Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0A01023g86184842670.0
Sklu_2433.1188484324510.0
AFR251C86882623560.0
Kwal_47.1921487683821090.0
Scas_712.1888284020670.0
YGL233W (SEC15)91086220690.0
CAGL0H07909g88283620210.0
KLLA0D13772g34576740.92
AFR286W175848721.9
AER304C325843722.0
AEL086W96061703.2
Scas_706.211304147703.2
Kwal_23.610696049686.3
YNL311C763128677.5
KLLA0F26455g863157678.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A01023g
         (848 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A01023g 96383..98968 similar to sp|P22224 Saccharomyces cer...  1648   0.0  
Sklu_2433.11 YGL233W, Contig c2433 17844-20498                        948   0.0  
AFR251C [3443] [Homologous to ScYGL233W (SEC15) - SH] (888186..8...   912   0.0  
Kwal_47.19214                                                         816   0.0  
Scas_712.18                                                           800   0.0  
YGL233W (SEC15) [1765] chr7 (59121..61853) Component of exocyst ...   801   0.0  
CAGL0H07909g 772741..775389 similar to sp|P22224 Saccharomyces c...   783   0.0  
KLLA0D13772g 1185663..1186700 some similarities with sp|Q8J1F4 A...    33   0.92 
AFR286W [3478] [Homologous to ScYKR095W (MLP1) - SH; ScYIL149C (...    32   1.9  
AER304C [2806] [Homologous to ScYDR457W (TOM1) - SH] (1194908..1...    32   2.0  
AEL086W [2420] [Homologous to ScYDL031W (DBP10) - SH] complement...    32   3.2  
Scas_706.21                                                            32   3.2  
Kwal_23.6106                                                           31   6.3  
YNL311C (YNL311C) [4302] chr14 complement(49396..51687) Protein ...    30   7.5  
KLLA0F26455g 2450871..2453462 similar to sp|P36016 Saccharomyces...    30   8.8  

>KLLA0A01023g 96383..98968 similar to sp|P22224 Saccharomyces
           cerevisiae YGL233w SEC15 vesicular traffic control
           protein singleton, start by similarity
          Length = 861

 Score = 1648 bits (4267), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 821/848 (96%), Positives = 821/848 (96%)

Query: 1   MDQDPQLAVSQDLQRALLTAEFVSKSGSSNQDQGEDELFELDPQIFDRWVPLLRQTIDEG 60
           MDQDPQLAVSQDLQRALLTAEFVSKSGSSNQDQGEDELFELDPQIFDRWVPLLRQTIDEG
Sbjct: 1   MDQDPQLAVSQDLQRALLTAEFVSKSGSSNQDQGEDELFELDPQIFDRWVPLLRQTIDEG 60

Query: 61  QLNTVIDDLYASIDDHFENLETQILQDSQINNNLVTSINEIQKVQQIIDGSLQNDIKNLQ 120
           QLNTVIDDLYASIDDHFENLETQILQDSQINNNLVTSINEIQKVQQIIDGSLQNDIKNLQ
Sbjct: 61  QLNTVIDDLYASIDDHFENLETQILQDSQINNNLVTSINEIQKVQQIIDGSLQNDIKNLQ 120

Query: 121 SQVRHSTLNLVSRKQILIDNXXXXXXXXXXXXLIQKVLQILELFNRCRELIEEKDFFKAL 180
           SQVRHSTLNLVSRKQILIDN            LIQKVLQILELFNRCRELIEEKDFFKAL
Sbjct: 121 SQVRHSTLNLVSRKQILIDNTKTSSKITESSILIQKVLQILELFNRCRELIEEKDFFKAL 180

Query: 181 QTIETFETIYLQDFKQYNFEFLNQIYTSIPMLKSQIKDESINLIKKSLNYNLEKTFSVIG 240
           QTIETFETIYLQDFKQYNFEFLNQIYTSIPMLKSQIKDESINLIKKSLNYNLEKTFSVIG
Sbjct: 181 QTIETFETIYLQDFKQYNFEFLNQIYTSIPMLKSQIKDESINLIKKSLNYNLEKTFSVIG 240

Query: 241 EKYYDVYETQILQDWLKTKQSMKLHNYKFNSPVEISLRDTSKLDSLQLQNFCQLHEFHDS 300
           EKYYDVYETQILQDWLKTKQSMKLHNYKFNSPVEISLRDTSKLDSLQLQNFCQLHEFHDS
Sbjct: 241 EKYYDVYETQILQDWLKTKQSMKLHNYKFNSPVEISLRDTSKLDSLQLQNFCQLHEFHDS 300

Query: 301 ILIFQSLNEMDFFIDEFRKEYEFRKSKLIHPLFLKDFSTVSHSNGKIDAFAEKLDLSFFK 360
           ILIFQSLNEMDFFIDEFRKEYEFRKSKLIHPLFLKDFSTVSHSNGKIDAFAEKLDLSFFK
Sbjct: 301 ILIFQSLNEMDFFIDEFRKEYEFRKSKLIHPLFLKDFSTVSHSNGKIDAFAEKLDLSFFK 360

Query: 361 EYILKILGFLVYDKELHKSTDYVLSNNNNPNSTDIFWTSIMNKLYPYLITMVKEKLTTEQ 420
           EYILKILGFLVYDKELHKSTDYVLSNNNNPNSTDIFWTSIMNKLYPYLITMVKEKLTTEQ
Sbjct: 361 EYILKILGFLVYDKELHKSTDYVLSNNNNPNSTDIFWTSIMNKLYPYLITMVKEKLTTEQ 420

Query: 421 LLTEFKDFLGVLIAILENLKLNVELLYKVQVETFSQYCELLVFLFQKEFTNLLQDDDFMP 480
           LLTEFKDFLGVLIAILENLKLNVELLYKVQVETFSQYCELLVFLFQKEFTNLLQDDDFMP
Sbjct: 421 LLTEFKDFLGVLIAILENLKLNVELLYKVQVETFSQYCELLVFLFQKEFTNLLQDDDFMP 480

Query: 481 LAITDKALYEKILKICWLADQGSDTSNTTNDNFSATFPFSPLYPMTCTLVKKTYSSLHSF 540
           LAITDKALYEKILKICWLADQGSDTSNTTNDNFSATFPFSPLYPMTCTLVKKTYSSLHSF
Sbjct: 481 LAITDKALYEKILKICWLADQGSDTSNTTNDNFSATFPFSPLYPMTCTLVKKTYSSLHSF 540

Query: 541 ISIFYKHDISHLNLIVIKAIDNIFDRVVNDNIKSKLDTTSREEIAQILVNLDYFVIAAKE 600
           ISIFYKHDISHLNLIVIKAIDNIFDRVVNDNIKSKLDTTSREEIAQILVNLDYFVIAAKE
Sbjct: 541 ISIFYKHDISHLNLIVIKAIDNIFDRVVNDNIKSKLDTTSREEIAQILVNLDYFVIAAKE 600

Query: 601 FSLILTRENLTNNPDVEIRLSSIKKLIETRKEAETKLITLIDSKVIDLMEFIEFDWNSTE 660
           FSLILTRENLTNNPDVEIRLSSIKKLIETRKEAETKLITLIDSKVIDLMEFIEFDWNSTE
Sbjct: 601 FSLILTRENLTNNPDVEIRLSSIKKLIETRKEAETKLITLIDSKVIDLMEFIEFDWNSTE 660

Query: 661 VRTEPDMTIVDIAQFLEMMFTSTLAIIPYNIKMLLIFREFDVITRRFLEKLLNETPDRIS 720
           VRTEPDMTIVDIAQFLEMMFTSTLAIIPYNIKMLLIFREFDVITRRFLEKLLNETPDRIS
Sbjct: 661 VRTEPDMTIVDIAQFLEMMFTSTLAIIPYNIKMLLIFREFDVITRRFLEKLLNETPDRIS 720

Query: 721 PQSVQNFETDMLYLEKTITKIFPNDVSSVPTSPSIPATPTDVPSTAGNRSSTQVENNIKS 780
           PQSVQNFETDMLYLEKTITKIFPNDVSSVPTSPSIPATPTDVPSTAGNRSSTQVENNIKS
Sbjct: 721 PQSVQNFETDMLYLEKTITKIFPNDVSSVPTSPSIPATPTDVPSTAGNRSSTQVENNIKS 780

Query: 781 LLSTFTDLKQHIGLMKINHWDEYKDNDIRLKKYSRVKPEVAXXXXXXXXXXXXXXXNLVS 840
           LLSTFTDLKQHIGLMKINHWDEYKDNDIRLKKYSRVKPEVA               NLVS
Sbjct: 781 LLSTFTDLKQHIGLMKINHWDEYKDNDIRLKKYSRVKPEVAQSLLSKLQPPSSEQSNLVS 840

Query: 841 DEGSSAES 848
           DEGSSAES
Sbjct: 841 DEGSSAES 848

>Sklu_2433.11 YGL233W, Contig c2433 17844-20498
          Length = 884

 Score =  948 bits (2451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/843 (56%), Positives = 633/843 (75%), Gaps = 27/843 (3%)

Query: 1   MDQDPQLAVSQDLQRALLTAEFVS-----------KSGSSNQDQGEDELFELDPQIFDRW 49
           MDQ+PQ  VSQ+LQ+ LL+++F +           K  +++    +D++ ELD Q FDRW
Sbjct: 1   MDQEPQSLVSQELQKVLLSSDFSTLASPITAQNNNKQSNTSASLLQDDIIELDEQSFDRW 60

Query: 50  VPLLRQTIDEGQLNTVIDDLYASIDDHFENLETQILQDSQINNNLVTSINEIQKVQQIID 109
           VPLLR +I++  L  ++++L+ S+DD+F++LET+ILQDSQIN+NL TSINEI+ +Q++I+
Sbjct: 61  VPLLRTSIEDSSLTKLVEELFNSVDDNFQSLETRILQDSQINDNLTTSINEIESIQKLIN 120

Query: 110 GSLQNDIKNLQSQVRHSTLNLVSRKQILIDNXXXXXXXXXXXXLIQKVLQILELFNRCRE 169
           GSLQ ++ +LQ Q+  ST +++ +KQILI+N            LI K+LQILEL NRC++
Sbjct: 121 GSLQQEVSDLQQQLSQSTNDVILKKQILINNRKTSMKISESMILINKILQILELSNRCQD 180

Query: 170 LIEEKDFFKALQTIETFETIYLQDFKQYNFEFLNQIYTSIPMLKSQIKDESINLIKKSLN 229
           LI+E DFFKALQ+++  E IYLQDFK YNF+FL +IY SIP LKS IKDESINLIKKS  
Sbjct: 181 LIKEGDFFKALQSLDNLEKIYLQDFKNYNFDFLKEIYNSIPFLKSIIKDESINLIKKSFT 240

Query: 230 YNLEKTFSVIGEKYYDVYETQILQDWLKTKQSMKLHNYKFNSPVEISLRDTSKLDSLQLQ 289
            NLEKT   +G KY++VY+  +L+DWL+ K SMKL N+KFNS VE++LRD   L+ L+ +
Sbjct: 241 SNLEKTLFTVGSKYFEVYQEVLLKDWLELKHSMKLGNFKFNSSVELALRDQKGLELLKAE 300

Query: 290 NFCQLHEFHDSILIFQSLNEMDFFIDEFRKEYEFRKSKLIHPLFLKDFSTVSHSNGKI-- 347
           NF  L EFHDSILIFQ+L E+D+  +EF KEY+FRK+KL++PL LK+ +T S  NG+   
Sbjct: 301 NFYHLDEFHDSILIFQNLKELDYLCEEFIKEYDFRKAKLVYPLELKNTTTSSSLNGQNQS 360

Query: 348 ---DAFAEKLDLSFFKEYILKILGFLVYDKELHKSTDYVLSNNNNPNSTDIFWTSIMNKL 404
              D F E L++SF KEY+LKILGFL+YDK L+KSTDYVLS N+  N+T+ FW  +M KL
Sbjct: 361 HLDDVFGENLNMSFLKEYLLKILGFLIYDKHLNKSTDYVLSFNSY-NTTNEFWDILMKKL 419

Query: 405 YPYLITMVKEKLTTEQLLTEFKDFLGVLIAILENLKLNVELLYKVQVETFSQYCELLVFL 464
            P+L   V   LTTE+ L +FKDFLG+ IAILENLKLN+E LY++ +  F +YC LLV  
Sbjct: 420 APHLQQFVTRNLTTEEELVQFKDFLGIFIAILENLKLNIETLYRIHITVFEKYCNLLVHK 479

Query: 465 FQKEFTNLLQDDDFMPLAITDKALYEKILKICWLADQGSDT----SNTTNDNFSATFPFS 520
           F +EF+ LL DDDFMPL   D+ LYEK+LKICWL ++  +      +  N +F AT PFS
Sbjct: 480 FSEEFSTLLNDDDFMPLTTNDRNLYEKVLKICWLKEEEPEKMKEQQDPANGDFLATLPFS 539

Query: 521 PLYPMTCTLVKKTYSSLHSFISIFYKHDISHLNLIVIKAIDNIFDRVVNDNIKSKLDTTS 580
           PLYPM CTL KKTY  + +F++ FY+H++ HLN I++K +D+IF +VVN+ I+SKLDTTS
Sbjct: 540 PLYPMACTLAKKTYGKIVTFLNNFYQHELYHLNTILVKTMDSIFQKVVNNKIRSKLDTTS 599

Query: 581 REEIAQILVNLDYFVIAAKEFSLILTRENLTNNPDVEIRLSSIKKLIETRKEAETKLITL 640
           REEIAQ+L+NLDYFVIAA+EFS ILTREN+  NPDVEIRL+S ++L E+RK AETKLI L
Sbjct: 600 REEIAQVLINLDYFVIAAREFSSILTRENIIQNPDVEIRLASAEQLTESRKYAETKLIEL 659

Query: 641 IDSKVIDLMEFIEFDWNSTEVRTEPDMTIVDIAQFLEMMFTSTLAIIPYNIKMLLIFREF 700
           IDSKV DLMEF+E DW +T ++ EPD++I DIAQFLEMMFTSTL  +PY++K LLIFREF
Sbjct: 660 IDSKVSDLMEFVELDWVATTIKQEPDISIRDIAQFLEMMFTSTLVNLPYSVKTLLIFREF 719

Query: 701 DVITRRFLEKLLNETPDRISPQSVQNFETDMLYLEKTITKIFPNDVSSVP--TSPSIPAT 758
           D +TRRFLE LLN TP  I+PQSV NFE DM +LE  ++KIFP++   +P  +SPS P +
Sbjct: 720 DSLTRRFLEMLLNGTPSTITPQSVLNFEMDMKFLEGIVSKIFPSETKELPFESSPS-PDS 778

Query: 759 PTDVPSTAGNRSSTQVENNIKSLLSTFTDLKQHIGLMKINHWDEYKDNDIRLKKYSRVKP 818
           P     +   R+S  +ENN++SL STFTDLKQHI LMK ++ +EYKD  IR++KY R++P
Sbjct: 779 PL---QSDQARASNLIENNVRSLQSTFTDLKQHIQLMKASNLEEYKDPSIRMRKYPRIRP 835

Query: 819 EVA 821
           EVA
Sbjct: 836 EVA 838

>AFR251C [3443] [Homologous to ScYGL233W (SEC15) - SH]
           (888186..890792) [2607 bp, 868 aa]
          Length = 868

 Score =  912 bits (2356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/826 (54%), Positives = 618/826 (74%), Gaps = 8/826 (0%)

Query: 1   MDQDPQLAVSQDLQRALLTAEFVS-KSGSSNQDQGEDELFELDPQIFDRWVPLLRQTIDE 59
           ++Q+P   +SQ+LQ+ LLTAEF + +       +  D L  L  Q F++WVP LRQ ++ 
Sbjct: 5   LEQEPHTQLSQELQKVLLTAEFAATRDDDYTPGETGDGLMCLSDQTFEKWVPYLRQAVES 64

Query: 60  GQLNTVIDDLYASIDDHFENLETQILQDSQINNNLVTSINEIQKVQQIIDGSLQNDIKNL 119
            +L+ V++++Y+S++++F+N ETQILQDSQ+++NL  SI+E  ++Q + +  LQ  + +L
Sbjct: 65  DRLDGVVEEVYSSVEENFQNFETQILQDSQVSDNLSFSIDENDRIQNLAESYLQGQVADL 124

Query: 120 QSQVRHSTLNLVSRKQILIDNXXXXXXXXXXXXLIQKVLQILELFNRCRELIEEKDFFKA 179
           Q+ +  ST  +VS+K+ L  N            LI+K+ Q+LEL N+C+ELI + +F+KA
Sbjct: 125 QAHLSASTNEVVSKKRALTSNRRTSIKISESIILIEKIFQMLELTNKCQELIRDGNFYKA 184

Query: 180 LQTIETFETIYLQDFKQYNFEFLNQIYTSIPMLKSQIKDESINLIKKSLNYNLEKTFSVI 239
           LQ ++  E IY+ DFK Y FEFL  IY SIP LK+ IKDESINLIKKSL+ NLEKT S +
Sbjct: 185 LQNLDKLERIYIHDFKNYKFEFLAVIYNSIPKLKNIIKDESINLIKKSLSSNLEKTLSQV 244

Query: 240 GEKYYDVYETQILQDWLKTKQSMKLHNYKFNSPVEISLRDTSKLDSLQLQNFCQLHEFHD 299
           G+ Y+ VY  Q+L  WL  K++MKL NYKFNSPVE+SLRD S L  L+L+++  L EF+D
Sbjct: 245 GQTYFQVYNDQLLPHWLAMKKAMKLSNYKFNSPVEVSLRDDSFLAGLKLEDYYNLDEFYD 304

Query: 300 SILIFQSLNEMDFFIDEFRKEYEFRKSKLIHPLFLKDFSTVSHS-NGKIDAFAEKLDLSF 358
           SI+IF+SL E ++  DEF KEY+FRK KL++PL  K  +T++HS N ++D+F ++L L F
Sbjct: 305 SIMIFESLKETNYLCDEFTKEYDFRKVKLVYPLDWKSTTTMTHSANEQVDSFYQQLSLPF 364

Query: 359 FKEYILKILGFLVYDKELHKSTDYVLSNNNNPNSTDIFWTSIMNKLYPYLITMVKEKLTT 418
            KEY+LKILGFL+YDK LHKSTDY+ + N    +T+ FW   M K+ P+L   +KEKLTT
Sbjct: 365 LKEYLLKILGFLLYDKFLHKSTDYIFAYNTY-TTTEEFWEQFMTKVSPHLSRFIKEKLTT 423

Query: 419 EQLLTEFKDFLGVLIAILENLKLNVELLYKVQVETFSQYCELLVFLFQKEFTNLLQDDDF 478
           E  L EFK+FLG+LIAILEN+KLN E +YK+QV+ F +YC LL+ +F KEFTNLL DDDF
Sbjct: 424 EDQLIEFKNFLGILIAILENMKLNSESMYKIQVQVFEKYCGLLIHVFDKEFTNLLNDDDF 483

Query: 479 MPLAITDKALYEKILKICWL-ADQGSDTSNTTNDNFSATFPFSPLYPMTCTLVKKTYSSL 537
           MPL I+D+  YEK++K+CW+  D     +    + FS T PFSPLYPMTC L+KK+Y+++
Sbjct: 484 MPLPISDRNFYEKVMKLCWMKPDSVPIVTQDDANGFSVTLPFSPLYPMTCALIKKSYANM 543

Query: 538 HSFISIFYKHDISHLNLIVIKAIDNIFDRVVNDNIKSKLDTTSREEIAQILVNLDYFVIA 597
             F++ F++HD+S+LN+++++ +D+IF +VVN+ I+SKLDTTSREEIAQIL+NLDYF++A
Sbjct: 544 LLFLNTFFQHDLSYLNIVLVRTVDDIFIKVVNNKIRSKLDTTSREEIAQILINLDYFIVA 603

Query: 598 AKEFSLILTRENLTNNPDVEIRLSSIKKLIETRKEAETKLITLIDSKVIDLMEFIEFDWN 657
           AKEFS I+T+EN+T NPD+EI+LSS K+L +T+K AETKLI LIDSKV DLMEF+E DW 
Sbjct: 604 AKEFSDIMTKENITQNPDIEIKLSSTKQLADTKKYAETKLIELIDSKVTDLMEFVELDWT 663

Query: 658 STEVRTEPDMTIVDIAQFLEMMFTSTLAIIPYNIKMLLIFREFDVITRRFLEKLLNETPD 717
           + EVR EP ++I DIAQFLEMMFTSTLA +PY+IK LLIFREFD +TR+FLE L++E+P 
Sbjct: 664 TEEVRDEPGLSIRDIAQFLEMMFTSTLANLPYSIKSLLIFREFDQLTRKFLELLVHESPS 723

Query: 718 RISPQSVQNFETDMLYLEKTITKIFPNDVS--SVPTSPSIPATPTDVPSTAGNRSSTQVE 775
            I+ QSV NFETDM +LE  I+ IFPN+ +  +V  SPS P TP  V  +   +S   +E
Sbjct: 724 YITTQSVANFETDMKFLENVISNIFPNESTEQNVEISPSTPTTP--VADSFNVKSPNMIE 781

Query: 776 NNIKSLLSTFTDLKQHIGLMKINHWDEYKDNDIRLKKYSRVKPEVA 821
           +N++SL STFTDL QHI LMK N++DEYKD+ IR++KY R+KPEVA
Sbjct: 782 SNVRSLFSTFTDLNQHILLMKSNNFDEYKDSSIRMRKYPRIKPEVA 827

>Kwal_47.19214
          Length = 876

 Score =  816 bits (2109), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/838 (49%), Positives = 585/838 (69%), Gaps = 23/838 (2%)

Query: 1   MDQDPQLAVSQDLQRALLTAEFVSKSGSSNQDQGEDELFELDP----------QIFDRWV 50
           M+ D Q  +S++LQ+ LL+ +    S   +   G+DE+ E+              F++W 
Sbjct: 1   MEGDAQSLISEELQQVLLSTDL---SFLKSLQTGQDEIAEVAGEYEEELDLDEHTFNKWT 57

Query: 51  PLLRQTIDEGQLNTVIDDLYASIDDHFENLETQILQDSQINNNLVTSINEIQKVQQIIDG 110
           PLLR  I++  L  V+++LY SI+D+FENLE+QILQDSQ+++NL  S+ +I  ++++I+G
Sbjct: 58  PLLRSAIEDESLPLVVEELYNSIEDNFENLESQILQDSQLSDNLTASVGQIASIKEVIEG 117

Query: 111 SLQNDIKNLQSQVRHSTLNLVSRKQILIDNXXXXXXXXXXXXLIQKVLQILELFNRCREL 170
           SL  +I++L  Q+  +T ++++RKQ  I+N            LI KVLQILEL  +C++L
Sbjct: 118 SLLQEIEDLHIQLAETTNDVITRKQNYINNKKISTKISETIILITKVLQILELSKKCQDL 177

Query: 171 IEEKDFFKALQTIETFETIYLQDFKQYNFEFLNQIYTSIPMLKSQIKDESINLIKKSLNY 230
           I+E+ +FKALQ++   E IY+QDFK YNF+FL +IY SIP+LKS+IKDESINL+K S N 
Sbjct: 178 IKERSYFKALQSLGGLEKIYVQDFKNYNFDFLKKIYASIPILKSKIKDESINLVKSSFNS 237

Query: 231 NLEKTFSVIGEKYYDVYETQILQDWLKTKQSMKLHNYKFNSPVEISLRDTSKLDSLQLQN 290
           NLEK    +G+ ++D Y   +L DWL ++  +KL N+KFNSPVEISLRDT++L+SL +  
Sbjct: 238 NLEKKLLTVGQTFFDFYHDVLLSDWLNSRSELKLSNFKFNSPVEISLRDTTQLESLNVAT 297

Query: 291 FCQLHEFHDSILIFQSLNEMDFFIDEFRKEYEFRKSKLIHPLFLKDFSTVSHSNGKI--- 347
              L EF+DSILIFQ+L E+D+   EF+KEY+FR SK++HPL LK  ++ + +  K+   
Sbjct: 298 LYPLDEFYDSILIFQNLKEIDYLRTEFKKEYDFRTSKVVHPLELKVSASATPAEQKLQVT 357

Query: 348 DAFAEKLDLSFFKEYILKILGFLVYDKELHKSTDYVLSNNNNPNSTDIFWTSIMNKLYPY 407
           + FA+       K Y+L+ILGF++YD+ L+KST+YVLS N   N+++ FW   +N+  P+
Sbjct: 358 NLFADDFTQDQLKHYLLRILGFVIYDRHLNKSTEYVLSFNQF-NTSESFWELFINRFSPF 416

Query: 408 LITMVKEKLTTEQLLTEFKDFLGVLIAILENLKLNVELLYKVQVETFSQYCELLVFLFQK 467
           L   V  ++ TE+ + + KDFLGV IAILEN+ +N+E +Y++ V  F +Y   LV +F  
Sbjct: 417 LEHFVNSRINTEEEMIDLKDFLGVYIAILENIGVNIEQIYRINVLLFKKYARFLVQMFDS 476

Query: 468 EFTNLLQDDDFMPLAITDKALYEKILKICWLA----DQGSDTSNTTNDNFSATFPFSPLY 523
           EF+ LL DDDFMPL I D  LYEK+LKICWL     D+      T  ++F AT PFSPLY
Sbjct: 477 EFSTLLDDDDFMPLTINDHGLYEKVLKICWLREDELDKFGSIEQTPGESFFATLPFSPLY 536

Query: 524 PMTCTLVKKTYSSLHSFISIFYKHDISHLNLIVIKAIDNIFDRVVNDNIKSKLDTTSREE 583
           PMTCTL KK Y+ L  F++ F+++D+  LN ++++ ID+IF ++VND I +K DTTSREE
Sbjct: 537 PMTCTLAKKCYNKLVGFLTDFFQYDLGELNHVIVQMIDDIFGKIVNDKIAAKSDTTSREE 596

Query: 584 IAQILVNLDYFVIAAKEFSLILTRENLTNNPDVEIRLSSIKKLIETRKEAETKLITLIDS 643
           IAQIL+NLDYF++A KEFS IL+REN+ +NP VE+ L + K+L ++R   ETKLI LIDS
Sbjct: 597 IAQILINLDYFIVAVKEFSNILSRENIMHNPGVELGLQATKQLSKSRTLTETKLIALIDS 656

Query: 644 KVIDLMEFIEFDWNSTEVRTEPDMTIVDIAQFLEMMFTSTLAIIPYNIKMLLIFREFDVI 703
           KV DLMEF+EF+W S E+  EPD +I DIAQFLEMMF STL  +P ++K LLIFREFD +
Sbjct: 657 KVSDLMEFVEFEWASQEILREPDYSIKDIAQFLEMMFNSTLVNLPDSVKTLLIFREFDAL 716

Query: 704 TRRFLEKLLNETPDRISPQSVQNFETDMLYLEKTITKIFPNDVSSVPTSPSIPATPTDVP 763
           TRRFL+ LLN+TP  I+PQS+ NFE +M +LE  ITK+FP+   S P +P+ P  P+   
Sbjct: 717 TRRFLDVLLNQTPSVITPQSILNFERNMDFLEAIITKLFPSS-DSTPQTPTSPEIPSGQF 775

Query: 764 STAGNRSSTQVENNIKSLLSTFTDLKQHIGLMKINHWDEYKDNDIRLKKYSRVKPEVA 821
           S    RSS  + N ++SL STF+DLKQHI  +K    +EYKD+ IR++KY R+KPEVA
Sbjct: 776 SDNA-RSSNVINNTVRSLHSTFSDLKQHIQFLKSPDMEEYKDSSIRMRKYPRIKPEVA 832

>Scas_712.18
          Length = 882

 Score =  800 bits (2067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/840 (49%), Positives = 573/840 (68%), Gaps = 29/840 (3%)

Query: 4   DPQLAVSQDLQRALLTAEFVSKSGSSNQDQGE-----------DELFELDPQIFDRWVPL 52
           D ++ +SQD Q+ LL+ E      +++ D+ E           ++ FELDPQ FD+WVP 
Sbjct: 2   DQEVLLSQDFQKILLSYEPKKAETTTSHDKEENASEYKDLGMEEDAFELDPQSFDKWVPF 61

Query: 53  LRQTIDEGQLNTVIDDLYASIDDHFENLETQILQDSQINNNLVTSINEIQKVQQIIDGSL 112
           LR  +++ QL T+I +L  SIDD+F+ LE Q+LQDSQIN+ L TSINEI  +Q +ID SL
Sbjct: 62  LRSAVEKNQLGTIIQELDTSIDDNFQGLELQLLQDSQINDKLETSINEISNIQNMIDTSL 121

Query: 113 QNDIKNLQSQVRHSTLNLVSRKQILIDNXXXXXXXXXXXXLIQKVLQILELFNRCRELIE 172
              I NLQ Q+  +T  L+ +KQ+ ++N            L+ KV++ILEL ++C+ELI 
Sbjct: 122 SGGILNLQEQLTQTTNELIIKKQVFVNNKKTSLKISELTILLTKVVRILELSSKCQELIT 181

Query: 173 EKDFFKALQTIETFETIYLQDFKQYNFEFLNQIYTSIPMLKSQIKDESINLIKKSLNYNL 232
           E +FFKALQ +++ E IYLQ+F+ YNF+FL +IY SIP LKS  KDE +NLI+ SLN NL
Sbjct: 182 EGNFFKALQNLDSLEKIYLQEFRNYNFKFLKEIYDSIPYLKSVTKDECLNLIRNSLNSNL 241

Query: 233 EKTFSVIGEKYYDVYETQILQDWLKTKQSMKLHNYKFNSPVEISLRDTSKLDSLQLQNFC 292
            K  + +G  ++D Y+ ++L  WL+ K+SMKL  +KFNSPVEIS+RD + L  L L+ F 
Sbjct: 242 GKNLTDVGMSFFDTYQNELLPKWLEIKKSMKLEKFKFNSPVEISMRDQASLKKLNLEKFF 301

Query: 293 QLHEFHDSILIFQSLNEMDFFIDEFRKEYEFRKSKLIHPLFLKDFSTVSHSNGKI----- 347
            + EF+DSI+IFQ+LN++D+   EF KEYEFRK+KLI+PL  K     S+SN  I     
Sbjct: 302 HIEEFYDSIMIFQTLNKLDYLFSEFSKEYEFRKTKLIYPLLWK---RASNSNANIPPGDI 358

Query: 348 --DAFAEKLDLSFFKEYILKILGFLVYDKELHKSTDYVLSNNNNPNSTDIFWTSIMNKLY 405
             DAF ++++L F KEY  KILGFL+YD  L+KSTD+VL +NN  N+T+ FW  +MN+L 
Sbjct: 359 SSDAFTKQMNLKFLKEYFWKILGFLLYDINLNKSTDFVLVDNNY-NATNEFWDGLMNRLQ 417

Query: 406 PYLITMVKEKLTTEQLLTEFKDFLGVLIAILENLKLNVELLYKVQVETFSQYCELLVFLF 465
           PYL   +   L  +    EFKDF+ + +AILEN KL+++ LY++ +  F +YC++ +  F
Sbjct: 418 PYLRHFIVTGLNDDDSFVEFKDFMCIYVAILENYKLSIDPLYEILILLFDRYCDISIRYF 477

Query: 466 QKEFTNLLQDDDFMPLAITDKALYEKILKICWLADQGSDTSNTTNDNFSATFPFSPLYPM 525
             EF  LL DDDFMPL I DK L++K+ +ICW+ +            FS T PFSPLYPM
Sbjct: 478 DTEFEVLLNDDDFMPLTINDKTLFQKVSQICWMKEDEHLEPQEDMSGFSITLPFSPLYPM 537

Query: 526 TCTLVKKTYSSLHSFISIFYKHDISHLNLIVIKAIDNIFDRVVNDNIKSKLDTTSREEIA 585
           TCTL+KK YS L SFI++FY+HD+  LN +++ AID IF  +VN  I++KL +TSREEIA
Sbjct: 538 TCTLLKKAYSKLTSFITMFYRHDLPALNRLLVNAIDKIFIDIVNKKIRAKLQSTSREEIA 597

Query: 586 QILVNLDYFVIAAKEFSLILTRENLTNNPDVEIRLSSIKKLIETRKEAETKLITLIDSKV 645
           QIL+NLDYF++A K FS I+T  N+  NPD+EI+L S K L ++RK AE KLI LIDSKV
Sbjct: 598 QILINLDYFIVATKAFSKIMTEGNIMQNPDIEIQLKSTKDLKDSRKYAEGKLIKLIDSKV 657

Query: 646 IDLMEFIEFDWNSTEVRTEPDMTIVDIAQFLEMMFTSTLAIIPYNIKMLLIFREFDVITR 705
            D++E ++ DWNS E+  +PD++IVD+AQFLEMMF +TL  +PY+I++LLIFREFD +TR
Sbjct: 658 ADILETVDLDWNSKEIIQDPDISIVDVAQFLEMMFATTLINLPYSIQILLIFREFDSLTR 717

Query: 706 RFLEKLLNETPDRISPQSVQNFETDMLYLEKTITKIFPN----DVSSVPTSPSIPATPTD 761
           RFL+ LLN+TPD I+ +SV NFE ++ YLE  I +IFP+    + +        P +P  
Sbjct: 718 RFLDILLNDTPDHITHESVLNFEVNIKYLEGIIPRIFPSRDEEETNITSERMMTPLSPV- 776

Query: 762 VPSTAGNRSSTQVENNIKSLLSTFTDLKQHIGLMKINHWDEYKDNDIRLKKYSRVKPEVA 821
              T    S   +ENN+KSL  TF +L+Q+I L+K  +  EY D D+R++KYSRVKPE A
Sbjct: 777 FNGTNNGHSPELIENNVKSLEETFIELRQYIELLKTGN--EYMDPDLRMRKYSRVKPEHA 834

>YGL233W (SEC15) [1765] chr7 (59121..61853) Component of exocyst
           complex required for exocytosis [2733 bp, 910 aa]
          Length = 910

 Score =  801 bits (2069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/862 (49%), Positives = 585/862 (67%), Gaps = 46/862 (5%)

Query: 1   MDQDPQLAVSQDLQRALLTAEFVSKSGSSNQDQ-----------------GEDELFELDP 43
           MDQ+ Q  +S+D Q+ LL     S + SS  ++                 G++++F+LDP
Sbjct: 1   MDQEGQPLLSKDFQQVLLAT--ASGNNSSWTERAVLNNESTDAVKHEPALGQNDVFDLDP 58

Query: 44  QIFDRWVPLLRQTIDEGQLNTVIDDLYASIDDHFENLETQILQDSQINNNLVTSINEIQK 103
             FD+WVP LR+ +D+ QL+ VID+L  SI+D+F+ LE Q+LQDSQ+N+ L TSI+EI  
Sbjct: 59  LSFDKWVPFLRRALDKNQLDPVIDELENSIEDNFQGLELQLLQDSQMNDKLETSIDEIAN 118

Query: 104 VQQIIDGSLQNDIKNLQSQVRHSTLNLVSRKQILIDNXXXXXXXXXXXXLIQKVLQILEL 163
           +Q ++  +L ++I   Q ++  S   L+ +KQ+ ++N            LI KV++ILEL
Sbjct: 119 IQGMVQDTLSSEISKFQIRLSESANELIVKKQMYVNNKKISLKISEATILITKVVRILEL 178

Query: 164 FNRCRELIEEKDFFKALQTIETFETIYLQDFKQYNFEFLNQIYTSIPMLKSQIKDESINL 223
            ++C+ELI E+ FFK LQ +++ E +YLQ+FK YNF+FL +IY SIP L+   KDE INL
Sbjct: 179 SSKCQELITERKFFKVLQNLDSLEKLYLQEFKNYNFQFLIEIYNSIPFLQKVTKDECINL 238

Query: 224 IKKSLNYNLEKTFSVIGEKYYDVYETQILQDWLKTKQSMKLHNYKFNSPVEISLRDTSKL 283
           I+ SLN NL K    +G+++  +YE ++L  WL+T+  MKL N+KFNSP+EIS+RD S L
Sbjct: 239 IRNSLNLNLGKNLIKVGQEFVAIYENELLPQWLETRSKMKLTNFKFNSPIEISMRDESFL 298

Query: 284 DSLQLQNFCQLHEFHDSILIFQSLNEMDFFIDEFRKEYEFRKSKLIHPLFLKDFSTV--- 340
             L L  F QL +FHDSI+IFQ+LNE+     EF KEYE RK+KL++PL  K   T    
Sbjct: 299 AKLNLGEFFQLDDFHDSIMIFQNLNELSVLSGEFNKEYELRKTKLMYPLIWKKNKTAAYQ 358

Query: 341 ---------------SHSNGKIDAFAEKLDLSFFKEYILKILGFLVYDKELHKSTDYVLS 385
                          +H     D F + L L F ++Y LKILGFL+YD  L+K+T+++L 
Sbjct: 359 MDSLLRGTGTTPGSTAHDVSTDDPFTQSLSLHFLQDYFLKILGFLLYDINLNKATEFILV 418

Query: 386 NNNNPNSTDIFWTSIMNKLYPYLITMVKEKLTTEQLLTEFKDFLGVLIAILENLKLNVEL 445
           +NN  NST+ FW  +M++L PYL   + EKL TE+ + + KDFL + +AILEN KLN+E 
Sbjct: 419 DNNY-NSTNEFWDGLMDRLSPYLSYFIDEKLKTEEDMIKLKDFLCIYVAILENFKLNIEP 477

Query: 446 LYKVQVETFSQYCELLVFLFQKEFTNLLQDDDFMPLAITDKALYEKILKICWL--ADQGS 503
           LYK+ V  F ++C + +  F  EF  LL DDDFMPL+I DK LYEK+LKICW+   +  S
Sbjct: 478 LYKILVSIFEKFCSVSLRAFDDEFQILLNDDDFMPLSINDKTLYEKVLKICWMKEGEHLS 537

Query: 504 DTSNTTNDNFSATFPFSPLYPMTCTLVKKTYSSLHSFISIFYKHDISHLNLIVIKAIDNI 563
               T  + F+ T PFSPLYPMTCTL KKTYS + +F+SIFY+H++  LN I++K +D+I
Sbjct: 538 LPDPTNGEPFAVTLPFSPLYPMTCTLAKKTYSKITAFLSIFYRHELHTLNNILVKTMDDI 597

Query: 564 FDRVVNDNIKSKLDTTSREEIAQILVNLDYFVIAAKEFSLILTRENLTNNPDVEIRLSSI 623
           F+ +VN  I+SKL++TSREEIAQILVNLDYF+IAAKEFS  +TREN+  NPD+EIRLSSI
Sbjct: 598 FNDIVNKKIRSKLESTSREEIAQILVNLDYFIIAAKEFSNFMTRENILQNPDMEIRLSSI 657

Query: 624 KKLIETRKEAETKLITLIDSKVIDLMEFIEFDWNSTEVRTEPDMTIVDIAQFLEMMFTST 683
           K L E+RK AETKLI LIDSK+ D++E IE DW  TEVR +PD++I+D+AQFLEMMF ST
Sbjct: 658 KYLAESRKLAETKLIELIDSKISDILETIEIDWQITEVRQDPDISIIDLAQFLEMMFAST 717

Query: 684 LAIIPYNIKMLLIFREFDVITRRFLEKLLNETPDRISPQSVQNFETDMLYLEKTITKIFP 743
           L  +PY+++ LLIFREFD +TR+F+  LL++TP  I+ +S+ NFE D+ YLE  I +IFP
Sbjct: 718 LQNLPYSVQTLLIFREFDSLTRQFMGLLLHDTPSTITHESIMNFEVDVNYLESIIPRIFP 777

Query: 744 NDVSSVPT----SPSIPATPTDVPSTAGNRSSTQVENNIKSLLSTFTDLKQHIGLMKINH 799
           +   ++ +    SP  P+TPT  P+  G  + T  ENNIKSL +TF +LKQ I L+K   
Sbjct: 778 STPGTIDSNGYQSPMTPSTPT-FPNANGVDAPTLFENNIKSLEATFMELKQCIELLKTQG 836

Query: 800 WDEYKDNDIRLKKYSRVKPEVA 821
            D Y + +IRL+KYSR++ E A
Sbjct: 837 KD-YNEPEIRLRKYSRIRQEDA 857

>CAGL0H07909g 772741..775389 similar to sp|P22224 Saccharomyces
           cerevisiae YGL233w SEC15, start by similarity
          Length = 882

 Score =  783 bits (2021), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/836 (48%), Positives = 571/836 (68%), Gaps = 17/836 (2%)

Query: 1   MDQDPQLAVSQDLQRALLTAEFVSKSGSSNQDQ----GE--------DELFELDPQIFDR 48
           MDQ+ +  +S+D Q  LL    V  S   +Q+     GE        D   ++D +  D+
Sbjct: 1   MDQETKKVISKDFQDVLLDTSTVVVSSVFDQENKIVGGENAKGVDIIDSTLDIDQRAIDK 60

Query: 49  WVPLLRQTIDEGQLNTVIDDLYASIDDHFENLETQILQDSQINNNLVTSINEIQKVQQII 108
           W+P LR+  +  QLNTVI +L  SIDD+F+ LE Q+LQDSQ+N+ L TS++EI ++Q ++
Sbjct: 61  WIPYLREYTENDQLNTVITELENSIDDNFQGLELQLLQDSQLNDKLETSMDEIAEIQSMV 120

Query: 109 DGSLQNDIKNLQSQVRHSTLNLVSRKQILIDNXXXXXXXXXXXXLIQKVLQILELFNRCR 168
           + SL  DI   Q  +  ST  L+ +KQ  +++            LI KVL++LEL N+C+
Sbjct: 121 ELSLSRDIDEFQKNLTSSTNELIRQKQTYLNSKKTSLKISEAIILINKVLRLLELSNKCQ 180

Query: 169 ELIEEKDFFKALQTIETFETIYLQDFKQYNFEFLNQIYTSIPMLKSQIKDESINLIKKSL 228
           ELI E +FFKALQ +++ E +YLQ+F+ YNF+ L +IY SIP LKS  KDE INLIK SL
Sbjct: 181 ELITEGNFFKALQNLDSLEKLYLQEFRDYNFKLLKEIYVSIPYLKSVTKDECINLIKNSL 240

Query: 229 NYNLEKTFSVIGEKYYDVYETQILQDWLKTKQSMKLHNYKFNSPVEISLRDTSKLDSLQL 288
           N NL K  +V+G+ +Y +Y+ ++L  WL T++ MKL   KFNSP+EIS+RD   L  L+L
Sbjct: 241 NSNLGKNLNVVGQTFYLIYKDELLSKWLNTREIMKLKRVKFNSPIEISMRDEENLRKLEL 300

Query: 289 QNFCQLHEFHDSILIFQSLNEMDFFIDEFRKEYEFRKSKLIHPLFLK-DFSTVSHSNGKI 347
           + F  L  FHDS++IF++LNE D+ ++EF KEYEF+KSK I PL  K   +TVS ++   
Sbjct: 301 EQFFNLDAFHDSLMIFETLNETDYLVEEFNKEYEFKKSKTIQPLPWKTSGNTVSVNSTAH 360

Query: 348 DAFAEKLDLSFFKEYILKILGFLVYDKELHKSTDYVLSNNNNPNSTDIFWTSIMNKLYPY 407
           D F E L + F KEY+L ILGFL+YD  L++ TDY+  NNN  N+T+ FW  +M +L PY
Sbjct: 361 DEFKESLSVPFLKEYLLNILGFLLYDINLNRLTDYIFVNNNY-NATNEFWEMLMMRLKPY 419

Query: 408 LITMVKEKLTTEQLLTEFKDFLGVLIAILENLKLNVELLYKVQVETFSQYCELLVFLFQK 467
               +   L TE+ + EFKDFLG+ + I+EN KLN++ LY V +  F +YC+  + LF K
Sbjct: 420 FKYFMDTVLKTEKDIIEFKDFLGIYVCIMENYKLNIDPLYSVMLALFEKYCKTTLELFDK 479

Query: 468 EFTNLLQDDDFMPLAITDKALYEKILKICWLADQGSDTSNTTNDNFSATFPFSPLYPMTC 527
           +F  +L DDDFMPL I +K  YEK++KICW+ +      +  ++NFS T PFSPLYPMTC
Sbjct: 480 DFQVMLSDDDFMPLTIDNKGFYEKVIKICWMKENHQIIDDMDDENFSVTLPFSPLYPMTC 539

Query: 528 TLVKKTYSSLHSFISIFYKHDISHLNLIVIKAIDNIFDRVVNDNIKSKLDTTSREEIAQI 587
           T+ +K Y+ L SFIS FY+H +  LN I++  ID I D VVN  I++KL+TTSREEIAQ+
Sbjct: 540 TMTQKVYAKLTSFISSFYRHSLHSLNNILVNTIDGILDGVVNKQIRAKLETTSREEIAQL 599

Query: 588 LVNLDYFVIAAKEFSLILTRENLTNNPDVEIRLSSIKKLIETRKEAETKLITLIDSKVID 647
           L+NLDYFVIA+KEFS ++T++N+  NPDVEIRL+S K   E+RK AE+KLI LID+K+ D
Sbjct: 600 LINLDYFVIASKEFSNLMTKDNILENPDVEIRLASTKNFAESRKYAESKLIDLIDTKIKD 659

Query: 648 LMEFIEFDWNSTEVRTEPDMTIVDIAQFLEMMFTSTLAIIPYNIKMLLIFREFDVITRRF 707
           ++E + FDW  T+ R +PD++IVD+AQFLEMMF +TL  +PY++++LLIFREFD +TR F
Sbjct: 660 ILETVSFDWLDTDRRIDPDISIVDLAQFLEMMFATTLVNLPYSVQILLIFREFDSLTRHF 719

Query: 708 LEKLLNETPDRISPQSVQNFETDMLYLEKTITKIFP--NDVSSVPTSPSIPATPTDVPST 765
           L+ LL++TP  IS +SV NFE DM+YLE  I KIFP  ++  +       P TPT +   
Sbjct: 720 LDVLLHDTPQYISKESVGNFEVDMMYLEGIIPKIFPRTDENENGRLGSQTPKTPT-IDDE 778

Query: 766 AGNRSSTQVENNIKSLLSTFTDLKQHIGLMKINHWDEYKDNDIRLKKYSRVKPEVA 821
           + ++S++Q++NNIKSL STF +LKQ I L++    +EY D  +R +KYSR+KP+ A
Sbjct: 779 SRSQSNSQIDNNIKSLESTFMELKQCIQLLQSEDPNEYLDPQMRSRKYSRIKPDDA 834

>KLLA0D13772g 1185663..1186700 some similarities with sp|Q8J1F4
           Ashbya gossypii Yib1, hypothetical start
          Length = 345

 Score = 33.1 bits (74), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 35/76 (46%), Gaps = 3/76 (3%)

Query: 199 FEFLNQIYTSIPMLKSQIKDESINLIKKSLN---YNLEKTFSVIGEKYYDVYETQILQDW 255
           FE  + I  ++ +  S++  E+IN+ KK  N   YN  K +    E  Y  ++  +++ W
Sbjct: 151 FESSDSIPKALELKDSELHGETINVAKKRTNVPGYNNNKNYYPRKEWVYPGWQGNVMRQW 210

Query: 256 LKTKQSMKLHNYKFNS 271
                +    NYK N 
Sbjct: 211 YYPYAAPGYQNYKPNG 226

>AFR286W [3478] [Homologous to ScYKR095W (MLP1) - SH; ScYIL149C (MLP2)
            - SH] complement(951491..956767) [5277 bp, 1758 aa]
          Length = 1758

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 4/48 (8%)

Query: 774  VENNIKSLLSTFTDLKQHIGLMK--INHWDEYKDNDIRLKKYSRVKPE 819
            +E  IKSL +T T+ +Q + L+K   + W + +  DI L KY R+ PE
Sbjct: 1262 MEEQIKSLTATLTEKEQKLALLKEESDRWKQ-RSQDI-LHKYERIDPE 1307

>AER304C [2806] [Homologous to ScYDR457W (TOM1) - SH]
           (1194908..1204684) [9777 bp, 3258 aa]
          Length = 3258

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 26/43 (60%)

Query: 628 ETRKEAETKLITLIDSKVIDLMEFIEFDWNSTEVRTEPDMTIV 670
           E R  A  +L+T++DSK  DL +F+ +D+  + V  EP   +V
Sbjct: 795 ERRSYALPELLTILDSKFADLEDFLSYDFTKSYVLNEPKDRVV 837

>AEL086W [2420] [Homologous to ScYDL031W (DBP10) - SH]
           complement(464521..467403) [2883 bp, 960 aa]
          Length = 960

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 33/61 (54%), Gaps = 8/61 (13%)

Query: 519 FSPLYPMTCTLVKKTYSSLHSFISIFYKHDISHLNLIV--------IKAIDNIFDRVVND 570
            +P+Y  TC L+KK + S  +  ++F    IS++N ++        ++A+ ++F  +V  
Sbjct: 535 LTPMYEATCDLLKKKWISEGNEGALFQPPKISYVNRLILGSAPRLDLEAMGDLFKNLVES 594

Query: 571 N 571
           N
Sbjct: 595 N 595

>Scas_706.21
          Length = 1304

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 66/147 (44%), Gaps = 26/147 (17%)

Query: 599 KEFSLILTRENLTNNPDVE----------IRLSSIKKLIETRKEAETKLITLIDSKVIDL 648
           K F + L +E   NN ++           I+L++ +K IE  KE E +LIT + S + + 
Sbjct: 573 KRFYINLQKEIAVNNKNIHEKDKSYTEANIKLTNAQKEIENSKETEQRLITALQSALPED 632

Query: 649 MEFIEFDWNSTEVRTEPDMTIVDIAQFLEMMFTS------TLAIIPYNIKMLLIFREFDV 702
               E+D    EV  E +++     + L+M  T+       L I   +    L  R+F+ 
Sbjct: 633 CSIDEYD----EVVLETELSYKTALENLKMHQTTLEFNRKALEIAERDSCCYLCSRKFE- 687

Query: 703 ITRRFLEKLLNETPDRISPQSVQNFET 729
            T  F  KLL E    +  ++  NFET
Sbjct: 688 -TADFKSKLLQE----LKAKTDANFET 709

>Kwal_23.6106
          Length = 960

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 24/49 (48%)

Query: 724 VQNFETDMLYLEKTITKIFPNDVSSVPTSPSIPATPTDVPSTAGNRSST 772
           VQ + TD+  +E        N V    T  ++ A PTD PS+ G  SST
Sbjct: 115 VQAYPTDIFPMELYAVDPVGNVVGVTKTKNAVSAMPTDPPSSKGRFSST 163

>YNL311C (YNL311C) [4302] chr14 complement(49396..51687) Protein
           that may be involved in amino acid metabolism, contains
           an cyclin-associated F-box [2292 bp, 763 aa]
          Length = 763

 Score = 30.4 bits (67), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 57/128 (44%), Gaps = 13/128 (10%)

Query: 623 IKKLIETRKEAETKLITLIDSKVIDLMEFIEFDWNSTEVRTEPDMTIVDIAQFLEMMFTS 682
           +KKL   R   ET +IT    K++D +E   F +   E+       ++DI  +L  +   
Sbjct: 187 VKKLNNIRLNDETPIITSERIKLLDKLESNYFHYTYIEL-------MLDIIDYLPNLTRV 239

Query: 683 TLAIIPYNIKMLLIFREFDVITRRFLEKLLNETPDRISPQSVQNFETDMLYLEKTITKIF 742
            L+ +  N K+ L +  F+  +R F +K++         QS+ N +     L K   K +
Sbjct: 240 ILSDVEPNFKIPLWYSVFNDGSRDFFKKIIK------GQQSITNEDLRTFQLSKKFVKEY 293

Query: 743 PNDVSSVP 750
            +   S+P
Sbjct: 294 ESKYYSLP 301

>KLLA0F26455g 2450871..2453462 similar to sp|P36016 Saccharomyces
           cerevisiae YKL073w LHS1 chaperone of the ER lumen, start
           by similarity
          Length = 863

 Score = 30.4 bits (67), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 77/157 (49%), Gaps = 19/157 (12%)

Query: 603 LILTRENLTNNPDVEIRLSSIKKLIETRKEAETKLITLIDSKVIDLMEFIEFDWNSTEVR 662
           L+L R+ L N  D+E  L + ++L+E  KE ET   + I      + +++EF  + + +R
Sbjct: 598 LLLERQRLLN--DLEASLYAARELVEDAKELETPPTSYIQQLENMITQYLEFVDDPSSLR 655

Query: 663 TEPDMT----IVDIAQFLEMMFTSTLAIIPYNIKMLLI--FREFDVITRRFLE---KLLN 713
           T+   T    + ++ Q LE+        +  + K L +  FR       ++LE   K+  
Sbjct: 656 TKNIKTMKSNLAELQQRLEIY-------MDRDNKQLDVEGFRALFDKGEKYLELLSKIQQ 708

Query: 714 ETPDRISPQSVQNFETDMLYLEKTITKIFPNDVSSVP 750
           ++   +SP + +NFE+  L + +  TK+ P    +VP
Sbjct: 709 KSLSELSPLN-KNFESLGLNVSEEYTKVKPPKSKTVP 744

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.135    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 27,670,162
Number of extensions: 1299475
Number of successful extensions: 5890
Number of sequences better than 10.0: 80
Number of HSP's gapped: 6077
Number of HSP's successfully gapped: 80
Length of query: 848
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 738
Effective length of database: 12,788,129
Effective search space: 9437639202
Effective search space used: 9437639202
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)