaps = 16/286 (5%)

Query: 3   KRSRKDSKGGIV--KRYKVVKSTLDPNTSGIYITCARNKEKAAASEILSIFEEKVEEYYS 60
           KR   ++  G    K++K+    LDP TSGIY TC+R KE+ AA E+  +FEEK +E Y 
Sbjct: 4   KRPNSNASNGRTQKKKFKINSGFLDPGTSGIYATCSRRKERLAAQELGQLFEEKFQEMYK 63

Query: 61  DELNAMNSASPDGSGSIEIESKEPVXXXXXXXXXXXXXXXXXXXGLKNHKTTIVDTKKNK 120
           +EL   + +  +    + IE +                        K+H     D  K K
Sbjct: 64  EELTKDDDSDEENIDELSIEDQ--------IKQELSELHEKNKPTSKSH-----DNNKKK 110

Query: 121 PILEQLDLQTECLVFVKTRKPIVPEKFVHRIIRDLADPHDLRKRTRFVQKLTPITDSCHA 180
             L+ +DL  EC++F KTR PIVPE+FV +II DLA P ++ KRTR++ KLTPIT SC+A
Sbjct: 111 EPLQFIDLDCECVIFCKTRSPIVPEEFVAKIIEDLASPDNMEKRTRYIAKLTPITYSCNA 170

Query: 181 SMEELAKLCERVLPQHFHKEEMVP-VKFAVEINKRNFSTMDKMEMIKYIAGFVGKQGSLE 239
           +ME+L  L +R+L  HFH E     +KFAVE+ +RNF+T+ KM++I  +   V ++G L 
Sbjct: 171 TMEQLILLAQRILAPHFHGEHSEDGLKFAVEVTRRNFNTIPKMDIINQVVKEVTEKGKLN 230

Query: 240 HKVDLKNYDKLVLLQCFKNNIGMCVVDKDYRTDYKKYNVQELFEMK 285
           HKVDLKNYDKLVL++CFKNNIGM VV  DY T Y+KYNVQ+++E K
Sbjct: 231 HKVDLKNYDKLVLVECFKNNIGMSVVSGDYLTKYRKYNVQQIYEAK 276

>CAGL0H07931g 775729..776526 similar to sp|P53072 Saccharomyces
           cerevisiae YGL232w, start by similarity
          Length = 265

 Score =  214 bits (546), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 117/275 (42%), Positives = 169/275 (61%), Gaps = 28/275 (10%)

Query: 14  VKRYKVVKSTLDPNTSGIYITCARNKEKAAASEILSIFEEKVEEYYSDELNAMNSASPDG 73
           +K++K+    LDP TSGIY TC R KEKAA SE+  + EEK+EE Y +  + +  +  D 
Sbjct: 16  IKKFKIATGFLDPGTSGIYATCTRRKEKAAISEMGILLEEKIEELYGE--SEVADSDVDE 73

Query: 74  SGSIEIESKEPVXXXXXXXXXXXXXXXXXXXGLKNHKTTIVDTKKNKPILEQLDLQTECL 133
           +GSIE E  + +                             D +  K +L+ +DLQ EC+
Sbjct: 74  AGSIEDEVAKELAQL----------------------KKNKDDQDKKQLLKAIDLQCECV 111

Query: 134 VFVKTRKPIVPEKFVHRIIRDLADPHDLRKRTRFVQKLTPITDSCHASMEELAKLCERVL 193
           VF KTRKP+ P   V  II D ++P    KRTR++QKLTPIT SC+A+ E+  KL ++V+
Sbjct: 112 VFFKTRKPVNPTTLVKAIIDDFSNPESKVKRTRYIQKLTPITYSCNATKEQFQKLIDQVV 171

Query: 194 PQHFHKEEMVPVKFAVEINKRNFSTMDKMEMIKYIAGFVGKQGSLEHKVDLKNYDKLVLL 253
              F  ++    KFAVE+ +RNF+TM++M++I  +   V K G   HKVDLKNYDK++++
Sbjct: 172 EPAFKSDQ--SYKFAVEVTRRNFNTMERMDIINTVVSTVMKHG--HHKVDLKNYDKVIMV 227

Query: 254 QCFKNNIGMCVVDKDYRTDYKKYNVQELFEMKHKN 288
           +CFKNNIGM V+D DY   +KKYN+Q+++E K K+
Sbjct: 228 ECFKNNIGMSVLDNDYSKKHKKYNLQQIYEAKFKD 262

>Sklu_2433.12 YGL232W, Contig c2433 21601-22035
          Length = 144

 Score =  187 bits (476), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 87/134 (64%), Positives = 109/134 (81%)

Query: 152 IRDLADPHDLRKRTRFVQKLTPITDSCHASMEELAKLCERVLPQHFHKEEMVPVKFAVEI 211
           + + A+P DL KRTR+VQKLTPIT SC+A+M EL KL +RVL  HFH++E    KFA++I
Sbjct: 1   MEEFANPKDLTKRTRYVQKLTPITYSCNATMPELIKLAQRVLAPHFHQDETKAYKFAIDI 60

Query: 212 NKRNFSTMDKMEMIKYIAGFVGKQGSLEHKVDLKNYDKLVLLQCFKNNIGMCVVDKDYRT 271
            +RNF+T+DKMEMIK IA  VGK G L+H VDLKN+DKLVL++CFKNNIGM VV+ DYRT
Sbjct: 61  TRRNFNTLDKMEMIKQIASEVGKNGQLKHTVDLKNFDKLVLVECFKNNIGMSVVNADYRT 120

Query: 272 DYKKYNVQELFEMK 285
            +KKYNVQ+L+E K
Sbjct: 121 KFKKYNVQQLYEAK 134

>Kwal_23.4717
          Length = 527

 Score = 29.6 bits (65), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 42/89 (47%), Gaps = 4/89 (4%)

Query: 179 HASMEELAKLCERVLPQHFHKEEMVPVKFAVEINKRNFSTMDKMEMIKYIAGFVGKQGSL 238
           +ASM+EL +L E++   + H    V  +FA E+     +   K + ++++   + + G  
Sbjct: 297 YASMDELIELSEQL---YLHVLNRVDNRFARELKNELLANAGKFKRVEFLPTLLRETGVD 353

Query: 239 EHKVDLKNYDKLVLLQCFKNNIGMCVVDK 267
             ++DL N D L+       NI M    K
Sbjct: 354 FTQIDLHNSD-LISRALIAKNIHMDTTGK 381

>CAGL0M10527g complement(1052421..1059914) similar to sp|P35194
            Saccharomyces cerevisiae YBL004w, start by similarity
          Length = 2497

 Score = 28.9 bits (63), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 18/29 (62%)

Query: 29   SGIYITCARNKEKAAASEILSIFEEKVEE 57
            SG Y TCA  + +   +++LS F E+ +E
Sbjct: 1275 SGFYQTCADKETRLGVNDVLSAFSERFDE 1303

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.133    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,049,319
Number of extensions: 371062
Number of successful extensions: 1150
Number of sequences better than 10.0: 12
Number of HSP's gapped: 1140
Number of HSP's successfully gapped: 12
Length of query: 304
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 203
Effective length of database: 13,099,691
Effective search space: 2659237273
Effective search space used: 2659237273
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 61 (28.1 bits)