Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0A00286g1280126065040.0
AAL182W1231121530940.0
Scas_711.391227123029300.0
YJL074C (SMC3)1230121229170.0
Kwal_14.24351247122828730.0
CAGL0H02805g1219122127340.0
Scas_565.6117013025579e-58
CAGL0D05258g117013265151e-52
AGL023W122212942916e-26
Kwal_55.2042111707022834e-25
YFR031C (SMC2)11702032575e-22
YFL008W (SMC1)12259082486e-21
AGR236W11701922423e-20
AGR089C137010082182e-17
Scas_681.414098382155e-17
Kwal_56.2382513967602022e-15
KLLA0D16005g11702051861e-13
KLLA0F19085g13727161735e-12
YLR086W (SMC4)1418891701e-11
CAGL0L12188g1398691628e-11
Scas_707.231223921547e-10
KLLA0D07502g1243701521e-09
AEL337C10971671216e-06
Scas_643.1110952411206e-06
Kwal_23.504312251991172e-05
CAGL0F01155g11051921082e-04
KLLA0F07997g11191801082e-04
AER044W11031721063e-04
YOL034W (SMC5)10931631054e-04
Kwal_26.720411171331010.001
CAGL0F02079g122357940.009
KLLA0E05247g1098199900.026
Scas_719.6109657890.028
Scas_636.1460853880.035
CAGL0H05071g1110160880.043
YDR091C60853870.047
CAGL0G08041g60782870.055
AGR125W60780850.075
Kwal_56.2342953953840.11
Kwal_26.9380110299830.18
Kwal_26.948071971820.20
YLR383W (RHC18)111475810.27
Sklu_2249.2108379810.28
KLLA0A10131g72071780.56
KLLA0A00594g1748296770.85
KLLA0C17556g60782760.92
Kwal_26.8903815240761.0
YBL047C (EDE1)1381217751.3
CAGL0J01485g30045722.1
YHR023W (MYO1)1928271742.1
YHR138C11471672.9
KLLA0C10879g755216723.0
KLLA0B11121g23773703.1
Kwal_26.93861215130723.2
Kwal_27.12530108779723.6
CAGL0E01265g2095243714.0
AGL335W69171714.3
AFR730W31885704.5
AFL058C89689705.9
KLLA0E13035g67379696.4
CAGL0B04851g154073696.5
YBR156C (SLI15)698190696.7
Sklu_2355.386899697.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A00286g
         (1260 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A00286g complement(22024..25866) similar to sp|P47037 Sacch...  2509   0.0  
AAL182W [5] [Homologous to ScYJL074C (SMC3) - SH] complement(161...  1196   0.0  
Scas_711.39                                                          1133   0.0  
YJL074C (SMC3) [2838] chr10 complement(299073..302765) Cohesin, ...  1128   0.0  
Kwal_14.2435                                                         1111   0.0  
CAGL0H02805g complement(256682..260341) similar to sp|P47037 Sac...  1057   0.0  
Scas_565.6                                                            219   9e-58
CAGL0D05258g 500858..504370 similar to sp|P38989 Saccharomyces c...   202   1e-52
AGL023W [4288] [Homologous to ScYFL008W (SMC1) - SH] complement(...   116   6e-26
Kwal_55.20421                                                         113   4e-25
YFR031C (SMC2) [1711] chr6 complement(216582..220094) Subunit of...   103   5e-22
YFL008W (SMC1) [1674] chr6 (119424..123101) Coiled-coil protein ...   100   6e-21
AGR236W [4547] [Homologous to ScYFR031C (SMC2) - SH] complement(...    98   3e-20
AGR089C [4399] [Homologous to ScYLR086W (SMC4) - SH] (901443..90...    89   2e-17
Scas_681.4                                                             87   5e-17
Kwal_56.23825                                                          82   2e-15
KLLA0D16005g complement(1346492..1350004) similar to sp|P38989 S...    76   1e-13
KLLA0F19085g 1758111..1762229 similar to sgd|S0004081 Saccharomy...    71   5e-12
YLR086W (SMC4) [3501] chr12 (302244..306500) Subunit of condensi...    70   1e-11
CAGL0L12188g 1308672..1312868 similar to tr|Q12267 Saccharomyces...    67   8e-11
Scas_707.23                                                            64   7e-10
KLLA0D07502g complement(642751..646482) similar to sp|P32908 Sac...    63   1e-09
AEL337C [2168] [Homologous to ScYOL034W - SH] (14613..17906) [32...    51   6e-06
Scas_643.11                                                            51   6e-06
Kwal_23.5043                                                           50   2e-05
CAGL0F01155g complement(116762..120079) similar to tr|Q08204 Sac...    46   2e-04
KLLA0F07997g complement(748561..751920) similar to sgd|S0005394 ...    46   2e-04
AER044W [2549] [Homologous to ScYLR383W (RHC18) - SH] complement...    45   3e-04
YOL034W (SMC5) [4782] chr15 (259923..263204) Protein containing ...    45   4e-04
Kwal_26.7204                                                           44   0.001
CAGL0F02079g 201002..204673 similar to sp|P32908 Saccharomyces c...    41   0.009
KLLA0E05247g complement(472583..475879) similar to sp|Q12749 Sac...    39   0.026
Scas_719.6                                                             39   0.028
Scas_636.14                                                            39   0.035
CAGL0H05071g 486899..490231 similar to sp|Q12749 Saccharomyces c...    39   0.043
YDR091C (YDR091C) [943] chr4 complement(626702..628528) Putative...    38   0.047
CAGL0G08041g complement(758811..760634) highly similar to tr|Q03...    38   0.055
AGR125W [4436] [Homologous to ScYDR091C (RLI1) - SH] complement(...    37   0.075
Kwal_56.23429                                                          37   0.11 
Kwal_26.9380                                                           37   0.18 
Kwal_26.9480                                                           36   0.20 
YLR383W (RHC18) [3762] chr12 (885288..888632) Protein involved i...    36   0.27 
Sklu_2249.2 YFR031C, Contig c2249 627-3873 reverse complement          36   0.28 
KLLA0A10131g complement(889688..891850) similar to sp|P40416 Sac...    35   0.56 
KLLA0A00594g complement(53304..58550) gi|5531276|emb|CAB50890.1 ...    34   0.85 
KLLA0C17556g complement(1544404..1546227) highly similar to sgd|...    34   0.92 
Kwal_26.8903                                                           34   1.0  
YBL047C (EDE1) [147] chr2 complement(127860..132005) Protein wit...    33   1.3  
CAGL0J01485g 138326..139228 similar to sp|P38747 Saccharomyces c...    32   2.1  
YHR023W (MYO1) [2310] chr8 (151658..157444) Myosin heavy chain (...    33   2.1  
YHR138C (YHR138C) [2425] chr8 complement(377356..377700) Protein...    30   2.9  
KLLA0C10879g 936212..938479 weakly similar to sp|P31111 Saccharo...    32   3.0  
KLLA0B11121g 976252..976965 weakly similar to sp|P53271 Saccharo...    32   3.1  
Kwal_26.9386                                                           32   3.2  
Kwal_27.12530                                                          32   3.6  
CAGL0E01265g complement(112930..119217) weakly similar to tr|Q03...    32   4.0  
AGL335W [3977] [Homologous to ScYMR301C (ATM1) - SH] complement(...    32   4.3  
AFR730W [3923] [Homologous to ScYCL050C (APA1) - SH; ScYDR530C (...    32   4.5  
AFL058C [3135] [Homologous to ScYGL093W (SPC105) - SH] (325923.....    32   5.9  
KLLA0E13035g 1151967..1153988 similar to sp|P40460 Saccharomyces...    31   6.4  
CAGL0B04851g complement(463474..468096) similar to sp|P25558 Sac...    31   6.5  
YBR156C (SLI15) [341] chr2 complement(551060..553156) Mitotic sp...    31   6.7  
Sklu_2355.3 YLR045C, Contig c2355 7060-9666 reverse complement         31   7.5  

>KLLA0A00286g complement(22024..25866) similar to sp|P47037
            Saccharomyces cerevisiae YJL074c SMC3 required for
            structural maintenance of chromosomes, start by
            similarity
          Length = 1280

 Score = 2509 bits (6504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1242/1260 (98%), Positives = 1242/1260 (98%)

Query: 1    MLYTVYETRPSLIKKNEYHKHIQNYTKQVKFTRPVSESSRNKSNYKGKKTDYNTVEMVHI 60
            MLYTVYETRPSLIKKNEYHKHIQNYTKQVKFTRPVSESSRNKSNYKGKKTDYNTVEMVHI
Sbjct: 1    MLYTVYETRPSLIKKNEYHKHIQNYTKQVKFTRPVSESSRNKSNYKGKKTDYNTVEMVHI 60

Query: 61   KTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKREDRKG 120
            KTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKREDRKG
Sbjct: 61   KTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKREDRKG 120

Query: 121  FIYQGAGQVMSAFVEIIFDDPENLMLAPLRNDTGEVRIRRTVGLKKDEYMINDKNSTRQD 180
            FIYQGAGQVMSAFVEIIFDDPENLMLAPLRNDTGEVRIRRTVGLKKDEYMINDKNSTRQD
Sbjct: 121  FIYQGAGQVMSAFVEIIFDDPENLMLAPLRNDTGEVRIRRTVGLKKDEYMINDKNSTRQD 180

Query: 181  VRRVLENVGFSTSNPYNIVPQGRIISLTNAKDLERLHLLEDVVGAKSFENKLKESLKKME 240
            VRRVLENVGFSTSNPYNIVPQGRIISLTNAKDLERLHLLEDVVGAKSFENKLKESLKKME
Sbjct: 181  VRRVLENVGFSTSNPYNIVPQGRIISLTNAKDLERLHLLEDVVGAKSFENKLKESLKKME 240

Query: 241  AAERDRTKITNELNELDKRXXXXXXXXXXXXXXXXXXRDRKVLQFCLYDRELNDITNQIE 300
            AAERDRTKITNELNELDKR                  RDRKVLQFCLYDRELNDITNQIE
Sbjct: 241  AAERDRTKITNELNELDKRLSELSDEKEELEKYNNLNRDRKVLQFCLYDRELNDITNQIE 300

Query: 301  QLEGEYNSIIENSSEYVNELEKREVLAVELNKRMNSLESEIKIKQSTDLPQLKASKLEVA 360
            QLEGEYNSIIENSSEYVNELEKREVLAVELNKRMNSLESEIKIKQSTDLPQLKASKLEVA
Sbjct: 301  QLEGEYNSIIENSSEYVNELEKREVLAVELNKRMNSLESEIKIKQSTDLPQLKASKLEVA 360

Query: 361  GELADLDTRLNDIQMQLDASQAHLESNVKEIGEVKKQIEINCSSIAEVQPKFQKLSNEAE 420
            GELADLDTRLNDIQMQLDASQAHLESNVKEIGEVKKQIEINCSSIAEVQPKFQKLSNEAE
Sbjct: 361  GELADLDTRLNDIQMQLDASQAHLESNVKEIGEVKKQIEINCSSIAEVQPKFQKLSNEAE 420

Query: 421  ILKVEIEKLTKRQRELLSKKGKYEDFRTVNERNDWIQEQINLLNQSLNKSNILKDQLTSQ 480
            ILKVEIEKLTKRQRELLSKKGKYEDFRTVNERNDWIQEQINLLNQSLNKSNILKDQLTSQ
Sbjct: 421  ILKVEIEKLTKRQRELLSKKGKYEDFRTVNERNDWIQEQINLLNQSLNKSNILKDQLTSQ 480

Query: 481  LSTLQHDLENLNAEIEDLADSVNGMGSVAQQEDLQNKVTQAKKEYLTKIDQRKQLWRTEQ 540
            LSTLQHDLENLNAEIEDLADSVNGMGSVAQQEDLQNKVTQAKKEYLTKIDQRKQLWRTEQ
Sbjct: 481  LSTLQHDLENLNAEIEDLADSVNGMGSVAQQEDLQNKVTQAKKEYLTKIDQRKQLWRTEQ 540

Query: 541  RLQTISTSLDNDVKRFESDMNETIDRSLALGLQNVNDIVNRLNLHEHVFGPVGELIKVSD 600
            RLQTISTSLDNDVKRFESDMNETIDRSLALGLQNVNDIVNRLNLHEHVFGPVGELIKVSD
Sbjct: 541  RLQTISTSLDNDVKRFESDMNETIDRSLALGLQNVNDIVNRLNLHEHVFGPVGELIKVSD 600

Query: 601  KYKICAEVVGGNSLFNVVVDNEETASLLIKELFATKGGRVTFIPLNKLHVDTNFTYPNNL 660
            KYKICAEVVGGNSLFNVVVDNEETASLLIKELFATKGGRVTFIPLNKLHVDTNFTYPNNL
Sbjct: 601  KYKICAEVVGGNSLFNVVVDNEETASLLIKELFATKGGRVTFIPLNKLHVDTNFTYPNNL 660

Query: 661  EKNQCTPLIKKIKYDVKFEKVIKQVFGRTLVVKSLIDGASLAKEYKLNAITLDGDRADSK 720
            EKNQCTPLIKKIKYDVKFEKVIKQVFGRTLVVKSLIDGASLAKEYKLNAITLDGDRADSK
Sbjct: 661  EKNQCTPLIKKIKYDVKFEKVIKQVFGRTLVVKSLIDGASLAKEYKLNAITLDGDRADSK 720

Query: 721  GVLSGGYLDQYKSNRLDTLRDFKQSKREYKKIQVELQEIKQALQSIEQEIDGLNNVVKDA 780
            GVLSGGYLDQYKSNRLDTLRDFKQSKREYKKIQVELQEIKQALQSIEQEIDGLNNVVKDA
Sbjct: 721  GVLSGGYLDQYKSNRLDTLRDFKQSKREYKKIQVELQEIKQALQSIEQEIDGLNNVVKDA 780

Query: 781  AAERDAYEAGIEKARSQLKAKLSQKITIDDSIKALKARLNKIDTELEQCRERTNAFAADI 840
            AAERDAYEAGIEKARSQLKAKLSQKITIDDSIKALKARLNKIDTELEQCRERTNAFAADI
Sbjct: 781  AAERDAYEAGIEKARSQLKAKLSQKITIDDSIKALKARLNKIDTELEQCRERTNAFAADI 840

Query: 841  SKPFVNELDADEKAELLAISNSIQTKETSLNFNLSTLNELSSKLDELNAELNSKLLPKLH 900
            SKPFVNELDADEKAELLAISNSIQTKETSLNFNLSTLNELSSKLDELNAELNSKLLPKLH
Sbjct: 841  SKPFVNELDADEKAELLAISNSIQTKETSLNFNLSTLNELSSKLDELNAELNSKLLPKLH 900

Query: 901  ELERKPSSSHSLQISQINNQMELVLMEKQTVTRTKEQVESELSVLDSSIKSLRGEKATLQ 960
            ELERKPSSSHSLQISQINNQMELVLMEKQTVTRTKEQVESELSVLDSSIKSLRGEKATLQ
Sbjct: 901  ELERKPSSSHSLQISQINNQMELVLMEKQTVTRTKEQVESELSVLDSSIKSLRGEKATLQ 960

Query: 961  KDLDKANSQQRSLVKRITNFQKNAEKVLLKKSTLNSRKEELQQLIREVGLLAEESLKKYK 1020
            KDLDKANSQQRSLVKRITNFQKNAEKVLLKKSTLNSRKEELQQLIREVGLLAEESLKKYK
Sbjct: 961  KDLDKANSQQRSLVKRITNFQKNAEKVLLKKSTLNSRKEELQQLIREVGLLAEESLKKYK 1020

Query: 1021 PLASDEILKKLNTTTGHLSKMTNVNKRASENYTRFEDKRGELTSRAEELDESKQSIENLI 1080
            PLASDEILKKLNTTTGHLSKMTNVNKRASENYTRFEDKRGELTSRAEELDESKQSIENLI
Sbjct: 1021 PLASDEILKKLNTTTGHLSKMTNVNKRASENYTRFEDKRGELTSRAEELDESKQSIENLI 1080

Query: 1081 DQLKEQKITAIEKTFNKVADNFSRVFATLVPRGIGKLIINHRKNTDNSEVSTKKRRRGAR 1140
            DQLKEQKITAIEKTFNKVADNFSRVFATLVPRGIGKLIINHRKNTDNSEVSTKKRRRGAR
Sbjct: 1081 DQLKEQKITAIEKTFNKVADNFSRVFATLVPRGIGKLIINHRKNTDNSEVSTKKRRRGAR 1140

Query: 1141 QEQNSAEALNESKYTGVSIQVSFNSKKDEQLRVEQLSGGQKTVCAIALILAIQMVDPAPF 1200
            QEQNSAEALNESKYTGVSIQVSFNSKKDEQLRVEQLSGGQKTVCAIALILAIQMVDPAPF
Sbjct: 1141 QEQNSAEALNESKYTGVSIQVSFNSKKDEQLRVEQLSGGQKTVCAIALILAIQMVDPAPF 1200

Query: 1201 YLFDEIDAALDKQYRIAVARTIKNLSDTAQFICTTFRTDMINVADTFFRVKFENKVSTVT 1260
            YLFDEIDAALDKQYRIAVARTIKNLSDTAQFICTTFRTDMINVADTFFRVKFENKVSTVT
Sbjct: 1201 YLFDEIDAALDKQYRIAVARTIKNLSDTAQFICTTFRTDMINVADTFFRVKFENKVSTVT 1260

>AAL182W [5] [Homologous to ScYJL074C (SMC3) - SH]
            complement(16155..19850) [3696 bp, 1231 aa]
          Length = 1231

 Score = 1196 bits (3094), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 621/1215 (51%), Positives = 870/1215 (71%), Gaps = 19/1215 (1%)

Query: 58   VHIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKRED 117
            ++IK VII GFKTYKN+T ++NFSPHHNVVVG NGSGKSNFFAAIRFVLS++ +NLKRE+
Sbjct: 1    MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 118  RKGFIYQGAGQVMSAFVEIIFDDPENLMLAPLRNDTGEVRIRRTVGLKKDEYMINDKNST 177
            R+  IYQG   VMS +VEI+F   EN  L   + D G + IRRTVGLKKDEYMIN+KN++
Sbjct: 61   RRSLIYQGTSSVMSGYVEIVFHGAENRTLLGAQ-DGGVIHIRRTVGLKKDEYMINNKNAS 119

Query: 178  RQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAKDLERLHLLEDVVGAKSFENKLKESLK 237
            R DV+R+LE+ GFSTSNPYNIVPQGRI+SLTNA++ ERL LLE+V+GAKSFE KLKESL+
Sbjct: 120  RSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRERLQLLEEVIGAKSFERKLKESLQ 179

Query: 238  KMEAAERDRTKITNELNELDKRXXXXXXXXXXXXXXXXXXRDRKVLQFCLYDRELNDITN 297
            KME  E++R KI  EL E++ +                  R RK+ QF LYDRELN++T+
Sbjct: 180  KMETTEKNREKIRIELEEVEAKLNELDEERKELEKYNSLDRKRKMCQFALYDRELNEVTS 239

Query: 298  QIEQLEGEYNSIIENSSEYVNELEKREVLAVELNKRMNSLESEIKIKQSTDLPQLKASKL 357
             +E+L+GEY + +  S +Y+ ELEKRE L   L K +N L SE+K+K+STDL Q K S+L
Sbjct: 240  MVEKLDGEYTNTLVLSEQYIQELEKRESLIETLTKSLNQLGSELKMKESTDLQQAKDSEL 299

Query: 358  EVAGELADLDTRLNDIQMQLDASQAHLESNVKEIGEVKKQIEINCSSIAEVQPKFQKLSN 417
            E+A  LADL+ +  ++  Q +A +    SN + +  ++ QI +    +A + P+F++L+ 
Sbjct: 300  ELAKHLADLNVKYEELISQNNALKEQSASNSESLLAIRSQIAVKEQQLARLSPRFEQLTI 359

Query: 418  EAEILKVEIEKLTKRQRELLSKKGKYEDFRTVNERNDWIQEQINLLNQSLNKSNILKDQL 477
            E   +K E + L +RQR+LL+K+GKY  FR   ER+ WI +++++L + L  S+I    +
Sbjct: 360  EEAAMKAEFKALQQRQRDLLAKRGKYSQFRNKAERDAWIDQELSILKEELQCSSIALTSI 419

Query: 478  TSQLSTLQHDLENLNAEIEDLADSVNGMGSVAQQEDLQNKVTQAKKEYLTKIDQRKQLWR 537
            + +  +L+  L  L+ +I +L DS +G G  A+ ED+Q ++T  KK +L KID+RKQLWR
Sbjct: 420  SEERDSLRIKLTTLDDQIMELNDSAHGPGINAELEDVQQELTVLKKAHLFKIDERKQLWR 479

Query: 538  TEQRLQTISTSLDNDVKRFESDMNETIDRSLALGLQNVNDIVNRLNLHE-HVFGPVGELI 596
            +EQ++Q++  SL +DVKR E  ++ET+DRSLA GL+NV++I  RLNL E  VFGP+GELI
Sbjct: 480  SEQKIQSVLESLVDDVKRAEGTLSETMDRSLATGLKNVSEIAQRLNLPEGSVFGPLGELI 539

Query: 597  KVSDKYKICAEVVGGNSLFNVVVDNEETASLLIKELFATKGGRVTFIPLNKLHVDTNFTY 656
            K+S+KYK CAEVVGG SLF+VVVD E TA+LL++EL+ +KGGRVTFIPLN++HVD+N  Y
Sbjct: 540  KISEKYKACAEVVGGTSLFHVVVDTENTAALLMQELYNSKGGRVTFIPLNRVHVDSNIVY 599

Query: 657  PNNLEKNQCTPLIKKIKYDVKFEKVIKQVFGRTLVVKSLIDGASLAKEYKLNAITLDGDR 716
            P+N +++ CTPLIKKIKYD KFE+ IK VFG+T+VVK L  G  LAK+++LNAITLDGD+
Sbjct: 600  PSN-DEHHCTPLIKKIKYDPKFERAIKHVFGKTIVVKDLNQGTKLAKQFRLNAITLDGDK 658

Query: 717  ADSKGVLSGGYLDQYKSNRLDTLRDFKQSKREYKKIQVELQEIKQALQSIEQEIDGLNNV 776
            ADS+GVL+GG+ D +K  RLD++RD K  K+E +  + +L+E+K+ L SI+QEID LN+ 
Sbjct: 659  ADSRGVLTGGFHDHHKQKRLDSMRDLKSLKKEQQGNKSQLEEVKEKLHSIDQEIDELNDK 718

Query: 777  VKDAAAERDAYEAGIEKARSQLKAKLSQKITIDDSIKALKARLNKIDTELEQCRERTNAF 836
            +K + + R+     +E    +L+    ++  +++++  L ++  K     +  +++ + +
Sbjct: 719  IKKSMSRREMILTQVEAVNIKLEKAKRERFLLEETMVQLISKEEKAKINQKLLQDKLDMY 778

Query: 837  AADISKPFVNELDADEKAELLAISNSIQTKETSLNFNLSTLNELSSKLDELNAELNSKLL 896
              D+S+ F  EL   E+ EL  I+  +   E  LN     L+ +  K+D L AEL+SKL 
Sbjct: 779  TEDLSRDFDTELTLTEREELDEIAKKLPDLENLLNTTTDALSSVVVKIDSLKAELDSKLK 838

Query: 897  PKLHELERKPSSSHS-LQISQINNQMELVLMEKQTVTRTKEQVESELSVLDSSIKSLRGE 955
            P+  ELE +P+   S   I  +   ++ V  E++T+   K  V++E+  +   I +L+  
Sbjct: 839  PQAKELEDQPNEIMSTTAIQNLQEHIDAVEDERKTLLERKSTVDNEVQKISEIIDTLKSR 898

Query: 956  KATLQKDLDKANSQQRSLVKRITNFQKNAEKVLLKKSTLNSRKEELQQLIREVGLLAEES 1015
            +   +K L+KANSQQR+L+K++ N+QK AEK +L+K TL++R++ELQQ IR++GLL ++S
Sbjct: 899  QEEEEKSLEKANSQQRALLKKLDNYQKEAEKSMLRKMTLSTRRDELQQKIRDIGLLPDDS 958

Query: 1016 LKKYKPLASDEILKKLNTTTGHLSKMTNVNKRASENYTRFEDKRGELTSRAEELDESKQS 1075
              KY  ++S E+LK+L++    +SKMTNVNKRA EN+ +F+DK+ ++  RA+ELDESK+S
Sbjct: 959  ADKYHNMSSSELLKELSSINDKISKMTNVNKRALENFKKFDDKQKDVMKRAKELDESKES 1018

Query: 1076 IENLIDQLKEQKITAIEKTFNKVADNFSRVFATLVPRGIGKLIINHRKNTDNSEVS---- 1131
            IE LID+LK+QK+ A+E TF KV++NF+++F  +VPRG GKL+I HR+  + S+ S    
Sbjct: 1019 IEKLIDKLKKQKVEAVENTFKKVSENFTQLFEKMVPRGTGKLVI-HRRENEPSKPSKRQQ 1077

Query: 1132 -------TKKRRRGARQEQNSAEALNESKYTGVSIQVSFNSKKDEQLRVEQLSGGQKTVC 1184
                   T+       Q++NS++   +S Y+GVSI+VSFNSKKDEQ+ VEQLSGGQKTVC
Sbjct: 1078 KKRKRQETEDVHFNDDQDENSSQ---DSIYSGVSIEVSFNSKKDEQVHVEQLSGGQKTVC 1134

Query: 1185 AIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFICTTFRTDMINVA 1244
            AIALILAIQMVDPAPFYLFDEIDAALDKQYR AVA T+K LS  AQFICTTFR DMI VA
Sbjct: 1135 AIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQLSSQAQFICTTFRGDMIAVA 1194

Query: 1245 DTFFRVKFENKVSTV 1259
            D F+RV FENK+STV
Sbjct: 1195 DRFYRVNFENKISTV 1209

>Scas_711.39
          Length = 1227

 Score = 1133 bits (2930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 604/1230 (49%), Positives = 851/1230 (69%), Gaps = 52/1230 (4%)

Query: 58   VHIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKRED 117
            ++IK V+I GFKTY+N+TV+++FSPHHN+V+GSNGSGKSNFF+AIRFVLS++ SNLKRE+
Sbjct: 1    MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 118  RKGFIYQGAG-QVMSAFVEIIFDDPENLMLAP----LRNDTGEVRIRRTVGLKKDEYMIN 172
            R+G I+QG+G  VMSA VEI+F DPE+ M+ P     R +  E+ IRRTVGLKKD+Y +N
Sbjct: 61   RQGLIHQGSGGSVMSASVEIVFHDPEHKMILPSGVVPRENNDEICIRRTVGLKKDDYQLN 120

Query: 173  DKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAKDLERLHLLEDVVGAKSFENKL 232
            D+N T+ DV R+LE+ GFS SNPYNIVPQG+IISLTNAKD ERL LLEDVVGAKSFE KL
Sbjct: 121  DRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKERLQLLEDVVGAKSFEVKL 180

Query: 233  KESLKKMEAAERDRTKITNELNELDKRXXXXXXXXXXXXXXXXXXRDRKVLQFCLYDREL 292
            K SLKKME  E+ R +I  E++EL+ +                  ++RKV QF LYDREL
Sbjct: 181  KASLKKMEETEQKRARIAKEMDELNSKLKEMEQERKELEKYNALEKNRKVFQFTLYDREL 240

Query: 293  NDITNQIEQLEGEYNSIIENSSEYVNELEKREVLAVELNKRMNSLESEIKIKQSTDLPQL 352
            NDI NQ+E+L+ +YN    +S +Y+ EL+KRE +   ++K ++ ++S +KIK +TDLPQ 
Sbjct: 241  NDIINQVERLDDDYNVTANSSEQYIKELDKREEIISNISKNLSEIDSTLKIKTTTDLPQA 300

Query: 353  KASKLEVAGELADLDTRLNDIQMQLDASQAHLESNVKEIGEVKKQIEINCSSIAEVQPKF 412
            K+   E+  +L +L  ++ D+++Q+ A +    S+ K +  +  +I+     ++ + PKF
Sbjct: 301  KSRHSELTNQLTNLQVQIKDLKLQIKAQERQANSDQKTLDIINDEIQKREQKLSSISPKF 360

Query: 413  QKLSNEAEILKVEIEKLTKRQRELLSKKGKYEDFRTVNERNDWIQEQINLLNQSL----- 467
            Q+LS E    K++  KL +RQR+LL KKG+Y  F ++ ERN+WIQ +I   +++L     
Sbjct: 361  QELSKEELKFKLQYNKLQQRQRDLLLKKGRYARFASIEERNEWIQNEIEESDKTLQGLVD 420

Query: 468  --NKSNILKDQLTSQLSTLQHDLENLNAEIEDLADSVNGMGSVAQQEDLQNKVTQAKKEY 525
              NK  I +D++ S++ +L  D++NLN       DS+ G     + E +Q+++ + K EY
Sbjct: 421  IKNKILIERDEINSKVRSLDEDIDNLN-------DSIEGPNVTGELEVIQDELEKLKSEY 473

Query: 526  LTKIDQRKQLWRTEQRLQTISTSLDNDVKRFESDMNETIDRSLALGLQNVNDIVNRLNLH 585
               ID+RK+LWR EQ+++T+  +L  +VK  E ++NET+DRSLA G+++V +I  +L L 
Sbjct: 474  AASIDKRKELWRNEQKIETVLQNLLENVKVLERNVNETMDRSLANGIKSVKEIATKLKLP 533

Query: 586  E-HVFGPVGELIKVSDKYKICAEVVGGNSLFNVVVDNEETASLLIKELFATKGGRVTFIP 644
            E  VFG +GELI V++KYKICAEVVGGNSLF++VVD EETA++++KEL+  KGGRVTFIP
Sbjct: 534  EDSVFGTLGELINVNEKYKICAEVVGGNSLFHIVVDTEETATIIMKELYKMKGGRVTFIP 593

Query: 645  LNKLHVDTNFTYPNNLEKNQCTPLIKKIKYDVKFEKVIKQVFGRTLVVKSLIDGASLAKE 704
            LN++++D N  YP N ++   TPLI KIKYD +F+K ++ +FG+T+VVK L  G  ++K+
Sbjct: 594  LNRIYLDANIQYPPN-DQTSFTPLINKIKYDQRFDKAVRHIFGKTIVVKDLTTGLRISKK 652

Query: 705  YKLNAITLDGDRADSKGVLSGGYLDQYKSNRLDTLRDFKQSKREYKKIQVELQEIKQALQ 764
            +KLN+ITLDGDRAD +GVL+GGY DQYK +RLD+L    +S  +++++ +EL  IKQA+Q
Sbjct: 653  FKLNSITLDGDRADKRGVLTGGYYDQYKQSRLDSLSTLNESTAKHRELSLELTSIKQAIQ 712

Query: 765  SIEQEIDGLNNVVKDAAAERDAYEAGIEKARSQLKAKLSQKITIDDSIKALKARLNKIDT 824
             ++  ID LNN ++     R++  + IE  +S+L+ K + KI +++S++AL  +  K + 
Sbjct: 713  EVDSNIDTLNNSIRKHNTNRESLLSNIEGMKSKLRNKKNDKILLEESLQALAIKTEKNEI 772

Query: 825  ELEQCRERTNAFAADISKPFVNELDADEKAELLAISNSIQTKETSLNFNLSTLNELSSKL 884
             +    ++   +  D+S  F +EL   EK EL   S S+   E  L      L  ++S++
Sbjct: 773  NIRVTADKKETYVKDMSSEFNSELSLVEKEELEVTSISLLEIEKKLTLTTENLETVTSEM 832

Query: 885  DELNAELNSKLLPKLHELERKPSSSHSLQISQINNQMELVLMEKQTVTRTKEQVESELSV 944
            + LNAELNSKL P+  ++  + S      +S +   ++ +  + + V   + Q  S L  
Sbjct: 833  NSLNAELNSKLFPQKQDILSQMSQEGLSYLSSLRRDVDSMTSKLEAV---QNQCNSALQH 889

Query: 945  LDS---SIKSLRGEKATLQKDLDKANSQQRSLVKRITNFQKNAEKVLLKKSTLNSRKEEL 1001
            +D+    I+ L+ EK    K L+KANSQQR L+K++  FQK+ EK ++KK+ L +R++EL
Sbjct: 890  VDTIQKEIEDLKSEKRNNDKILEKANSQQRLLLKKLETFQKDVEKTMIKKTALITRRDEL 949

Query: 1002 QQLIREVGLLAEESLKKYKPLASDEILKKLNTTTGHLSKMTNVNKRASENYTRFEDKRGE 1061
            QQ IRE+GLLAE++L  +  L+S+E+LK+LN+ +  +S + NVNKRA EN+ +F++K+ E
Sbjct: 950  QQKIREIGLLAEDALNAFNDLSSEELLKRLNSVSEDISGLKNVNKRAYENFRKFDEKQKE 1009

Query: 1062 LTSRAEELDESKQSIENLIDQLKEQKITAIEKTFNKVADNFSRVFATLVPRGIGKLIINH 1121
            L  RA ELDESK SI++LI +L++QK+TA++ TF KVA+NF  VF  LVP G  KLII H
Sbjct: 1010 LVERATELDESKTSIQDLITRLRQQKVTAVDSTFLKVAENFETVFEKLVPIGKAKLII-H 1068

Query: 1122 RKNTDNSEVSTKKRRRGARQEQNS----------AEAL--NESKYTGVSIQVSFNSKKDE 1169
            R   DN+          AR E NS           E +  NES YTGVSI VSFNSK++E
Sbjct: 1069 R--VDNN----------ARMETNSNDDDVDMDQEDEVINNNESIYTGVSISVSFNSKENE 1116

Query: 1170 QLRVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTA 1229
            QL VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYR AVA  IK LS  A
Sbjct: 1117 QLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANIIKQLSVNA 1176

Query: 1230 QFICTTFRTDMINVADTFFRVKFENKVSTV 1259
            QFICTTFRTDM+ VAD FFRVK+ENK+STV
Sbjct: 1177 QFICTTFRTDMLQVADRFFRVKYENKISTV 1206

>YJL074C (SMC3) [2838] chr10 complement(299073..302765) Cohesin,
            coiled-coil protein of the SMC family involved in
            chromosome condensation and segregation [3693 bp, 1230
            aa]
          Length = 1230

 Score = 1128 bits (2917), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 588/1212 (48%), Positives = 851/1212 (70%), Gaps = 13/1212 (1%)

Query: 58   VHIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKRED 117
            ++IK VII GFKTY+N T+++NFSPH NV++GSNGSGKSNFFAAIRFVLS++ SNLKRE+
Sbjct: 1    MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 118  RKGFIYQGAG-QVMSAFVEIIFDDPENLMLAP---LRNDTGEVRIRRTVGLKKDEYMIND 173
            R+G I+QG+G  VMSA VEI+F DP++ M+ P   L     EV IRRTVGLKKD+Y +ND
Sbjct: 61   RQGLIHQGSGGSVMSASVEIVFHDPDHSMILPSGVLSRGDDEVTIRRTVGLKKDDYQLND 120

Query: 174  KNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAKDLERLHLLEDVVGAKSFENKLK 233
            +N T+ D+ R+LE  GFS +NPYNIVPQG+I++LTNAKD ERL LLEDVVGAKSFE KLK
Sbjct: 121  RNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKERLQLLEDVVGAKSFEVKLK 180

Query: 234  ESLKKMEAAERDRTKITNELNELDKRXXXXXXXXXXXXXXXXXXRDRKVLQFCLYDRELN 293
             SLKKME  E+ + +I  E+ EL+ +                  R+RK+ QF LYDRELN
Sbjct: 181  ASLKKMEETEQKKIQINKEMGELNSKLSEMEQERKELEKYNELERNRKIYQFTLYDRELN 240

Query: 294  DITNQIEQLEGEYNSIIENSSEYVNELEKREVLAVELNKRMNSLESEIKIKQSTDLPQLK 353
            ++ NQ+E+L+G+YN+ + +S +Y+ EL+KRE +  +++K+++S+E+ +KIK +TDL Q K
Sbjct: 241  EVINQMERLDGDYNNTVYSSEQYIQELDKREDMIDQVSKKLSSIEASLKIKNATDLQQAK 300

Query: 354  ASKLEVAGELADLDTRLNDIQMQLDASQAHLESNVKEIGEVKKQIEINCSSIAEVQPKFQ 413
              + E++ +L +++ ++ D+Q Q+++++     +   + E+K  IE     ++++ P++Q
Sbjct: 301  LRESEISQKLTNVNVKIKDVQQQIESNEEQRNLDSATLKEIKSIIEQRKQKLSKILPRYQ 360

Query: 414  KLSNEAEILKVEIEKLTKRQRELLSKKGKYEDFRTVNERNDWIQEQINLLNQSLNKSNIL 473
            +L+ E  + K+++  L ++QR+L+ KKG+Y  F++ +ER+ WI  +I  L  S+   N L
Sbjct: 361  ELTKEEAMYKLQLASLQQKQRDLILKKGEYARFKSKDERDTWIHSEIEELKSSIQNLNEL 420

Query: 474  KDQLTSQLSTLQHDLENLNAEIEDLADSVNGMGSVAQQEDLQNKVTQAKKEYLTKIDQRK 533
            + QL    ++L+     ++ EIE+L DS+NG  +  Q ED  +++   K++    +D RK
Sbjct: 421  ESQLQMDRTSLRKQYSAIDEEIEELIDSINGPDTKGQLEDFDSELIHLKQKLSESLDTRK 480

Query: 534  QLWRTEQRLQTISTSLDNDVKRFESDMNETIDRSLALGLQNVNDIVNRLNLH-EHVFGPV 592
            +LWR EQ+LQT+  +L +DV + + ++NET+ RSLA G+ NV +I  +L +  E VFG +
Sbjct: 481  ELWRKEQKLQTVLETLLSDVNQNQRNVNETMSRSLANGIINVKEITEKLKISPESVFGTL 540

Query: 593  GELIKVSDKYKICAEVVGGNSLFNVVVDNEETASLLIKELFATKGGRVTFIPLNKLHVDT 652
            GELIKV+DKYK CAEV+GGNSLF++VVD EETA+L++ EL+  KGGRVTFIPLN+L +D+
Sbjct: 541  GELIKVNDKYKTCAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRLSLDS 600

Query: 653  NFTYPNNLEKN-QCTPLIKKIKYDVKFEKVIKQVFGRTLVVKSLIDGASLAKEYKLNAIT 711
            +  +P+N     Q TPLIKKIKY+ +FEK +K VFG+T+VVK L  G  LAK++KLNAIT
Sbjct: 601  DVKFPSNTTTQIQFTPLIKKIKYEPRFEKAVKHVFGKTIVVKDLGQGLKLAKKHKLNAIT 660

Query: 712  LDGDRADSKGVLSGGYLDQYKSNRLDTLRDFKQSKREYKKIQVELQEIKQALQSIEQEID 771
            LDGDRAD +GVL+GGYLDQ+K  RL++L++  +S+ ++KKI  EL  ++  L  I+ +ID
Sbjct: 661  LDGDRADKRGVLTGGYLDQHKRTRLESLKNLNESRSQHKKILEELDFVRNELNDIDTKID 720

Query: 772  GLNNVVKDAAAERDAYEAGIEKARSQLKAKLSQKITIDDSIKALKARLNKIDTELEQCRE 831
             +N  ++  + +R++    IE  R+ L  K ++K+ +++S+ A+  +L K++T     +E
Sbjct: 721  QVNGNIRKVSNDRESVLTNIEVYRTSLNTKKNEKLILEESLNAIILKLEKLNTNRTFAQE 780

Query: 832  RTNAFAADISKPFVNELDADEKAELLAISNSIQTKETSLNFNLSTLNELSSKLDELNAEL 891
            + N F  D+ + F +EL  +EK  L +++  I      LN     L  +++ +D LNAEL
Sbjct: 781  KLNTFENDLLQEFDSELSKEEKERLESLTKEISAAHNKLNITSDALEGITTTIDSLNAEL 840

Query: 892  NSKLLPKLHELERKPSSSHSLQISQINNQMELVLMEKQTVTRTKEQVESELSVLDSSIKS 951
             SKL+P+ ++LE K S      I  + ++++ + +EK++V +  E    EL  +   I+S
Sbjct: 841  ESKLIPQENDLESKMSEVGDAFIFGLQDELKELQLEKESVEKQHENAVLELGTVQREIES 900

Query: 952  LRGEKATLQKDLDKANSQQRSLVKRITNFQKNAEKVLLKKSTLNSRKEELQQLIREVGLL 1011
            L  E+   +K L+KAN+QQR L+K++ NFQK+ EK ++KK+TL +R+EELQQ IRE+GLL
Sbjct: 901  LIAEETNNKKLLEKANNQQRLLLKKLDNFQKSVEKTMIKKTTLVTRREELQQRIREIGLL 960

Query: 1012 AEESL-KKYKPLASDEILKKLNTTTGHLSKMTNVNKRASENYTRFEDKRGELTSRAEELD 1070
             E++L   +  + SD++L++LN     +S + NVNKRA EN+ +F ++R +L  RA ELD
Sbjct: 961  PEDALVNDFSDITSDQLLQRLNDMNTEISGLKNVNKRAFENFKKFNERRKDLAERASELD 1020

Query: 1071 ESKQSIENLIDQLKEQKITAIEKTFNKVADNFSRVFATLVPRGIGKLIINHRKN---TDN 1127
            ESK SI++LI +LK+QK+ A++ TF KV++NF  VF  LVPRG  KLII HRKN    D+
Sbjct: 1021 ESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGTAKLII-HRKNDNANDH 1079

Query: 1128 SEVSTKKRRRGARQEQNSAEALNESKYTGVSIQVSFNSKKDEQLRVEQLSGGQKTVCAIA 1187
             E         + + QN  ++  E  YTGVSI VSFNSK++EQL VEQLSGGQKTVCAIA
Sbjct: 1080 DESIDVDMDAESNESQNGKDS--EIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIA 1137

Query: 1188 LILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFICTTFRTDMINVADTF 1247
            LILAIQMVDPA FYLFDEIDAALDKQYR AVA  +K LS  AQFICTTFRTDM+ VAD F
Sbjct: 1138 LILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQFICTTFRTDMLQVADKF 1197

Query: 1248 FRVKFENKVSTV 1259
            FRVK+ENK+STV
Sbjct: 1198 FRVKYENKISTV 1209

>Kwal_14.2435
          Length = 1247

 Score = 1111 bits (2873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 591/1228 (48%), Positives = 832/1228 (67%), Gaps = 45/1228 (3%)

Query: 55   VEMVHIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLK 114
            VEM +I++V+I GFKTY+N T VE+FSPH NVV+G NGSGKSNFFAA+RFVLS++ S+LK
Sbjct: 23   VEM-YIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLK 81

Query: 115  REDRKGFIYQGAGQVMSAFVEIIFDDPENLMLAPLRNDTGE---VRIRRTVGLKKDEYMI 171
            RE+R+G I+QG G +MSA+VEI+F DP + M+        E   VR+RRT+GLKKDEY +
Sbjct: 82   REERQGLIHQGTGSIMSAYVEIVFHDPSDQMMMTSGIPVTEEHIVRVRRTIGLKKDEYSV 141

Query: 172  NDKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAKDLERLHLLEDVVGAKSFENK 231
            N K   + D+ R+ E+VGFS SNPYNIVPQGRI+++TNAKD ERL LLEDVVGA+SFE K
Sbjct: 142  NGKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDKERLLLLEDVVGARSFEIK 201

Query: 232  LKESLKKMEAAERDRTKITNELNELDKRXXXXXXXXXXXXXXXXXXRDRKVLQFCLYDRE 291
            L+ES KKMEA  RDR KIT+EL+EL  R                  RDR++ QF LYDRE
Sbjct: 202  LRESSKKMEATNRDRAKITSELSELKARLEELDEERQELEKYQELERDRRIFQFVLYDRE 261

Query: 292  LNDITNQIEQLEGEYNSIIENSSEYVNELEKREVLAVELNKRMNSLESEIKIKQSTDLPQ 351
            LN++T+QIE LE EYN+++++S EY+ EL KRE L   L K ++++E+E+K+K+STD  Q
Sbjct: 262  LNEVTSQIESLEDEYNNVLQSSEEYIQELYKRETLIANLTKNISNVEAELKLKESTDFQQ 321

Query: 352  LKASKLEVAGELADLDTRLNDIQMQLDASQAHLESNVKEIGEVKKQIEINCSSIAEVQPK 411
             K+   E+    ADL+ R  + + Q D          K +  V+++I+   + +  + P+
Sbjct: 322  DKSRLQEIVKRKADLEIRYEETKRQRDQVHGQCAVYRKNLATVEEEIQNTSTQLNRLSPR 381

Query: 412  FQKLSNEAEILKVEIEKLTKRQRELLSKKGKYEDFRTVNERNDWIQEQINLLNQSLNKSN 471
            +++L  EAE  + ++ +  ++QRE++SK+G Y  F   +ER+ WI ++++ L        
Sbjct: 382  YEQLKLEAEAFEAQLSQYQRKQREIISKRGIYAQFENQSERDAWIAKELSSLKAQ----- 436

Query: 472  ILKDQLTSQLSTLQHDLENLNAEIE-------DLADSVNGMGSVAQQEDLQNKVTQAKKE 524
               D L   +  ++ + E + AEI+       +L DSV G G  ++ +D+Q  +   K+ 
Sbjct: 437  --TDDLKKNVEIMEAEKEQVAAEIQQDKEAITELNDSVRGPGISSELQDIQTHLNDLKRS 494

Query: 525  YLTKIDQRKQLWRTEQRLQTISTSLDNDVKRFESDMNETIDRSLALGLQNVNDIVNRLNL 584
            YL KID+RK+LWR+EQRLQT+S +L + VKR E +++ET+DR+LA GL+ V +I  RL L
Sbjct: 495  YLEKIDERKELWRSEQRLQTVSEALLDGVKRSERNLSETMDRNLANGLKAVREITQRLKL 554

Query: 585  HE-HVFGPVGELIKVSDKYKICAEVVGGNSLFNVVVDNEETASLLIKELFATKGGRVTFI 643
                V GP+GELIKV++KYK CAE VGGNSL +VVVD EETAS+L+ EL+ TK GRVTFI
Sbjct: 555  PPGAVHGPLGELIKVNEKYKTCAEAVGGNSLLHVVVDTEETASILMSELYNTKAGRVTFI 614

Query: 644  PLNKLHVDTNFTYPNNLEKNQCTPLIKKIKYDVKFEKVIKQVFGRTLVVKSLIDGASLAK 703
            PLN++      T+P N +  +CTPL+ KIKYD  FEK ++ VFGRT+VV+ L +G+ LA+
Sbjct: 615  PLNRISDRNAVTFPENAQA-ECTPLLWKIKYDKVFEKAVRHVFGRTIVVRDLGNGSKLAR 673

Query: 704  EYKLNAITLDGDRADSKGVLSGGYLDQYKSNRLDTLRDFKQSKREYKKIQVELQEIKQAL 763
             Y L+A+TLDGDRAD++GV++GGY D +K  RLD L+D   +K +  +    L  ++  +
Sbjct: 674  SYNLDAVTLDGDRADNRGVITGGYHDYHKRTRLDCLKDISSAKEQLTQATQSLNAVRLKI 733

Query: 764  QSIEQEIDGLNNVVKDAAAERDAYEAGIEKARSQLKAKLSQKITIDDSIK-----ALKAR 818
             +I+ EID +N  +K  AA +DA  A IE     L+ K+S K+T D + K     A+  +
Sbjct: 734  GAIDSEIDNVNGELKAQAARKDAILANIEG----LRLKMS-KMTADSTFKMENLEAMTVK 788

Query: 819  LNKIDTELEQCRERTNAFAADISKPFVNELDADEKAELLAISNSIQTKETSLNFNLSTLN 878
            LN++ T L    E+   +  D+ KPF   L  +E+  L +++  I+     +      L+
Sbjct: 789  LNRLKTSLTVNEEKIEKYEDDLKKPFEKNLSDEEEEALKSLAVEIRKLSEPMARTTEALS 848

Query: 879  ELSSKLDELNAELNSKLLPKLHELERKPSSSHSLQISQINNQMELVLMEKQTVTRTKEQV 938
            ELS ++D L  ELN KL P+  +LE +    +S      N ++E +  E + +   ++ +
Sbjct: 849  ELSLRIDLLKTELNVKLNPQKRDLENRLEEEYSRDDLTTNRELEHMADELKKLAVKEQDL 908

Query: 939  ESELSVLDSSIKSLRGEKATLQKDLDKANSQQRSLVKRITNFQKNAEKVLLKKSTLNSRK 998
            ++ L+ L  +I +L  E+A  Q+ L+KA+SQQR+LVK++  FQK AEK ++KK++L +R+
Sbjct: 909  QTSLASLTEAIGTLSEERANYQQLLEKADSQQRALVKKLDTFQKEAEKSVIKKTSLITRR 968

Query: 999  EELQQLIREVGLLAEESLKKYKPLASDEILKKLNTTTGHLSKMTNVNKRASENYTRFEDK 1058
            +E+Q  I E+GLL+EESL++++ L ++ IL+KLNT    +SKM+N+N+RA EN+ +F DK
Sbjct: 969  DEVQLRISEIGLLSEESLERHQNLETERILRKLNTVNDKISKMSNINRRAIENFKKFNDK 1028

Query: 1059 RGELTSRAEELDESKQSIENLIDQLKEQKITAIEKTFNKVADNFSRVFATLVPRGIGKLI 1118
            R +L SRAEEL++SK+SIE L++ LK+QK+ A+E TF+KVA NF+ +F  LVP GIG+LI
Sbjct: 1029 REDLESRAEELEQSKESIEKLVESLKKQKVEAVEATFSKVATNFTTIFEKLVPAGIGRLI 1088

Query: 1119 INHRKNTDNSEVSTKKRRRGARQEQNSAEALN------ESKYTGVSIQVSFNSKKDEQLR 1172
            I HR        +T+K  RG  Q       LN      +S Y+GVSI VSFNSK +EQL 
Sbjct: 1089 I-HR--------TTEKSNRGTGQRSPEYSPLNSNADTLDSMYSGVSISVSFNSKNNEQLY 1139

Query: 1173 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFI 1232
            VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYR +VA TIK LS  AQFI
Sbjct: 1140 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQFI 1199

Query: 1233 CTTFRTDMINVADTFFRVKFENKVSTVT 1260
            CTTFRTDM+ VAD+F+RVKFENK+S + 
Sbjct: 1200 CTTFRTDMLQVADSFYRVKFENKISEIA 1227

>CAGL0H02805g complement(256682..260341) similar to sp|P47037
            Saccharomyces cerevisiae YJL074c SMC3 required for
            structural maintenance of chromosomes, start by
            similarity
          Length = 1219

 Score = 1057 bits (2734), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 573/1221 (46%), Positives = 831/1221 (68%), Gaps = 42/1221 (3%)

Query: 58   VHIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKRED 117
            ++IK VII GFKTY+N T++ +FSPHHNVV+G+NGSGKSNFFAA+RFVLS++ SNLKRE+
Sbjct: 1    MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 118  RKGFIYQGAG-QVMSAFVEIIFDDPENLMLAPLR-NDTG---EVRIRRTVGLKKDEYMIN 172
            R+G I+QGAG  VMSA VEI+F DPE+ ++AP   N  G   EVRIRRTVGLKKD+Y +N
Sbjct: 61   RQGLIHQGAGASVMSASVEIVFHDPEHSIIAPTGINSNGSSDEVRIRRTVGLKKDDYQVN 120

Query: 173  DKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAKDLERLHLLEDVVGAKSFENKL 232
            D+N T+ D+ R+LE+ GF  SNPYNIVPQGRI+SLTNAKD ERL LLE+VVGAKSFE KL
Sbjct: 121  DRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKERLQLLEEVVGAKSFEVKL 180

Query: 233  KESLKKMEAAERDRTKITNELNELDKRXXXXXXXXXXXXXXXXXXRDRKVLQFCLYDREL 292
            K S+K+M+  E+ R +I+ E+ EL+ +                  RDRKVL++ L+DREL
Sbjct: 181  KASMKQMDETEQKRAQISAEMEELESKLNEMEKERKELEKYNSLERDRKVLRYTLHDREL 240

Query: 293  NDITNQIEQLEGEYNSIIENSSEYVNELEKREVLAVELNKRMNSLESEIKIKQSTDLPQL 352
             DI +QIE L+G+YN  + +S +Y+ ELEKRE +  E+N+ + +L+  +K+K + DL Q 
Sbjct: 241  QDIISQIESLDGDYNDTLGSSKKYILELEKRENMIKEVNEEIKNLQKSLKLKATVDLEQA 300

Query: 353  KASKLEVAGELADLDTRLNDIQMQLDASQAHLESNVKEIGEVKKQIEINCSSIAEVQPKF 412
            KA   E       +  +L DI+ ++  ++   +++ K +  + + I+   S   ++ P+F
Sbjct: 301  KAILEESLERSEAIKLQLKDIKEKIKQNKEQHDNDRKNLKLITEIIDSKKSKRRKISPRF 360

Query: 413  QKLSNEAEILKVEIEKLTKRQRELLSKKGKYEDFRTVNERNDWIQEQINLLNQSLNKSNI 472
             +L +E +++K  +++  ++Q   L KKG Y  F++  ER++WI  +I  L++S+N    
Sbjct: 361  DQLQSEEKLIKHHLKECIEKQNNFLLKKGSYARFKSKEERDEWINSKIKELSESINTMKA 420

Query: 473  LKDQLTSQLSTLQHDLENLNAEIEDLADSVNGMGSVAQQEDLQNKVTQAKKEYLTKIDQR 532
               +L  Q S++   +      IE+L DS+NG G  A+ ED++ ++   +++Y   ID R
Sbjct: 421  STTELKEQKSSIDVKINESENNIEELEDSLNGPGIKAEIEDIEKELINLRRKYTANIDAR 480

Query: 533  KQLWRTEQRLQTISTSLDNDVKRFESDMNETIDRSLALGLQNVNDIVNRLNLH-EHVFGP 591
            K+ WR EQ+LQ IS SL N+VK  E  +NET+ RSLA G +NV +I  RLNL  E VFG 
Sbjct: 481  KEKWREEQKLQMISDSLVNEVKENERSLNETMSRSLANGFKNVKEICERLNLGTESVFGT 540

Query: 592  VGELIKVSDKYKICAEVVGGNSLFNVVVDNEETASLLIKELFATKGGRVTFIPLNKL-HV 650
            VGELI+V++KYK+CAEV+GGNSLF+VVVD +ETAS+L+ ELF  KGGRVTF+PLNKL + 
Sbjct: 541  VGELIQVNEKYKVCAEVIGGNSLFHVVVDTDETASILMNELFRMKGGRVTFMPLNKLKNG 600

Query: 651  DTNFTYPNNLEKNQCTPLIKKIKYDVKFEKVIKQVFGRTLVVKSLIDGASLAKEYKLNAI 710
            + N  YP++     CTPLIKKIKYD++F+ V+KQVFGR LVVK L +G S++K+YKL+ I
Sbjct: 601  NQNIDYPSD-PNIPCTPLIKKIKYDMQFDCVVKQVFGRALVVKDLTNGLSISKQYKLSCI 659

Query: 711  TLDGDRADSKGVLSGGYLDQYKSNRLDTLRDFKQSKREYKKIQVELQEIKQALQSIEQEI 770
            TLDGDR D KGVL+GGYL+Q K +RL+ L+    SKR+  +I  +L EIK  L  ++ +I
Sbjct: 660  TLDGDRVDGKGVLTGGYLEQSKKSRLELLQTVALSKRQLLEISAKLTEIKNELTEMDNDI 719

Query: 771  DGLNNVVKDAAAERDAYEAGIEKARSQLKAKLSQKITIDDSIKALKARLNKIDTELEQCR 830
            D  N  ++     ++  ++ +   + +L  + ++ + +      +  +++ +D  L    
Sbjct: 720  DSTNGSIRLVMNRKENMQSNLNTWKHKLSHERNELLFLQQEKTNICEKIDSVDLNLGVSG 779

Query: 831  ERTNAFAADISKPFVNELDADEKAELLAISNSIQTKETSLNFNLSTLNELSSKLDELNAE 890
            E+      D++K F NEL  +EK E+  +S  I   +  LN    TL+ LS ++D + AE
Sbjct: 780  EKLTQLKIDLTKTFNNELTTEEKKEIEILSKEILENQNKLNLTSETLSHLSVEIDTITAE 839

Query: 891  LNSKLLPKLHELERK-PSSSHSLQISQINNQMELVLMEKQTVTRTKEQVESELSV----- 944
            L SKL+P+ +++++K   SS S+        +E +L++ + +     + +++L++     
Sbjct: 840  LESKLIPQQNDIKQKLLDSSDSI--------IEQLLLDSEELEGRASEADNQLTIQKRAL 891

Query: 945  --LDSSIKSLRGEKATLQKDLDKANSQQRSLVKRITNFQKNAEKVLLKKSTLNSRKEELQ 1002
              ++  I+S + E    ++ L+KAN+QQR L+K++  +QK+ +K ++KK+TL +RK+E++
Sbjct: 892  QSIEKEIESTKAEITNKERILEKANNQQRLLLKKLDEYQKDVDKTMIKKTTLATRKKEIE 951

Query: 1003 QLIREVGLLAEESLKKYKPLASDEILKKLNTTTGHLSKMTNVNKRASENYTRFEDKRGEL 1062
            Q IREVG+++E++L K+K L+S+++L KLN     +S M N+NKRA ENY +F +K+ EL
Sbjct: 952  QKIREVGIISEDTLDKFKTLSSEDLLLKLNEANKEISGMRNINKRAFENYKKFNEKQSEL 1011

Query: 1063 TSRAEELDESKQSIENLIDQLKEQKITAIEKTFNKVADNFSRVFATLVPRGIGKLIINHR 1122
              RA ELD+SKQSI++LI +LKEQK+ A++KTF+KV+ NF  +F  +VPRG   L I HR
Sbjct: 1012 RERATELDDSKQSIQDLIIKLKEQKLNAVDKTFDKVSKNFVMIFEKIVPRGTATLNI-HR 1070

Query: 1123 KNT----DNSEVSTKKRRRGARQEQNSAEALNESKYTGVSIQVSFNSKKDEQLRVEQLSG 1178
             N     DNSE+ T+                + + Y GVSI VSFNSK+DEQL+VEQLSG
Sbjct: 1071 INLQGTDDNSELFTQSNE-------------HTTPYEGVSISVSFNSKQDEQLKVEQLSG 1117

Query: 1179 GQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFICTTFRT 1238
            GQKTVCAIALILAIQMV+PAPFYLFDEIDAALDKQYR AVA+TI  LS+ AQFICTTFR+
Sbjct: 1118 GQKTVCAIALILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQLSNNAQFICTTFRS 1177

Query: 1239 DMINVADTFFRVKFENKVSTV 1259
            DM++ A+ F+RVK+ENK S+V
Sbjct: 1178 DMVDAANKFYRVKYENKQSSV 1198

>Scas_565.6
          Length = 1170

 Score =  219 bits (557), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 328/1302 (25%), Positives = 571/1302 (43%), Gaps = 233/1302 (17%)

Query: 58   VHIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKR-E 116
            + ++ +II GFK+Y  RTV+ ++ P  N + G NGSGKSN   AI FVL   +  + R  
Sbjct: 1    MKVEELIIDGFKSYATRTVIADWDPQFNAITGLNGSGKSNILDAICFVLGISSMTIVRAS 60

Query: 117  DRKGFIYQ-GAGQVMSAFVEIIFDDPENLMLAPLRNDTGEVRIRRTVGLK-KDEYMINDK 174
            + +  IY+ G   V  A V I+FD+ +        N++ ++ + R + L    +Y+IN  
Sbjct: 61   NLQDLIYKRGQAGVTKASVTIVFDNSDKTNSPIGFNNSSKISVTRQIILGGTSKYLINGH 120

Query: 175  NSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAKDLERLHLLEDVVGAKSFENKLKE 234
             + +Q V ++ ++V  + +NP  ++ QG+I  + N K  E L L+E+  G K FEN+   
Sbjct: 121  RAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPNEILSLIEEAAGTKMFENR--- 177

Query: 235  SLKKMEAAERDRTKITNELNELDKRXXXXXXXXXXXXXXXXXXRDRKVLQFCLYDRELND 294
                 E AER   K   +L E                        R +L+         +
Sbjct: 178  ----REKAERTMAKKETKLQE-----------------------SRTLLE--------EE 202

Query: 295  ITNQIEQLEGEYNSIIENSSEYVN-ELEKREVLAVELNKRMNSLESEIKIKQSTD--LPQ 351
            I  ++E+L  E    +E  +   + E   + V A +    +N   S   + +S++  + +
Sbjct: 203  IEPKLEKLRNEKRMFLEFQTTQADFEKTMKVVHAFDYKNMINRHASVKDVLESSEARMAE 262

Query: 352  LKASKLEVAGELADLDTRLNDIQMQL------DASQAHLESN----VKEIGEVKKQIEIN 401
            LK   L  A E+  L+  L  +++Q       DA+ + LE      + E+  +K    I 
Sbjct: 263  LKGLILRTAEEIGSLNEDLEQVKIQKEKELDKDATLSRLEKEESELLNEVSRIKTSHSIC 322

Query: 402  CSSIAEVQPKFQKLSNEAEILKVEIEKLTKRQRELLSKKGKYEDFRT----VNERNDWIQ 457
              +I E   + +KL ++ E  K+    L ++     S + +Y++       + E     +
Sbjct: 323  NDNIKENNKQVEKLKSDIEQFKL---TLKEKSETFESTEKEYQEINASLAKIKETYSKKE 379

Query: 458  EQINLLNQSLNKSNILKDQLTSQLSTLQHDLENLNAEIEDLA--------DSVNGMGSVA 509
            E ++ L   +  +       ++QL+  ++ L +    I+ L+        + VN    + 
Sbjct: 380  ELLSTLLTGITSTGDTDGGYSAQLTIAKNKLNDTEVSIKKLSMRIDILNKELVNNQPKL- 438

Query: 510  QQEDLQNKVTQA--KKEYLTKIDQRKQLWRT------EQRLQTISTSLDNDVKRFESDMN 561
            QQ  ++N+  +   +K     +D  +QL ++       + L+T   SL  ++ R E+  N
Sbjct: 439  QQAKIENEKIRGNVEKHKHVCLDLEQQLSKSGFDPLRTKELKTRENSLRQEIHRVET-QN 497

Query: 562  ETIDRSLALGLQNVNDIVNRLNLHEH-----VFGPVGELIKVSDKYKICA---EVVGGNS 613
            E + R +A GL       N  N  E+     V G   +L  ++  +   A   +V  G  
Sbjct: 498  ENLKRRVA-GLD-----FNYTNPSENFDARSVKGVAAQLFTLNKDHFDAASALQVCAGGR 551

Query: 614  LFNVVVDNEETASLLIKELFATKGGRVTFIPLNKLHVDT----NFTYPNNLEKNQCTPLI 669
            L+NVVVDNE+TASLL+++    K  RVT IPLNK+   T          ++   +    +
Sbjct: 552  LYNVVVDNEKTASLLLEKGRLRK--RVTIIPLNKIAARTLNARTLQMAKDIAPGKVELAL 609

Query: 670  KKIKYDVKFEKVIKQVFGRTLVVK--SLIDGASLAKEYKLNAITLDGDRADSKGVLSGGY 727
              I YD +  + ++ +FG +LV +  +     +   + +  +ITLDGD  D +G LSGG 
Sbjct: 610  NLIGYDDEVSRAMEFIFGGSLVCQDANTAKKVTFHPQIRTRSITLDGDVYDPEGTLSGGS 669

Query: 728  LDQYKSNRLDTLRDFKQSKREYKKIQVELQEIKQALQSIE---QEIDGLNN--------- 775
                 +N L  ++ + +S +  KK++ EL +I   L++ E   Q+   L N         
Sbjct: 670  -RNNTNNLLINIQTYNESCQTLKKLRYELDDIVSLLRAQEATSQKTKLLQNNLNLAQHKL 728

Query: 776  -----VVKDAAAER-----DAYEAGIEKARSQLKAKLSQKITIDD---SIKALKARLNKI 822
                  ++D +A +     +     IE   S +    SQ+ T+ D    I+ +K  +N+ 
Sbjct: 729  HLAQRALEDNSATQIIRRNEELHKEIETCHSDIT---SQQSTVRDYEMEIERIKKDMNEF 785

Query: 823  D----TELEQCRERTNAFAADISKPFVNELDADEKAELLA--------ISNSIQTKETSL 870
            D     +L++ ++     A  I+K    E  AD K+EL          + + I   ET++
Sbjct: 786  DQNKGAKLQELKDGLQKMAEKITK---QEQMADVKSELYQNIQLETEQLESDISANETAI 842

Query: 871  NFNLSTLNELSS-------KLDELNAELNSKLLPKLHELERKPSSSHSLQISQINNQMEL 923
               ++ L  L         KLD LNAE+ S +  KL+E +R+      L I     ++E 
Sbjct: 843  EQVITALTTLEEERQQTEKKLDNLNAEI-STVQTKLNEEKRRL-----LDIDDELRELEN 896

Query: 924  VLMEKQTVTRTKEQVESELSVLDSSIKSLRGEKATLQKDLDKANSQQRSLVKRITNFQKN 983
            ++ EK      + +   EL            E+  L  +LDK  S   SL KRI++    
Sbjct: 897  LIKEK-----NENKANWEL------------EQQRLTHELDKNKSNTNSLQKRISDLLTE 939

Query: 984  AEKV----LLKKSTLNSRKEELQQLIREVGLLAEESLKKYKPLASDEILKKLNTTTGHLS 1039
             E +    L++     +R   L +  RE G   EE           E+ +K+N     +S
Sbjct: 940  QEWLRDNDLVEGIIQENRGVNLAEY-RERGNQLEEKFH--------EMRRKINPNI--MS 988

Query: 1040 KMTNVNKRASENYTRFEDKRGELTSRAEELDESKQSIENLIDQLKEQKITAIEKTFNKVA 1099
             + NV K+ S            L      +++ K  I+  I +L E K   + KT+ KV 
Sbjct: 989  MIENVEKKESA-----------LKVMIRTIEKDKVKIQETISKLNEYKRDTLIKTWEKVT 1037

Query: 1100 DNFSRVFATLVPRGIGKLIINHRKNTDNSEVSTKKRRRGARQEQNSAEALNESKYTGVSI 1159
            ++F  +FA L+P    KL+ +  K+                               G+ +
Sbjct: 1038 EDFGHIFADLLPNSFAKLVPSEGKDVTE----------------------------GLEV 1069

Query: 1160 QVSF-NSKKDEQLRVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAV 1218
            +V   N  KD  +   +LSGGQ+++ A++LI+A+    PAP Y+ DE+DAALD  +   +
Sbjct: 1070 RVKLGNLWKDSLV---ELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNI 1126

Query: 1219 ARTIKNLSDTAQFICTTFRTDMINVADTFFRVKFENKVSTVT 1260
               IK     +QFI  + +  M + A+  FR +F+N  S V+
Sbjct: 1127 GHLIKTRFKGSQFIVVSLKEGMFSNANRVFRTRFQNGTSVVS 1168

>CAGL0D05258g 500858..504370 similar to sp|P38989 Saccharomyces
            cerevisiae YFR031c SMC2 chromosome segregation protein,
            start by similarity
          Length = 1170

 Score =  202 bits (515), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 322/1326 (24%), Positives = 561/1326 (42%), Gaps = 281/1326 (21%)

Query: 58   VHIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLS-EENSNLKRE 116
            + ++ +II GFK+Y  RTV+ ++ P  N + G NGSGKSN   AI FVL     + ++  
Sbjct: 1    MKVEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRAS 60

Query: 117  DRKGFIYQ-GAGQVMSAFVEIIFDDPENLMLAPLRNDTGEVRIRRTVGL-KKDEYMINDK 174
            + +  IY+ G   V  A V I+FD+ +        ++  ++ + R + L    +Y+IN  
Sbjct: 61   NLQDLIYKRGQAGVTKASVTIVFDNTDKSNTPIGFSEYPKISVTRQIVLGGTSKYLINGH 120

Query: 175  NSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAKDLERLHLLEDVVGAKSFENKLKE 234
             + +Q V ++ ++V  + +NP  ++ QG+I  + N K  E L L+E+  G K FE+    
Sbjct: 121  RAPQQSVLQLFQSVQLNINNPNFLIMQGKITKILNMKPSEILSLIEEAAGTKMFED---- 176

Query: 235  SLKKMEAAERDRTKITNELNELDKRXXXXXXXXXXXXXXXXXXRDRKVLQFCLYDRELND 294
               + E AER   K   +L E                       +R +L+         +
Sbjct: 177  ---RKEKAERTMQKKETKLQE-----------------------NRTLLK--------EE 202

Query: 295  ITNQIEQLEGEYNSIIENSSEYVN-ELEKREVLAVELNKRMNSLESEIKIKQSTDLPQLK 353
            I  Q+E+L  E    +E  +   + E  ++ V+A +  K +NS +S   IK   +    K
Sbjct: 203  IDPQLEKLRNEKRLFLEFQTIQADLETTEKVVIATDYQKMLNSRDS---IKTVLETSNSK 259

Query: 354  ASKLEVAGELADLD-TRLN-DIQMQLDASQAHLE--SNVK-----------EIGEVKKQI 398
              +L+   +L + + + LN D+Q  +   +  LE  +N+K           EI ++K  +
Sbjct: 260  MDELQKKIDLVNREISNLNEDLQQTMKQKKKELENDTNIKAMESKEDKLLSEIAKLKANL 319

Query: 399  EINCSSIAEVQPKFQKLSNEAEILKVEIEKLTKRQRELLSKKGKYEDFRTVNERNDWIQE 458
            +IN  +I + + K ++L+       V+IEK     ++LL  K +  +      RN   + 
Sbjct: 320  KINGDNILDGKQKQKRLT-------VKIEK----SKQLLDSKSQLLEDSKSKSRN--CEA 366

Query: 459  QINLLNQSLNKSNILKDQLTSQLSTLQHDLENLNAEIEDLADSVNGMG----------SV 508
             +  LN    +   L   L++ +S+         A+I  + D +N              +
Sbjct: 367  DLTRLNSIFKQKEELLSVLSTGISSTGGTEGGYEAQISSVNDKINDNSIEIEKNKMKIEL 426

Query: 509  AQQEDLQN--KVTQAKKEYLTKIDQRKQLWRTEQRLQ------TISTSLDNDVKRFESDM 560
             ++E ++N  K+ +++ +  T + +RKQL    ++L+              ++K  E ++
Sbjct: 427  LKKEFMENEEKIGKSQLQVETHMKERKQLTEICKKLEEDIFSHGFRPEAFKELKNREYEL 486

Query: 561  NETI---DRSLALGLQNVNDIVNRLNLHEHVFGP------VGELIKVSD---KYKICAEV 608
            ++ I   +R      + V  I  + +     F P        EL  + +   KY I  ++
Sbjct: 487  DQAIYKTNRDCEGLRRRVAGIEFQYSKPFESFDPNSVKGVTAELFSIPEQNMKYVIGLQI 546

Query: 609  VGGNSLFNVVVDNEETASLLIKELFATKGGRVTFIPLNKLHVDTNFTYPNNLEK----NQ 664
              G  L+NV+VDNE+T S L+++    K  RVT IPL+K+      + P N  K     Q
Sbjct: 547  CAGGRLYNVIVDNEKTGSALLQKGRLRK--RVTIIPLDKV-----ISRPLNQNKLKLAKQ 599

Query: 665  CTP-----LIKKIKYDVKFEKVIKQVFGRTLVVKSLIDGASLAKEYKLN------AITLD 713
              P      +  I Y  +  K ++ +FG +L+     D A  AK+   N      +ITL+
Sbjct: 600  LAPGKVELALNLIGYSDEVVKAMEFIFGNSLIC----DDAETAKKITFNPGIRTRSITLE 655

Query: 714  GDRADSKGVLSGGY----------LDQY-------------KSNRLDTLRDFKQSKREYK 750
            GD  D +G LSGG           + QY             K N    L+  +    E  
Sbjct: 656  GDIYDPEGTLSGGTRNNTNTLLVDIQQYNTLKKELLAMNEEKQNIHKQLKILEAKSNETS 715

Query: 751  KIQVELQEIKQALQ-------------------SIEQEIDGLNNVVKDAAAERDAYEAGI 791
             +Q EL   K  L                     IE E+  L +  K    E  + EA I
Sbjct: 716  NLQKELSLKKHRLDILERTMNSEPSLMMQNRNGEIENEVKTLEDSTKQKMLENSSLEAEI 775

Query: 792  EKARSQLKAKLSQKITIDDSIKALKARLNKIDTELEQCRERTNAFAADISKPFVNELDAD 851
            EK R  +         +D S K   A+L ++  E+ +  E+     ++  K  +N+    
Sbjct: 776  EKLRKDM---------VDFS-KNKGAKLKELKAEVHELNEQIKDLESESEK--LNDTYEK 823

Query: 852  EKAELLAISNSIQTKETSLNFNLSTLNELSSKLDELNAELNSKLLPKLHEL--------- 902
             K E   I+N I T   SL+   ST+ ++  KL+E   ++N  L     EL         
Sbjct: 824  IKVETEQIANEIDTDTKSLD---STVQDIEKKLEE-EIKINKMLKTSEEELMSVQNDLNV 879

Query: 903  ERKPSSSHSLQISQINNQMELVLMEKQTVTRTKEQVESELSVLDSSIKSLRGEKATLQKD 962
            ERK       +IS I++++E        + RT +Q E   +  +  +K        L  D
Sbjct: 880  ERK-------RISNIDDELE-------ELERTIKQKEESKNTYELELKQ-------LHHD 918

Query: 963  LDKANSQQRSLVKRITNFQKNAEKVLLKKSTLNSRKEELQQLIREV-----GLLAEESLK 1017
            L K  +    + K + + Q+  E V           +E+  L+R +     G+   E   
Sbjct: 919  LSKYKNSTDGIEKALNDIQEEHEWV----------TDEM--LVRSICEQNAGVNVNEYRH 966

Query: 1018 KYKPLAS--DEILKKLNTTTGHLSKMTNVNKRASENYTRFEDKRGE-LTSRAEELDESKQ 1074
            + + L    DE+ +K+N    ++ +                +K+GE L +    +++ K+
Sbjct: 967  RMEQLQKNFDELRRKVNPNIMNMIESV--------------EKKGEALKTMIRTIEKDKK 1012

Query: 1075 SIENLIDQLKEQKITAIEKTFNKVADNFSRVFATLVPRGIGKLIINHRKNTDNSEVSTKK 1134
             IE+ I +L E K   + KT+ KV  +F  +F  L+P    KL+    K+          
Sbjct: 1013 KIEDTISKLNEYKKETLVKTWKKVTKDFGNIFCDLLPNSSAKLVPCEGKDITE------- 1065

Query: 1135 RRRGARQEQNSAEALNESKYTGVSIQVSFNSKKDEQLRVEQLSGGQKTVCAIALILAIQM 1194
                                 G+ ++V   +   E L   +LSGGQ+++ A++LI+A+  
Sbjct: 1066 ---------------------GLEVKVKLGNLWKESLV--ELSGGQRSLIALSLIMALLQ 1102

Query: 1195 VDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFICTTFRTDMINVADTFFRVKFEN 1254
              PAP Y+ DE+DAALD  +   +   IK     +QFI  + +  M   A+  FR +F++
Sbjct: 1103 FRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVSLKEGMFTNANRVFRTRFQD 1162

Query: 1255 KVSTVT 1260
              S V+
Sbjct: 1163 GTSVVS 1168

>AGL023W [4288] [Homologous to ScYFL008W (SMC1) - SH]
            complement(670883..674551) [3669 bp, 1222 aa]
          Length = 1222

 Score =  116 bits (291), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 271/1294 (20%), Positives = 531/1294 (41%), Gaps = 188/1294 (14%)

Query: 65   ISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKREDRKGFIYQ 124
            +  FK+YK    V     +   +VG NGSGKSN   AI FVL   +S+L+       IY+
Sbjct: 9    VKNFKSYKGVHNVGFGGKNFISIVGPNGSGKSNMMDAISFVLGIRSSHLRSSALVDLIYR 68

Query: 125  GAGQVMSAFVEIIFDDPENLMLAPL---RNDTGEVR---IRRTVGLKKDE-YMINDKNST 177
            G  +   +  E   ++P++  +      ++ +G  R     R +    D  Y ++ K   
Sbjct: 69   GRMEEGGSAHE---NNPKSAYVTAFYVKQDASGAERRMEFTRVIHNTGDSTYKLDGKTVG 125

Query: 178  RQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAKDLERLHLLEDVVGAKSFEN---KLKE 234
             ++   VLE           +V QG +  + +   ++   L E V G+  ++    +LK+
Sbjct: 126  YKEYVDVLEGERILVKARNFLVFQGDVEQIASQSGVDLTKLFEQVSGSVQYQREYERLKD 185

Query: 235  SLKKMEAAERDRTKITNELNELDKRXXXXXXXXXXXXXXXXXXRDRKVLQFCLYD----- 289
              +K  A   +  K   ++ ++D +                  R +   QF L+      
Sbjct: 186  DYEKASAEYNESLKARRKM-QIDLKSFKEGVQKEEQYISLLAERVKLQQQFMLWQLFHLQ 244

Query: 290  -------RELNDITNQIEQLEGEYN---SIIENSSEYVNELEKREVLAVELNKRMNSLES 339
                     L D   ++ QL+ + +   +I+  S   V    K E+L   L +R  +L  
Sbjct: 245  SKRSGLVASLKDSKAKLSQLKRQLSNEEAILGKSKSLV---AKEELL---LARRRETL-- 296

Query: 340  EIKIKQSTDLPQLKASKLEVAGELADLDTRLNDIQMQLDASQAHLESNVKEIGEVKKQIE 399
               +++  D  +L A  L V         R+ +I+ ++D+ Q  +E     + ++K Q++
Sbjct: 297  ---LQKQQDKARLNAQLLPVGSARQGTTRRMVNIEKRIDSLQRDIERQESYVKQLKNQLK 353

Query: 400  INCSSIAEVQPKFQKLSNEAEILKVEIEKLTKRQREL-LSKKGKY--EDFRTVNERNDWI 456
            +   + A  + + +K ++    L  E +K  +  +E+ LS  G    E    +  + + +
Sbjct: 354  VVGKTKASFEAELEKSASGKFTLSEEQKKEYEELKEVYLSSGGSEFEEKLAILQNKKEEL 413

Query: 457  QEQINLLNQSLNKSNILKDQLTSQLSTLQHDLENLNAEIEDLADSVNGMGSVAQQEDLQN 516
             E+I +  + +  S       T     L+ D+E L  E+ +   ++N   ++  ++  + 
Sbjct: 414  SEEIAVFEKRIGISK------TRAEHDLKVDIERLEVEVSERTGNLNDKNAIHSEKVREW 467

Query: 517  KVTQAKKEYLTKIDQRKQLWRTEQRLQTISTSLDNDVKRFESDMNETIDRSLALGLQNVN 576
            K  Q++ E         + +    +L+ +   LD D+   + + N+  +R L        
Sbjct: 468  KQIQSEIE-----SANNKEYELSYKLREVLAKLD-DLSANQRETNK--ERKLR------E 513

Query: 577  DIVNRLNLHEHVFGPVGELIKVS-DKYKICAEVVGGNSLFNVVVDNEETASLLIKELFAT 635
            ++     L   V G V +L +   +KY +    + G +  +V+VD+   A   I  L   
Sbjct: 514  NVATLRRLFPGVRGLVHDLCRPKKEKYAVGVSTILGKNFDSVIVDSLSVAQQCISYLKKH 573

Query: 636  KGGRVTFIPLNKLHVDTNFTYPNNLEKNQCTPLIKKIKYDVKFEKVIKQVFGRTLVVKSL 695
            + G  +FIPL+ +   +  T P   +   C   +  I+Y+   EK ++ V   +++  SL
Sbjct: 574  RSGVASFIPLDTIDTSSP-TLPAG-DNTGCILTLDAIEYESSLEKAMQYVCSDSIICDSL 631

Query: 696  IDGASLAKEYKLN------AITLDGDRADSKGVLSGGYLDQYKSNRLDTLRDFKQSKREY 749
                 +A+  K N       +TL+G      G+++GG + +  +NR D        K EY
Sbjct: 632  ----DIARNLKWNRNVKSKLVTLEGALIHRAGLMTGG-ITKNNTNRWD--------KEEY 678

Query: 750  K-------KIQVELQEIKQALQ---------------------SIEQEIDGLNNVVKDAA 781
            +       KI  EL E+   ++                     S+  +++ LN  +K+A 
Sbjct: 679  QSLLLLKDKISTELSELTTGIRTGSIKSRDYENEVSLLSTEISSLRSQLNQLNRSMKEAL 738

Query: 782  AERDAYEAGIEKARSQLKAKLSQKITIDDSIKALKARLNKIDTELEQCRERTNAFAADIS 841
             E + ++  IEK  S               + +L   + ++D ++    +      A + 
Sbjct: 739  TELNYHDDLIEKEYSP-------------KVDSLHKMVEEVDGQMADIAKDKANLQASVY 785

Query: 842  KPFVNELDAD--------------EKAELLAISNSIQTKETSLNFNLSTLNELSSKLDEL 887
            K F  ++  D                 EL  +   +   E  L F    L     +  + 
Sbjct: 786  KDFSKKIGFDIGEYEQHTGGRLRKHSRELQQLQKEVMNIENKLEFETERLESTIKRQQKA 845

Query: 888  NAELNSKLLPKLHELERKPSSSHSLQISQINNQME---LVLMEKQTVTRTKEQ----VES 940
              +L  K+  +L  L  + +   S  + Q+ NQ+     VL E Q   + K      +E 
Sbjct: 846  REDLK-KVQGELDSLTSQETDIQS-NLEQVTNQIAEETKVLEEAQEKLKKKGNNIKIIED 903

Query: 941  ELSVLDSSIKSLRGEKATLQKDLDKANSQQRSLVK--RITNFQKNAEKVLLKKSTLNSRK 998
             ++ L  SI++ + E    ++D++K   ++ +++K  ++TN +   +   L+   +    
Sbjct: 904  TINDLHDSIQTCKREITEWKEDIEKVGIERVNILKNCKMTNIELPLDSSALEDLAIERID 963

Query: 999  EELQQLIREVGLLAEESLKKYKPLASDEI-------LKKLNTTTGHLSKMTNVNKRASEN 1051
             E  +    + +       +YK  +S  I       +K ++ T   L      N +A E 
Sbjct: 964  AETIEAGNNISVDYSRLSARYKESSSHHIRDEFESSIKAIDNTLTELQP----NSKAVER 1019

Query: 1052 YTRFEDKRGELTSRAEELDESKQSIENLIDQLKEQKITAIEKTFNKVADNFSRVFATLVP 1111
            +    D+   ++  +++L ES++  + L  ++KE++I      FN V DN  R++  L  
Sbjct: 1020 FDEARDQFNAVSGESDKLKESERKAKELYLKIKEKRINTFLACFNHVRDNIDRIYRELT- 1078

Query: 1112 RGIGKLIINHRKNTDNSEVSTKKRRRGARQEQNSAEALNESKYTGVSIQVSFNSKKDEQL 1171
            R  G               ST +   G+     + E  +E    G+    +   K+ + +
Sbjct: 1079 RNPG---------------STAELAGGS--ASLTLEDEDEPYLGGIRYHATPPMKRFKDM 1121

Query: 1172 RVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALD--KQYRIAVARTIKNLSDTA 1229
              + LSGG+KT+ A+AL+ AI    P+PF++ DE+DAALD     RIA A   ++ S   
Sbjct: 1122 --DYLSGGEKTMAALALLFAINSYQPSPFFILDEVDAALDVTNVERIA-AYIRRHASPKM 1178

Query: 1230 QFICTTFRTDMINVADTF---FRVKFENKVSTVT 1260
            QFI  + ++++ + +++    FR + EN    +T
Sbjct: 1179 QFIVISLKSNLFSKSESMAGVFRNQHENSSMVIT 1212

>Kwal_55.20421
          Length = 1170

 Score =  113 bits (283), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 178/702 (25%), Positives = 302/702 (43%), Gaps = 122/702 (17%)

Query: 603  KICAEVVGGNSLFNVVVDNEETASLLIKELFATKGGRVTFIPLNK-----LHVDTNFTYP 657
            +ICA    G  LFNVVV+NE TAS L++     K  RVT IPLNK     LH DT   + 
Sbjct: 545  QICA----GGRLFNVVVNNESTASQLLERGRLRK--RVTIIPLNKISARRLHQDT-VNFA 597

Query: 658  NNLEKNQCTPLIKKIKYDVKFEKVIKQVFGRTLVVKSLIDGASLAKEYKLNA--ITLDGD 715
              L  +     +  I Y+ +  K ++ +FG +L+ +       +    K+ A  ITL GD
Sbjct: 598  KQLAPDSVELALNLIGYEDEVAKAMEFIFGTSLICRDAETAKKVTFHPKVRARSITLQGD 657

Query: 716  RADSKGVLSGGYLDQYKSNRLDTLRDFKQSKREYKKIQVELQEIKQALQSIEQEIDGLNN 775
              D +G LSGG     ++N    L D ++    Y      L E +  L  + + I   + 
Sbjct: 658  IYDPEGTLSGGS----RNNNSSILIDIQK----YNAYSRNLSESEAKLADVTKRIKQYSE 709

Query: 776  VVKDAAAERDAYEAGIEKARSQLKAKLSQKITIDDSIKALKARLNKIDTELEQCRERTNA 835
            V++     ++       K        L+++   ++    L +R  +I  E++ C E   +
Sbjct: 710  VLQKTKNLQNELNLATHKFH------LAERNLANNPSVQLMSRNKEIQDEIQMCLESMRS 763

Query: 836  FAADISKPFVNELDADEKAELLAISNSIQTKETSLNFNLSTLNELSSKLDELNAELNSKL 895
             + DI K          +AE+ ++   +      L F+     +  SKLDEL  E+ S +
Sbjct: 764  GSEDIKKL---------EAEVASVEKDM------LEFS----KDKGSKLDELKREI-SHI 803

Query: 896  LPKLHE----LERKPSSSHSLQIS--QINNQMELVLME-KQTVTRTKE------QVESEL 942
               + E    LE K  S+ SLQ+   Q+N+ +     E K++V   KE       VE +L
Sbjct: 804  RKDIEEKKIVLEMKDDSNQSLQLEMEQLNSDILAARDEFKESVEAAKELEQKKHSVEQKL 863

Query: 943  SVLDSSIKSLRGEKATLQKDLDKANSQQRSLVK--RITNFQKNAEKVLLKKSTLNSRK-- 998
                + ++  + E +  +K L + + + + L    R  + Q  +++V L + +  +RK  
Sbjct: 864  EETANQLQDTKTEFSEQKKKLHEIDDEIKVLTDLLRTKSDQLRSDEVELARLSNETRKLK 923

Query: 999  -------EELQQLIREVGLLAEESL-------------KKYKPLASDEILKKLNTTTGHL 1038
                   E++  L+++   L +E L             + Y+  A      +LN     L
Sbjct: 924  TNTSSVEEQITALLKDEDWLQDEGLVSSIVTQNQGINLEAYRQRAD-----QLNEKFSAL 978

Query: 1039 SKMTNVNKRASENYTRFEDKRGELTSRAEELDESKQSIENLIDQLKEQKITAIEKTFNKV 1098
             +  N N  +       E K   L +    +++ K+ I+  + +L E K   + KT+ KV
Sbjct: 979  RRKVNPNIMSM--IESVEKKESALKTMISTIEKDKRKIQETVAKLNEYKRETLIKTWEKV 1036

Query: 1099 ADNFSRVFATLVPRGIGKLIINHRKNTDNSEVSTKKRRRGARQEQNSAEALNESKYTGVS 1158
              +F  +F  L+P    KL+    K                            S   G+ 
Sbjct: 1037 TVDFGNIFGDLLPNSFAKLVPIEGK----------------------------SVTEGLE 1068

Query: 1159 IQVSFNSKKDEQLRVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAV 1218
            +++   S   E L   +LSGGQ+++ A++LILA+    PAP Y+ DE+DAALD  +   +
Sbjct: 1069 VKIRLGSIWKESLV--ELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNI 1126

Query: 1219 ARTIKNLSDTAQFICTTFRTDMINVADTFFRVKFENKVSTVT 1260
               IK     +QFI  + +  M   A+  FR +F++  S V+
Sbjct: 1127 GHLIKTRFKGSQFIVVSLKEGMFTNANRVFRTRFQDGTSVVS 1168

 Score = 99.4 bits (246), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 67/205 (32%), Positives = 108/205 (52%), Gaps = 16/205 (7%)

Query: 58  VHIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLS-EENSNLKRE 116
           + ++ +II GFK+Y  RTV+ N+ P  N + G NGSGKSN   AI FVL     S ++  
Sbjct: 1   MKVEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRAS 60

Query: 117 DRKGFIYQ-GAGQVMSAFVEIIF--DDPENLMLAPLRNDT-GEVRIRRTVGL-KKDEYMI 171
           + +  IY+ G   V  A V I+F   D  N   +P+  ++  ++ + R + L    +Y+I
Sbjct: 61  NLQDLIYKRGQAGVTKASVTIVFANSDKNN---SPIGFESYPKISVTRQIVLGGTSKYLI 117

Query: 172 NDKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAKDLERLHLLEDVVGAKSFENK 231
           N   + +Q V  + ++V  + +NP  ++ QG+I  + N K  E L L+E+  G K FE+ 
Sbjct: 118 NGHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTEILSLIEEAAGTKMFED- 176

Query: 232 LKESLKKMEAAERDRTKITNELNEL 256
                 + E AER   K   +L E+
Sbjct: 177 ------RREKAERTMNKKETKLQEI 195

>YFR031C (SMC2) [1711] chr6 complement(216582..220094) Subunit of
           condensin protein complex required for chromosome
           condensation and segregation, coiled-coil protein of the
           SMC family [3513 bp, 1170 aa]
          Length = 1170

 Score =  103 bits (257), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 64/203 (31%), Positives = 110/203 (54%), Gaps = 7/203 (3%)

Query: 58  VHIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLS-EENSNLKRE 116
           + ++ +II GFK+Y  RTV+ ++ P  N + G NGSGKSN   AI FVL     S ++  
Sbjct: 1   MKVEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRAS 60

Query: 117 DRKGFIYQ-GAGQVMSAFVEIIFDDPENLMLAPLRNDTGEVRIRRTVGL-KKDEYMINDK 174
             +  IY+ G   V  A V I+FD+ +         ++ ++ + R V L    +Y+IN  
Sbjct: 61  SLQDLIYKRGQAGVTKASVTIVFDNTDKSNSPIGFTNSPQISVTRQVVLGGTSKYLINGH 120

Query: 175 NSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAKDLERLHLLEDVVGAKSFENKLKE 234
            + +Q V ++ ++V  + +NP  ++ QG+I  + N K  E L L+E+  G K FE++ ++
Sbjct: 121 RAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSEILSLIEEAAGTKMFEDRREK 180

Query: 235 SLKKMEAAE----RDRTKITNEL 253
           + + M   E     +RT +T E+
Sbjct: 181 AERTMSKKETKLQENRTLLTEEI 203

 Score = 90.1 bits (222), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 57/205 (27%), Positives = 95/205 (46%), Gaps = 30/205 (14%)

Query: 1056 EDKRGELTSRAEELDESKQSIENLIDQLKEQKITAIEKTFNKVADNFSRVFATLVPRGIG 1115
            E K   L +  + +++ K  I+  I +L E K   + KT+ KV  +F  +FA L+P    
Sbjct: 994  EKKEAALKTMIKTIEKDKMKIQETISKLNEYKRETLVKTWEKVTLDFGNIFADLLPNSFA 1053

Query: 1116 KLIINHRKNTDNSEVSTKKRRRGARQEQNSAEALNESKYTGVSIQVSFNSKKDEQLRVEQ 1175
            KL+    K+                               G+ ++V   +   E L   +
Sbjct: 1054 KLVPCEGKDVTQ----------------------------GLEVKVKLGNIWKESLI--E 1083

Query: 1176 LSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFICTT 1235
            LSGGQ+++ A++LI+A+    PAP Y+ DE+DAALD  +   +   IK     +QFI  +
Sbjct: 1084 LSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVS 1143

Query: 1236 FRTDMINVADTFFRVKFENKVSTVT 1260
             +  M   A+  FR +F++  S V+
Sbjct: 1144 LKEGMFANANRVFRTRFQDGTSVVS 1168

>YFL008W (SMC1) [1674] chr6 (119424..123101) Coiled-coil protein of
            the SMC family involved in chromosome condensation and
            segregation [3678 bp, 1225 aa]
          Length = 1225

 Score =  100 bits (248), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 206/908 (22%), Positives = 393/908 (43%), Gaps = 148/908 (16%)

Query: 408  VQPKFQKLSNEAEILKVEIEKLTKRQRELLSKKGKYEDFRTVNERNDWIQEQINLLNQSL 467
            ++ K   L+N+   ++ E+E+  KR    +SK+   E+     E+ D    Q+N L  SL
Sbjct: 403  LEEKIAVLNNDKREIQEELERFNKRAD--ISKRRITEELSITGEKLDT---QLNDLRVSL 457

Query: 468  NKSNILKDQLTSQLSTLQHDLENLNAEIEDLADSVNGMGSVAQQEDLQNKVTQAKKEYLT 527
            N+ N L  +   +L  LQ D+E+ N                 Q+ DL  K+    +E L 
Sbjct: 458  NEKNALHTERLHELKKLQSDIESANN----------------QEYDLNFKL----RETLV 497

Query: 528  KIDQRKQLWRTEQRLQTISTSLDNDVKRFESDMNETIDRSLALGLQNVNDIVNRLNLHEH 587
            KID      R   + + +  ++   +KRF   +          GL  V+D+ +       
Sbjct: 498  KIDDLSANQRETMKERKLRENIAM-LKRFFPGVK---------GL--VHDLCH------- 538

Query: 588  VFGPVGELIKVSDKYKICAEVVGGNSLFNVVVDNEETASLLIKELFATKGGRVTFIPLNK 647
               P  E      KY +    + G +  +V+V+N   A   I  L   + G  +FIPL+ 
Sbjct: 539  ---PKKE------KYGLAVSTILGKNFDSVIVENLTVAQECIAFLKKQRAGTASFIPLDT 589

Query: 648  LHVD-TNFTYPNNLEKNQCTPLIKKIKYDVKFEKVIKQVFGRTLVVKSLIDGASLAKEYK 706
            +  +    + P++         I  I Y+ ++EK ++ V G +++  +L    ++AK+ K
Sbjct: 590  IETELPTLSLPDS---QDYILSINAIDYEPEYEKAMQYVCGDSIICNTL----NIAKDLK 642

Query: 707  LNA------ITLDGDRADSKGVLSGGYLDQYKSNRLDTLRDFKQSKREYK-------KIQ 753
                     +T++G      G+++GG +    +NR D        K EY+       K+ 
Sbjct: 643  WKKGIRGKLVTIEGALIHKAGLMTGG-ISGDANNRWD--------KEEYQSLMSLKDKLL 693

Query: 754  VELQEIKQALQS-------IEQEIDGLNNVVKDAAAERDAYEAGIEKARSQLKAK--LSQ 804
            +++ E+    +S       +E  +  LN+ + +   +    +  +++ R ++K    L +
Sbjct: 694  IQIDELSNGQRSNSIRAREVENSVSLLNSDIANLRTQVTQQKRSLDENRLEIKYHNDLIE 753

Query: 805  KITIDDSIKALKARLNKIDTELEQCRERTNAFAADISKPFVN--------------ELDA 850
            K  I   I  LK +L+ ++   +   +   A   +I K F +              EL  
Sbjct: 754  K-EIQPKITELKKKLDDLENTKDNLVKEKEALQNNIFKEFTSKIGFTIKEYENHSGELMR 812

Query: 851  DEKAELLAISNSIQTKETSLNFNLSTLNELSSKLDELNAELNSKLLPKLHELERKPSSSH 910
             +  EL  +   I T E  L F    L+    + ++   +L +  + ++  LE +  +  
Sbjct: 813  QQSKELQQLQKQILTVENKLQFETDRLSTTQRRYEKAQKDLENAQV-EMKSLEEQEYAIE 871

Query: 911  SLQISQINNQME-----LVLMEKQTVTRTKEQVESE--LSVLDSSIKSLRGEKATLQKDL 963
             ++I  I +++E     L  ++K+ VT+  E   SE  L  ++S+++ L+ E+  +++D+
Sbjct: 872  -MKIGSIESKLEEHKNHLDELQKKFVTKQSELNSSEDILEDMNSNLQVLKRERDGIKEDI 930

Query: 964  DKANSQQRSLVK--RITNFQ-KNAEKVLLKKSTLNSRKEELQQLIREVGLLAEESLKKYK 1020
            +K + ++ + +K  +I+N     + +  +    ++S   E   +   + +  +   KKYK
Sbjct: 931  EKFDLERVTALKNCKISNINIPISSETTIDDLPISSTDNEAITISNSIDINYKGLPKKYK 990

Query: 1021 PLASDEILKKLNTTTGHLSKMTN---VNKRASENYTRFEDKRGELTSRAEELDESKQSIE 1077
               +D   K+L      + ++ N    N RA E Y   E +   + +  E+L   ++ I 
Sbjct: 991  ENNTDSARKELEQKIHEVEEILNELQPNARALERYDEAEGRFEVINNETEQLKAEEKKIL 1050

Query: 1078 NLIDQLKEQKITAIEKTFNKVADNFSRVFATLVPRGIGKLIINHRKNTDNSEVSTKKRRR 1137
            N   ++K+++    EKTF+ V+D+   ++  L             KN  NS V       
Sbjct: 1051 NQFLKIKKKRKELFEKTFDYVSDHLDAIYRELT------------KNP-NSNVEL----- 1092

Query: 1138 GARQEQNSAEALNESKYTGVSIQVSFNSKKDEQLRVEQLSGGQKTVCAIALILAIQMVDP 1197
                   + E  +E    G+    +   K+ + +  E LSGG+KTV A+AL+ AI    P
Sbjct: 1093 AGGNASLTIEDEDEPFNAGIKYHATPPLKRFKDM--EYLSGGEKTVAALALLFAINSYQP 1150

Query: 1198 APFYLFDEIDAALD--KQYRIAVARTIKNLSDTAQFICTTFRTDMINVADTF---FRVKF 1252
            +PF++ DE+DAALD     RIA A   ++ +   QFI  + +  M   +D     +R + 
Sbjct: 1151 SPFFVLDEVDAALDITNVQRIA-AYIRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQ 1209

Query: 1253 ENKVSTVT 1260
            EN    +T
Sbjct: 1210 ENSSKIIT 1217

>AGR236W [4547] [Homologous to ScYFR031C (SMC2) - SH]
           complement(1189851..1193363) [3513 bp, 1170 aa]
          Length = 1170

 Score = 97.8 bits (242), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 106/192 (55%), Gaps = 9/192 (4%)

Query: 58  VHIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLS-EENSNLKRE 116
           + ++ +II GFK+Y  RTV+  + P  N + G NGSGKSN   +I FVL     + ++ +
Sbjct: 1   MKVEELIIDGFKSYATRTVISGWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQ 60

Query: 117 DRKGFIYQ-GAGQVMSAFVEIIFD--DPENLMLAPLRNDT-GEVRIRRTVGL-KKDEYMI 171
           + +  IY+ G   V+ A V I+FD  DP +   +P   +T  ++ + R + L    +Y+I
Sbjct: 61  NLQDLIYKRGQAGVIKASVTIVFDNSDPSS---SPFGFETYPKISVTRQIILGGTSKYLI 117

Query: 172 NDKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAKDLERLHLLEDVVGAKSFENK 231
           N   + +  V  + ++V  + +NP  ++ QG+I  + N K  E L L+E+  G + FE++
Sbjct: 118 NGHRAQQLTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPDEILALIEEAAGTRMFEDR 177

Query: 232 LKESLKKMEAAE 243
            +++ K M   E
Sbjct: 178 REKAEKTMAKKE 189

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 95/205 (46%), Gaps = 30/205 (14%)

Query: 1056 EDKRGELTSRAEELDESKQSIENLIDQLKEQKITAIEKTFNKVADNFSRVFATLVPRGIG 1115
            E K   L +  + +++ K  I   I++L E K  A+ KT+ KV  +F  +FA L+P    
Sbjct: 994  EKKEAALRTMIKTIEKDKMKIVETIEKLNEYKRDALVKTWEKVNVDFGNIFAELLPNSFA 1053

Query: 1116 KLIINHRKNTDNSEVSTKKRRRGARQEQNSAEALNESKYTGVSIQVSFNSKKDEQLRVEQ 1175
            KL     K+                               G+ ++V   +   E L   +
Sbjct: 1054 KLAAIEGKDVT----------------------------AGLEVKVKLGTLWKESLV--E 1083

Query: 1176 LSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFICTT 1235
            LSGGQ+++ A++LILA+    PAP Y+ DE+DAALD  +   +   IK     +QFI  +
Sbjct: 1084 LSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVS 1143

Query: 1236 FRTDMINVADTFFRVKFENKVSTVT 1260
             +  M   A+  F+ +F++  S V+
Sbjct: 1144 LKEGMFTNANRVFKTRFQDGTSVVS 1168

>AGR089C [4399] [Homologous to ScYLR086W (SMC4) - SH] (901443..905555)
            [4113 bp, 1370 aa]
          Length = 1370

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 228/1008 (22%), Positives = 418/1008 (41%), Gaps = 181/1008 (17%)

Query: 55   VEMVHIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLK 114
            VE + I+T+++  FK+Y  R VV  F    + VVG NGSGKSN   ++ F      + ++
Sbjct: 103  VERLCIRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMR 162

Query: 115  REDRKGFIYQGAGQVMSAF--VEIIF----DDPENLMLAPLRNDTGEVRI---RRTVGLK 165
            +      I++        F  VEI F    D+P+       R  +G+  +   R+     
Sbjct: 163  QGKLSHLIHKSEKYPDLDFCSVEIQFQYVVDEPD----GTTRVLSGKPELSVMRKAFKNN 218

Query: 166  KDEYMINDKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAK-------DLERLHL 218
              +Y +N K ST  +V R+L + G    +   ++ QG + S+   K       D   L  
Sbjct: 219  TSKYYLNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEY 278

Query: 219  LEDVVGAKSFENKLKESLKKMEAAERDRTKITNELNELDKRXXXXXXXXXXXXXXXXXXR 278
            LED++G   ++ +++++L ++++      +  N  + ++K                   +
Sbjct: 279  LEDIIGTTKYKAQIEQALVEVDSLNDICMEKENRFDLVEKEKLSLEPGKDEALAFLKKEK 338

Query: 279  DRKVL-----QFCLYD------RELNDITNQIEQLEGEYNSIIENSSEYVNELEKREVLA 327
            D  +L     Q+ L+       + L++++N + +LE E    +E   E V   +  E LA
Sbjct: 339  DLTLLMSKKYQYHLFHNGSKLAKTLSNVSNTMNKLEQEKAKKVEAQKEIVELTDASEQLA 398

Query: 328  ---VELN-------KRMNSLESEI---KIKQSTDLPQLKASKLEVAGELADLDTRLNDIQ 374
               V +N        +M  LE E+   + KQ + L   K SK E           LN ++
Sbjct: 399  NRLVSMNNTNKESLAKMRQLERELVSNEEKQKSLLQ--KRSKAEKT---------LNTVE 447

Query: 375  MQLDASQAHLESNVKEIGEVKKQIEINCSSIAEVQPKFQKL-----------SNEAEILK 423
              +   +  +E  + +  E +  +     +I + Q + +K+           + E  +L+
Sbjct: 448  KSIKQCENKIEEYISQNQEYETSLTTLNHTIVDAQAELEKMKLALSDKTGDITKEVAVLE 507

Query: 424  VEIEKLTKRQRELLSKKGKYE-DFRTVNERNDWIQEQINLLNQSLNKSNILKDQLTSQLS 482
             E+E  T +  E  S+    E +   + E +  ++ +I  L+Q +       +QL   +S
Sbjct: 508  KELEPWTNKVEEKKSEIKLVESEISIIKEADLKLESEIANLSQEI-------EQLRGNIS 560

Query: 483  TLQHDLENLNAEIEDLADSVNGMGSVAQQEDLQNKVTQAKKEYLTKIDQRKQLWRTE-QR 541
              +  +E LN E   + D +     V ++E      T A+    +K+++ K++  T  QR
Sbjct: 561  HREESIETLNVESSSIRDYI----LVGERE-----CTSAR----SKLEEMKKVLVTHRQR 607

Query: 542  LQTISTSLDNDVKRFESDMNETIDRSLALGLQNVNDIVNRLNLHEH------VFGPVGEL 595
            +        ND             RS     +N N ++  L+  +         G +G+L
Sbjct: 608  V--------NDA------------RSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDL 647

Query: 596  IKVSDKYKICAEVVGGNSLFNVVVDNEETASLLIKELFATKGGRVTFIPLNKL---HVDT 652
              + DKY I A       L ++VVD  E     I+ L   K G   FI L+KL   ++  
Sbjct: 648  GTIDDKYDI-AISTACPRLDDIVVDTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQP 706

Query: 653  NFTYPNNLEKNQCTPLIKKIKYDVKFEKVIKQVFGRTLVVKSLIDGASLA---KEYKLNA 709
              T P N+ +     L+K    + KF      V   TLV   L     +A   K Y++  
Sbjct: 707  AHT-PENVPR--LFDLVK--PKEPKFAPAFYSVLRDTLVTTDLSQANRVAYGKKRYRV-- 759

Query: 710  ITLDGDRADSKGVLSGGYLDQYKSNRL-DTLRDFKQSKREYKKIQVELQE----IKQALQ 764
            +TLDG   D  G ++GG  D+  S  +  T +    +  E ++++ EL E     K A +
Sbjct: 760  VTLDGKLIDISGTMTGGG-DRAASGLMKSTQQSSLYTPEEVQRMEEELNEREKNFKVAFE 818

Query: 765  SIEQEIDGLNNVV---KDAAAERDAYEAGIEKARSQLKAKLSQKITIDDSIKALKARLNK 821
            + ++    L N +    +   E    +  IE   ++L++K+ +K+ ++        R NK
Sbjct: 819  TFQEMESALQNYLDRQPEIEVELSKQKMDIETISAELESKIERKLELE--------RSNK 870

Query: 822  I----DTELEQCRERTNAFAADISKPFV------NELDADEKAELLAISNSIQTKETSLN 871
                  +EL    E+  A  AD++  F+      N+   + +A+++ I            
Sbjct: 871  TSIEDSSELRTAEEKLAALNADLNS-FMSASESKNQRIKELRAKIMEIG----------G 919

Query: 872  FNLSTLNELSSKLDELNAEL--------NSKLLPKLHELERKPSSSHSL----QISQINN 919
              L TLN   SK+D LN ++          K   K  ELE K +    +     I   + 
Sbjct: 920  LELQTLN---SKVDSLNQQIKIVAAKQKKDKTAQKKAELELKRARKQQITAKDDIEHCDI 976

Query: 920  QMELVLMEKQTVTRTKEQVESELSVLDSSIKSLRGEKATLQKDLDKAN 967
            +++ +     T++   ++++ +LS L   I +L  E A  + +LD+ N
Sbjct: 977  EIQKMKSSYDTISTGMQELQKQLSDLQEEIGTLTDEHAVTKHELDQKN 1024

 Score = 67.8 bits (164), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 44/72 (61%)

Query: 1173 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFI 1232
            +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +    VA  IK  +  AQFI
Sbjct: 1272 ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1331

Query: 1233 CTTFRTDMINVA 1244
              + R +M  +A
Sbjct: 1332 VISLRNNMFELA 1343

>Scas_681.4
          Length = 1409

 Score = 87.4 bits (215), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 195/838 (23%), Positives = 343/838 (40%), Gaps = 148/838 (17%)

Query: 56  EMVHIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKR 115
           E + I  + ++ FK+Y  + VV  F    + VVG NGSGKSN   ++ FV     + +++
Sbjct: 147 ERLFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 206

Query: 116 EDRKGFIYQGA--GQVMSAFVEIIFDDPENLMLAPLRNDTGEVRI----------RRTVG 163
           +     I++      + S  V++ F       L  +    G+ +I          R+   
Sbjct: 207 DRLSDLIHKSEKFPDLTSCSVDVEF-------LYAIDEHDGDTKISETKPKLVISRKAFK 259

Query: 164 LKKDEYMINDKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAK-------DLERL 216
               +Y IN K S   DV ++L+  G    +   ++ QG + ++   K       D   L
Sbjct: 260 NNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLL 319

Query: 217 HLLEDVVGAKSFENKLKESLKKMEAAERDRTKITNELNELDKRXXXXXXXXXXXXXXXXX 276
             LED++G   ++  +++ L ++E+      +  N    +D+                  
Sbjct: 320 EYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKNLALEFLEK 379

Query: 277 XRD-----RKVLQFCLY--DRELNDITNQIEQLEGEYNSIIENSSEYVNELEKREVLAVE 329
            +       K+LQ+ L+  + +L +   +I  L  EYN  +E S        K + L  E
Sbjct: 380 EKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEYN--VEKS--------KNQTLQNE 429

Query: 330 LNKR---MNSLESEIKIKQSTDLPQLKASKLEVAGELADLDTRLNDIQMQLDASQAHLES 386
           +N+    +N  +S+IK+ +  +  QLK+ ++ + GE   LD +L +    L   +A  E 
Sbjct: 430 INRTKQLLNESQSKIKVLEGEEKQQLKSKRI-LEGEHVSLDEKLKN----LTQKKAKTE- 483

Query: 387 NVKEIGEVKKQIEINCSSIAEVQPKFQKLSNEAEILKVEIEKLTKRQRELLSKKGKYEDF 446
             K I   +K I    S I E++   ++ S+E E L           ++L S++   E  
Sbjct: 484 --KIIATTEKTISSLTSEIQELEKSQKEYSDELETL----------NQQLQSERESLEAM 531

Query: 447 R-TVNERNDWIQEQINLLNQSLNKSNI-LKDQLT------SQLSTLQHDLENLNAEIEDL 498
           +  + E+   I E+I +    L   NI ++++ T      SQ+S LQ     L  +I+ L
Sbjct: 532 KLKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVL 591

Query: 499 ADSVNGMGS--VAQQEDLQNKVTQAKKEYLTKIDQRKQLWRTEQRLQTISTSLDNDVKRF 556
           +  V+   +  + ++EDL N         L K  Q+  + +     +T      + +K  
Sbjct: 592 SQEVSNQTALKIKREEDLVN---------LKK--QQSSITKEISNGETECNDGRSKLKEM 640

Query: 557 ESDMNETIDRS----LALG-LQNVNDIVNRL----------NLHEHVFGPVGELIKVSDK 601
           ++ +N    R+    LAL  +QN   ++  L            H    G +G+L  + + 
Sbjct: 641 KNVLNMQRQRASEARLALANVQNRGKVLTALYKLQKSGRIVGFH----GRLGDLGTIDNT 696

Query: 602 YKICAEVVGGNSLFNVVVDNEETASLLIKELFATKGGRVTFIPLNKLH-VDTN-FTYPNN 659
           Y +         L ++VV+  E     I+ L   K G   FI L+KL   +TN    P N
Sbjct: 697 YDVAVSTACPR-LDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKN 755

Query: 660 LEKNQCTPLIKKIKYDVKFEKVIKQVFGRTLVVKSLIDGASLA-KEYKLNAITLDGDRAD 718
           + +     LIK    D KF      V   TLV K L     +A  + +   +TLDG   D
Sbjct: 756 VPR--LFDLIK--PKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLID 811

Query: 719 SKGVLSGG-----------------YLDQYKSNRLDTL--------RDFKQSKREYKKIQ 753
             G +SGG                 Y D Y    ++ +        ++F+ +   + +++
Sbjct: 812 VSGTMSGGGNHVSKGLMMLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEME 871

Query: 754 VELQEIKQALQSIEQEIDGLNNVVKDAAAERDAYEAGIEKARSQLKAKLSQKITIDDS 811
            ELQ++      IE EI  +         E D Y A I+    QL+    +K  ID+S
Sbjct: 872 NELQKLNNRKPEIELEISKI-------IMEIDTYSAEIKSKERQLQ----EKTNIDNS 918

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 1/89 (1%)

Query: 1173 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFI 1232
            +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +    VA  IK  +  AQFI
Sbjct: 1307 ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1366

Query: 1233 CTTFRTDMINVADTFFRV-KFENKVSTVT 1260
              + R +M  +A     + K EN+  + T
Sbjct: 1367 VISLRNNMFELAQQLVGIYKCENRTHSAT 1395

>Kwal_56.23825
          Length = 1396

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 175/760 (23%), Positives = 313/760 (41%), Gaps = 132/760 (17%)

Query: 34  PVSESSRNKSNYKGKKTDYNTVEMVHIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGS 93
           P+ +S      ++  +    +++ + I  +++  FK+Y    VV  F    + VVG NGS
Sbjct: 103 PMKKSRLESQKFQESRAMMGSIQRLCIDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGS 162

Query: 94  GKSNFFAAIRFVLSEENSNLKREDRKGFIYQG--AGQVMSAFVEIIF----DDPENLMLA 147
           GKSN   ++ FV     + +++      I++      + S  V+I F    D+P+     
Sbjct: 163 GKSNVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSI 222

Query: 148 PLRNDTGEVRIRRTVGLKKDEYMINDKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISL 207
             +  +  +R R+       +Y +N K S+   + ++L + G    +   ++ QG + S+
Sbjct: 223 IQQKPSMVIR-RKAFRNNTSKYYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESI 281

Query: 208 TNAK-------DLERLHLLEDVVGAKSF----ENKLKESLK----------KMEAAERDR 246
              K       D   L  LED++G   +    EN L E  K          + E  ER++
Sbjct: 282 AQMKPKAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAKLNDICEEKENRFEIVEREK 341

Query: 247 TKITNELNE----LDKRXXXXXXXXXXXXXXXXXXRDRKVLQFCLYDRE--LNDITNQIE 300
           + +    NE    L+K                      K+LQ+ L+  E  LN    +I 
Sbjct: 342 SSLEQGKNEALEYLEKEKTLTILRS-------------KLLQYHLWKNEQKLNSTKEKIA 388

Query: 301 QLEGEYNSIIENSSEYVNELEKREVLAVELNKRMNSLESEIKIKQSTDLPQLKASKLEVA 360
           + +                    E L+ E  KR    E    +K   DL  LK     + 
Sbjct: 389 KAQ--------------------EKLSAEKAKRTKHSEEMAAMK--ADLQSLKL----IL 422

Query: 361 GELADLDTRLNDIQMQLDASQAHLESNVKEIG--EVK--KQIEINCSSIAEVQPKFQKLS 416
           G+L + + +L   +   D  +  LE  +K +   EVK  + ++   SSI+  Q K ++L+
Sbjct: 423 GDLGESEKKLTLEKRACDRDRVSLEEKLKNLTQKEVKSSRSLQSITSSISTTQAKMEELA 482

Query: 417 NEAEILKVEIEKLTKRQRELLSKKGKYEDFR-TVNERNDWIQEQINLLNQSLNKSNILKD 475
           N+ E  + ++ +L    +E   +K K ++ + ++ ++   I EQI  + + L   N+   
Sbjct: 483 NDQEQHEKDLLELNGTMKE---EKEKLDEIKSSLKDKISLISEQIREIEKELEPWNVKLQ 539

Query: 476 QLTSQL--------------STLQHDLENLNAEIEDLADSVNGM-GSV----AQQEDLQN 516
           +  +Q+              + ++ D+  +N  I++L + +N   GSV     +Q D+  
Sbjct: 540 EKKAQVKLEETTISVFKESHAKIEQDIILVNKGIDELRNKMNEQRGSVFSLEKEQVDIGR 599

Query: 517 KVTQAKKEY---LTKIDQRKQLWRTEQRLQTISTSLDNDVKRFESDMNETIDRSLALGLQ 573
           ++T  + E    + KI + K +  T  R ++I     + +  FE   N+    +  L LQ
Sbjct: 600 QLTVGQSECDNAVKKIKEMKGIL-TAHRQRSIDAR--SSLSTFE---NKNKVLAALLRLQ 653

Query: 574 NVNDIVNRLNLHEHVFGPVGELIKVSDKYKICAEVVGGNSLFNVVVDNEETASLLIKELF 633
               I           G +G+L  + DKY + A       L ++VV+  E     I+ L 
Sbjct: 654 RSGRISG-------FHGRLGDLGTIDDKYDV-AISTACPRLDDIVVETVECGQQCIEYLR 705

Query: 634 ATKGGRVTFIPLNKLHVDTNFTYPNNLEKNQCTPLIKKIKYDV------KFEKVIKQVFG 687
             K G   FI L+KL    NF    NL   +    + ++ YD+      KF      V  
Sbjct: 706 KNKLGYARFILLDKLR---NF----NLSPIKTPENVPRL-YDLVRPNNPKFRNAFYSVLR 757

Query: 688 RTLVVKSLIDGASLA-KEYKLNAITLDGDRADSKGVLSGG 726
            TLV K L +   +A  + +   +TLDG   D  G +SGG
Sbjct: 758 DTLVAKDLKEANKVAYGKQRYRVVTLDGKLIDLSGTMSGG 797

>KLLA0D16005g complement(1346492..1350004) similar to sp|P38989
            Saccharomyces cerevisiae YFR031c SMC2 chromosome
            segregation protein, start by similarity
          Length = 1170

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 59/205 (28%), Positives = 98/205 (47%), Gaps = 30/205 (14%)

Query: 1056 EDKRGELTSRAEELDESKQSIENLIDQLKEQKITAIEKTFNKVADNFSRVFATLVPRGIG 1115
            E K   L +  + +++ KQ I+  I++L E K   + KT+ KV+ +F  +F  L+P    
Sbjct: 994  EKKETALKTMIKTIEKDKQKIQETIEKLNEYKRETLIKTWEKVSVDFGNIFGDLLPNSFA 1053

Query: 1116 KLIINHRKNTDNSEVSTKKRRRGARQEQNSAEALNESKYTGVSIQVSFNSKKDEQLRVEQ 1175
            KL                        E +  + + E    G+ ++V       E L   +
Sbjct: 1054 KL------------------------EPSEGKDVTE----GLEVKVKLGKIWKESLV--E 1083

Query: 1176 LSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFICTT 1235
            LSGGQ+++ A++LILA+    PAP Y+ DE+DAALD  +   +   IK     +QFI  +
Sbjct: 1084 LSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVS 1143

Query: 1236 FRTDMINVADTFFRVKFENKVSTVT 1260
             +  M   A+  FR +F++  S V+
Sbjct: 1144 LKEGMFTNANRVFRTRFQDGTSVVS 1168

>KLLA0F19085g 1758111..1762229 similar to sgd|S0004081 Saccharomyces
           cerevisiae YLR086w SMC4 Stable Maintenance of
           Chromosomes, start by similarity
          Length = 1372

 Score = 71.2 bits (173), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 174/716 (24%), Positives = 295/716 (41%), Gaps = 100/716 (13%)

Query: 54  TVEMVHIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNL 113
           T + + I  ++++ FK+Y     +  F    + VVG NGSGKSN   ++ FV     + +
Sbjct: 119 TSQRLCIDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM 178

Query: 114 KREDRKGFIYQGA--GQVMSAFVEIIFDDPENLMLAPLRNDTGEVRI----------RRT 161
           ++      I++      + S  V+I F    +        D GE +I          RR 
Sbjct: 179 RQGKLSELIHKSEQFPSLASCSVQIHFHYVHD-------TDNGETKILPSAGTMVVERRA 231

Query: 162 VGLKKDEYMINDKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAK-------DLE 214
                 +Y +N K S   +V R+L+  G    +   ++ QG + S+   K       D  
Sbjct: 232 FKNNSSKYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDG 291

Query: 215 RLHLLEDVVGAKSFENKLKESLKKMEAAERDRTKITNELNELDKRXXXXXXXXXXXXXXX 274
            L  LED++G   F+ ++++ L+++E       +  N    +DK                
Sbjct: 292 LLEYLEDIIGTAKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFL 351

Query: 275 XXXRDRKV-----LQFCLYD--RELNDITNQIEQLEGEYNSIIENSSEYVNELEKREVLA 327
              R   +     LQ  +YD  R+L    ++I  L  E+    E  S+Y +  ++ E L 
Sbjct: 352 DKERKHTILKAQLLQRQIYDSNRKLATSCDKISALNMEFQ---EEKSQYEHLQKEAETLT 408

Query: 328 VELN---KRMNSLESEIKIKQSTDLPQLKASKLEVAGELADLDTRLNDIQMQLDASQ--- 381
            E+N   K   +LE+E K         + + K  +  +    D +L  I  +L A++   
Sbjct: 409 HEINNTKKESTALETESK--------NVNSKKRSLEKDFIATDEKLKSIARKLKAAEKAF 460

Query: 382 AHLESN----VKEIGEVKKQIEINCSSIAEVQPKFQKLSNEAEIL---KVEIEKLTKR-Q 433
           +  ESN    V EI  +KK  + +C    E+      +S E E L   K+ + + TK   
Sbjct: 461 SQSESNGKAAVNEIESLKKNHD-DCE--IELHNLNHSISIEKEKLNEIKIHLHEKTKDLS 517

Query: 434 RELLSKKGKYEDFRTVNERNDWIQEQINLLNQSLNKSNILKDQLTSQLSTLQHDLENLNA 493
           +E+ S + + E FR      D IQE+ + +  S  K  +LK    S  S L  +   + +
Sbjct: 518 QEMESLERQLEPFR------DQIQEKQSEIKLSETKITMLK----SSHSNLLKEKATIES 567

Query: 494 EIEDLADSVNGMGSVAQQEDLQNKVTQAK-KEYLTKIDQRKQLWRTEQRLQTISTSLDND 552
           +IEDL           Q E+L+ K T+   +   +K++ R    + E       T+   D
Sbjct: 568 KIEDL-----------QLEELKQKETETSLRNEKSKVEARISTAQKECEEAQKQTNEMRD 616

Query: 553 VKRFESDMNETIDRSLALGLQNVNDIVNRLNLHEH------VFGPVGELIKVSDKYKICA 606
           V   +  + E    +L  G QN N ++  L   ++        G +G+L  + D+Y I A
Sbjct: 617 VLIQQRQIVEEAKANLN-GFQNKNRVLLALTKLQNSGRITGFHGRLGDLGTIDDQYDI-A 674

Query: 607 EVVGGNSLFNVVVDNEETASLLIKELFATKGGRVTFIPLNKL---HVDTNFTYPNNLEKN 663
                  L ++VV+  E     I  L   K G   FI L+KL   ++D     P N+ + 
Sbjct: 675 ISTACPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLD-RIATPENVPR- 732

Query: 664 QCTPLIKKIKYDVKFEKVIKQVFGRTLVVKSLIDGASLA-KEYKLNAITLDGDRAD 718
               LI  ++ D+ F      V   TLV + L     +A  + +   +TLDG   D
Sbjct: 733 -LFDLITPVR-DL-FRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVVTLDGKLID 785

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 33/88 (37%), Positives = 49/88 (55%)

Query: 1173 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFI 1232
            +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +    VA  IK  +  AQFI
Sbjct: 1274 ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1333

Query: 1233 CTTFRTDMINVADTFFRVKFENKVSTVT 1260
              + R +M  +A     +   N ++  T
Sbjct: 1334 VISLRNNMFELAQNLVGIYKNNNMTKST 1361

>YLR086W (SMC4) [3501] chr12 (302244..306500) Subunit of condensin
            protein complex required for proper chromosome
            condensation and segregation, coiled-coil protein of the
            SMC family [4257 bp, 1418 aa]
          Length = 1418

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 1/89 (1%)

Query: 1173 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFI 1232
            +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +    VA  IK  +  AQFI
Sbjct: 1320 ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1379

Query: 1233 CTTFRTDMINVADTFFRV-KFENKVSTVT 1260
              + R +M  +A     V K +N+  + T
Sbjct: 1380 VISLRNNMFELAQQLVGVYKRDNRTKSTT 1408

 Score = 61.6 bits (148), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 91/195 (46%), Gaps = 12/195 (6%)

Query: 58  VHIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKRED 117
           + I  +++  FK+Y  + VV  F    + VVG NGSGKSN   ++ FV     + ++++ 
Sbjct: 154 LFINELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213

Query: 118 RKGFIYQGAG--QVMSAFVEIIFDDPENLMLAPLRND---TGEVRIRRTVGLKKDEYMIN 172
               I++      + S  V + F    +      R D    G +  R+       +Y IN
Sbjct: 214 LSDLIHKSEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYIN 273

Query: 173 DKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAK-------DLERLHLLEDVVGA 225
           +K S+  +V ++L+N G    +   ++ QG + ++   K       D   L  LED++G 
Sbjct: 274 EKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT 333

Query: 226 KSFENKLKESLKKME 240
            +++  ++E + ++E
Sbjct: 334 ANYKPLIEERMGQIE 348

>CAGL0L12188g 1308672..1312868 similar to tr|Q12267 Saccharomyces
            cerevisiae YLR086w Stable Maintenance of Chromosomes,
            start by similarity
          Length = 1398

 Score = 67.0 bits (162), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 42/69 (60%)

Query: 1173 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFI 1232
            +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +    VA  IK  +  AQFI
Sbjct: 1300 ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1359

Query: 1233 CTTFRTDMI 1241
              + R +M 
Sbjct: 1360 VISLRNNMF 1368

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 55/214 (25%), Positives = 95/214 (44%), Gaps = 31/214 (14%)

Query: 45  YKGKKTDYNTVEMVHIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRF 104
           Y+ KK D    E + I  ++++ FK+Y  R V+  F    + +VG NGSGKSN   ++ F
Sbjct: 116 YESKKLDVKK-ERLFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLF 174

Query: 105 VLSEENSNLKREDRKGFIYQGA--GQVMSAFVEIIFDDPENLMLAPLRNDTGEVRIRRTV 162
           V     + ++++     I++      + S  VE+ F          +  D G   I  T 
Sbjct: 175 VFGFRANKMRQDRLSDLIHKSETFPDLKSCSVEVHFK-------YVIDKDDGSTTIDETK 227

Query: 163 G--------LKKD--EYMINDKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAK- 211
           G         K +  +Y +N K S   +V  +L+  G    +   ++ QG + ++   K 
Sbjct: 228 GNLVVTRKAFKNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKA 287

Query: 212 ------DLERLHLLEDVVGAKSFENKLKESLKKM 239
                 D   L  LED++G     +K KES++K+
Sbjct: 288 KAEKENDDGLLEYLEDIIGT----SKYKESIEKL 317

>Scas_707.23
          Length = 1223

 Score = 63.9 bits (154), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 51/92 (55%), Gaps = 4/92 (4%)

Query: 1173 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDT-AQF 1231
            +E LSGG+KTV A+AL+ AI    P+PF++ DE+DAALD      +A  I+   +   QF
Sbjct: 1124 MEYLSGGEKTVAALALLFAINAYQPSPFFVLDEVDAALDITNVERIAAYIRRHGNPDLQF 1183

Query: 1232 ICTTFRTDMINVADTF---FRVKFENKVSTVT 1260
            I  + +  M   +D     +R + EN    VT
Sbjct: 1184 IVISLKNTMFEKSDALVGVYRQQQENSSKIVT 1215

 Score = 60.5 bits (145), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 99/214 (46%), Gaps = 23/214 (10%)

Query: 57  MVHIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKRE 116
           M  +  + +S FK+Y+  T +     +   ++G NGSGKSN   AI FVL   +S+L+  
Sbjct: 1   MGRLTGLELSNFKSYRGVTKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSN 60

Query: 117 DRKGFIYQGAGQVMSAFVEIIFDDPEN---------LMLAPLRNDTGEVRIRRTVGLKKD 167
             K  IY+G   V+  F E   +DPE+          + A    D   V + RT+ +  D
Sbjct: 61  ILKDLIYRG---VIRDFSE---EDPEDGEEQHPTSAYVKAFYEMDGKVVELMRTININGD 114

Query: 168 -EYMINDKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAKDLERLHLLEDVVGAK 226
             Y I++K  + +     LE           +V QG +  + +   L+   L E++ G+ 
Sbjct: 115 TTYKIDNKTVSYKQYAAFLEKENILIKAKNFLVFQGDVEQIASQSALDLSKLFEEISGSI 174

Query: 227 SFE---NKLKESLKKMEAAE----RDRTKITNEL 253
            ++   + LK+ L+K+  +     R+R +I  EL
Sbjct: 175 QYKKEYDSLKDELEKLGKSTTESIRNRRRIHGEL 208

>KLLA0D07502g complement(642751..646482) similar to sp|P32908
            Saccharomyces cerevisiae YFL008w SMC1 chromosome
            segregation protein, start by similarity
          Length = 1243

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 43/70 (61%), Gaps = 1/70 (1%)

Query: 1173 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIK-NLSDTAQF 1231
            +E LSGG+KT+ A+AL+  I    P+PF++ DE+DAALD      +A  IK N +  AQF
Sbjct: 1143 MEYLSGGEKTMAALALLFTINSYQPSPFFVLDEVDAALDITNVERIAHYIKRNANPNAQF 1202

Query: 1232 ICTTFRTDMI 1241
            I  + +  M 
Sbjct: 1203 IVISLKNAMF 1212

>AEL337C [2168] [Homologous to ScYOL034W - SH] (14613..17906) [3294
           bp, 1097 aa]
          Length = 1097

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 78/167 (46%), Gaps = 16/167 (9%)

Query: 48  KKTDYNTVEMVH-----IKTVIISGFKTYKNRTVVE-NFSPHHNVVVGSNGSGKSNFFAA 101
           K+   NTV+  H     I ++ ++ F TY   ++ E + SP  N+++G NGSGKS F  A
Sbjct: 29  KRLRRNTVQYAHFQEGAIVSIRLTNFVTY---SLAEFHMSPSLNMIIGPNGSGKSTFVCA 85

Query: 102 IRFVLSEENSNLKREDR-KGFIYQGAGQVMSAFVEIIFDDPENLMLAPLRNDTGEVRIRR 160
           I   L+ +   + R  R + FI  G  +   + +EI   +  N+   P+ +   E    R
Sbjct: 86  ICLGLAGKPEYIGRAKRVEDFIKNGTAE---STIEIQLRNSRNVSGLPMISAEDEAINVR 142

Query: 161 TVGLK---KDEYMINDKNSTRQDVRRVLENVGFSTSNPYNIVPQGRI 204
           TV +K   K  Y IN +  +   +R ++  +     N    + Q R+
Sbjct: 143 TVLMKARRKCAYYINGEPVSENQMRALVSMLNIQLDNLCQFLSQERV 189

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1177 SGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQY-RIAVARTIKNLS--DTAQFIC 1233
            SGG++ V  +  ++A+Q    APF + DEI+  +D +Y RI     ++N    +T+Q+  
Sbjct: 992  SGGERAVSTVLYMIALQHFTNAPFRVVDEINQGMDTRYERIVHKAMVENACAENTSQYFL 1051

Query: 1234 TT 1235
             T
Sbjct: 1052 IT 1053

>Scas_643.11
          Length = 1095

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 109/241 (45%), Gaps = 22/241 (9%)

Query: 31  FTRPVSESSRNKSNYKGKKTDYNTVEMVHIKTVIISGFKTYKNRTVVENFSPHHNVVVGS 90
            +R  S S       K     Y+  +   I  + +  F TY  R    N SP  N+++G 
Sbjct: 9   LSRFASSSGPQTKKLKLAPRTYDQFQPGSIVKIKLQNFVTY--RLTEFNLSPSLNMIIGP 66

Query: 91  NGSGKSNFFAAIRFVLSEENSNLKREDR-KGFIYQGAGQVMSAFVEII---FDDPENLM- 145
           NGSGKS F  A+   L+ +   + R  R   FI  G     ++ +EI    ++DP  L  
Sbjct: 67  NGSGKSTFVCAVCLGLAGKPEFIGRAKRVDDFIKNGED---TSRIEIFLKNYEDPTELQS 123

Query: 146 -LAPLRNDTGEVRIRRTVGLKKD------EYMINDKNSTRQDVRRVLENVGFSTSNPYNI 198
            L    N  G+  ++ T  +++D      +Y INDK  T   ++ +++ +     N    
Sbjct: 124 SLNLKFNLAGKDLLKVTRLIQRDGNKCKSDYFINDKPVTENVIKNLVKFLNIQLDNLCQF 183

Query: 199 VPQGRIISLTNAKDLERLHLLEDVVGAKSFENKLKESLKKMEAAERDRTKITNELNELDK 258
           + Q R+      K  ++L L+E V   +S + +L + L  +++++ D T + NE++   K
Sbjct: 184 LSQERVEEFARLKS-DKL-LVETV---RSIDAQLLQILDDLKSSQNDETTLENEVDIKQK 238

Query: 259 R 259
           R
Sbjct: 239 R 239

 Score = 38.1 bits (87), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 54/260 (20%), Positives = 100/260 (38%), Gaps = 62/260 (23%)

Query: 999  EELQQLIREVGLLAEESLKKYKPLASD-------------EILKKL-------NTTTGHL 1038
            EE QQ IR++    + + +K    A               EI+ KL       N     +
Sbjct: 831  EEYQQWIRQIRSYDDSTREKLNDYAEGYEKDGTFNVTHITEIIDKLESEISMINHDASSI 890

Query: 1039 SKMTNVNKRASENYTRFEDKRGELTSRAEELDESKQSIENLIDQLKEQKITAIEKTFNKV 1098
            + +  V K  S+       ++ EL S  E++ + + ++E  +D++ E           K+
Sbjct: 891  TILKQVEKEISQLEETLPKQQVELKSIKEKIKQGRSTLEPKLDEIIE-----------KI 939

Query: 1099 ADNFSRVFATLVPRGIGKLIINHRKNTDNSEVSTKKRRRGARQEQNSAEALNESKYTGVS 1158
            +  FSR+F  +   G   L+  H+ +    E+  K R     +  +S             
Sbjct: 940  STRFSRLFKNVGSAGAVNLVKPHQFSEWKIEIMVKFRDNATLKRLDSHTQ---------- 989

Query: 1159 IQVSFNSKKDEQLRVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALD-KQYRIA 1217
                              SGG++ V  +  ++A+Q    APF + DEI+  +D +  RI 
Sbjct: 990  ------------------SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDARNERIV 1031

Query: 1218 VARTIKNLS--DTAQFICTT 1235
                ++N    +T+Q+   T
Sbjct: 1032 HKAMVENACAENTSQYFLIT 1051

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 112/241 (46%), Gaps = 35/241 (14%)

Query: 348 DLPQLKASKLEVAGELADLDTRLNDIQMQLDA---SQAHLESNVKEIGEVKKQIEINCSS 404
           D+ +LK+   E   +L +L     + + QL +       +     E+ EV+KQ  +  S+
Sbjct: 665 DVRKLKSQVEERKAKLENLSNERGEFKHQLSSIARENERISQKGHELNEVRKQYSMVKST 724

Query: 405 IAEVQPKFQKLSNEAEILKVEIEKLTKRQRELLSKKGKYEDFRTVNERNDWIQEQINLLN 464
           I  ++ KFQ+L+N+A              R+ +S+K K  +     E    ++ Q +LL 
Sbjct: 725 IESLESKFQELNNDA--------------RKDVSQKIKAVEASISKE----LKIQTDLLK 766

Query: 465 QSLNKSNILKDQLTSQLSTLQHDLENLNAEIEDLADSVNG-MGSVAQQEDLQNKVTQAKK 523
           Q +    ++ +  + Q    + DLE L A+  D+  S+N  +G    +ED      + KK
Sbjct: 767 QMV---GLMGNVNSCQKELFKADLEYLEAKNNDV--SMNDVIGFFNDRED------ELKK 815

Query: 524 EYLTKIDQRKQLWRTEQRLQTIST--SLDNDVKRFESDMNETIDRSLALGLQNVNDIVNR 581
           E+ TK +  ++L  TE+  Q I    S D+  +   +D  E  ++     + ++ +I+++
Sbjct: 816 EFETKRETVRRLRDTEEYQQWIRQIRSYDDSTREKLNDYAEGYEKDGTFNVTHITEIIDK 875

Query: 582 L 582
           L
Sbjct: 876 L 876

>Kwal_23.5043
          Length = 1225

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 85/199 (42%), Gaps = 26/199 (13%)

Query: 65  ISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKREDRKGFIYQ 124
           ++ FK+YK +  +     +   ++G NGSGKSN   AI FVL  ++ +L+       IY+
Sbjct: 9   LNNFKSYKGKVSIGFRDSNFTSIIGPNGSGKSNLMDAISFVLGVKSVHLRSHLLADLIYR 68

Query: 125 GA--------------GQVMSAFVEIIFDDPENLMLAPLRNDTGEVRIRRTVGLKKDE-Y 169
           G                   SA+V+  +        +P  N+   V + RTV   ++  Y
Sbjct: 69  GTLSEEEASSADFESENHPNSAYVKAFY--------SPSNNEDDVVELSRTVTRSQESTY 120

Query: 170 MINDKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAKDLERLHLLEDVVGAKSFE 229
            I+ K    +   + LE+          +V QG +  +   K  E   L E V G+  ++
Sbjct: 121 RIDGKTVGYKKYSQFLESENILIKARNFLVFQGDVEQVAAQKPQELTDLFEQVSGSLQYK 180

Query: 230 ---NKLKESLKKMEAAERD 245
              ++++E L++  +   D
Sbjct: 181 QDYDRIREELERARSETSD 199

>CAGL0F01155g complement(116762..120079) similar to tr|Q08204
           Saccharomyces cerevisiae YOL034w, hypothetical start
          Length = 1105

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 81/192 (42%), Gaps = 27/192 (14%)

Query: 35  VSESSRNKSNYKGKKTDYNTVEMVHIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSG 94
           V + + ++   K K  DY+  +   I  + +  F TY N T   N SP  N+++G NGSG
Sbjct: 13  VDDLTPSRKRLKIKPVDYDVFKPGSIVKIRLENFVTY-NYTEF-NLSPSLNMIIGPNGSG 70

Query: 95  KSNFFAAIRFVLSEENSNLKREDR-KGFIYQGAGQVMSAFVEIIFDDPENL--------- 144
           KS +  A+   L+ +   + R  + + FI  G     ++ +EI+  D  N+         
Sbjct: 71  KSTYVCAVCLGLAGKPEYIGRSKQVEDFIKNGQD---TSKIEIVLKDDPNIDIEFLGSSF 127

Query: 145 -----------MLAPLRNDTGEVRIRRTVGLKK-DEYMINDKNSTRQDVRRVLENVGFST 192
                      +L   RN     +I R +  ++  EY IN   +T  +VR ++       
Sbjct: 128 HRIRNNGNYKGLLTITRNLEKRTKIGRNLEKRRTQEYSINGLPTTESNVRNLVSKFHIQL 187

Query: 193 SNPYNIVPQGRI 204
            N    + Q R+
Sbjct: 188 DNLCQFLSQERV 199

 Score = 38.5 bits (88), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 1177 SGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQY-RIAVARTIKNLSD--TAQFIC 1233
            SGG++ V  +  ++A+Q    APF + DEI+  +D  + R+     ++N  +  T+Q+  
Sbjct: 1000 SGGERAVSTVLYMIALQKFTQAPFRVVDEINQGMDTNFERLVHKAMVQNACEEGTSQYFL 1059

Query: 1234 TT 1235
             T
Sbjct: 1060 IT 1061

>KLLA0F07997g complement(748561..751920) similar to sgd|S0005394
           Saccharomyces cerevisiae YOL034w, start by similarity
          Length = 1119

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 85/180 (47%), Gaps = 15/180 (8%)

Query: 34  PVSESSRNKSN--YKGKKTDYNTVEMVHIKTVIISGFKTYKNRTVVE-NFSPHHNVVVGS 90
           P + +S+N S    + + ++ N  +   +  + ++ F TY    + E + SP  N+++G 
Sbjct: 32  PCTNNSKNLSTKRLRIQHSELNEFQPGAVVKLKLTNFVTY---ALTEFHLSPSLNMIIGP 88

Query: 91  NGSGKSNFFAAIRFVLSEENSNLKREDR-KGFIYQGAGQVMSAFVEIIFDDPENLMLAP- 148
           NGSGKS F  AI   L+ +   + R  + + +I  G  +     +EI   +   L+ +  
Sbjct: 89  NGSGKSTFVCAICLGLAGKPEYIGRSKKVEEYIKNGTDE---GVIEITLKNSSALLHSDF 145

Query: 149 --LRNDTGEVRIRRTVGL--KKDEYMINDKNSTRQDVRRVLENVGFSTSNPYNIVPQGRI 204
             +  D   V ++R + +  KK +Y IN+K  T + V+ ++  +     N    + Q R+
Sbjct: 146 NMINTDDDVVHVKRVLSMEKKKSKYYINNKVVTEEVVKSMVRVLNIQLDNLCQFLSQERV 205

 Score = 38.1 bits (87), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 76/183 (41%), Gaps = 48/183 (26%)

Query: 1059 RGELTSRAEELDESKQSIENLIDQLKEQKITAIEKTFNKVADNFSRVFATLVPRGIGKLI 1118
            R +L S A+ + E + S+E  +D + +Q           ++  FS +FA +   G     
Sbjct: 935  RAKLASNAQTILEIRNSLEPRLDDIVKQ-----------ISKKFSHLFAYVGSAG----- 978

Query: 1119 INHRKNTDNSEVSTKKRRRGARQEQNSAEALNESKYTGVSIQVSFNSKKD-EQLRVEQLS 1177
                      +V  KK            ++ N+     + I+V F    + +QL     S
Sbjct: 979  ----------QVELKK-----------PDSFND---WCIEIKVKFRDNSELQQLNPHVQS 1014

Query: 1178 GGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQ-----YRIAVARTIKNLSDTAQFI 1232
            GG++ V  +  ++A+Q    +PF + DEI+  +D+      +RI V        +T+Q+ 
Sbjct: 1015 GGERAVSTVLYMIALQQFTSSPFRVVDEINQGMDQTNERIVHRIMVENACA--ENTSQYF 1072

Query: 1233 CTT 1235
              T
Sbjct: 1073 LIT 1075

>AER044W [2549] [Homologous to ScYLR383W (RHC18) - SH]
           complement(714355..717666) [3312 bp, 1103 aa]
          Length = 1103

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 72/172 (41%), Gaps = 22/172 (12%)

Query: 51  DYNTVEMVHIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEEN 110
           D+      ++K + +  F  +++  +   F P  N +VGSNGSGKS    AI  V   + 
Sbjct: 53  DWEGTPAGYMKRITLKNFMCHEHFEL--EFGPRLNFIVGSNGSGKSAILTAITVVFGAKA 110

Query: 111 SNLKRE-DRKGFIYQGAGQVMSAFVEIIFDDPENLMLAPLRNDT--GEVRIRRTVGLKKD 167
           S+  R    K  I +G G   +A + I+     N  L          E+ I RT  LK+D
Sbjct: 111 SDTNRGVSLKSLIREGCG---TARIAIVL---ANQGLGAFEQGVYGSEITIERT--LKRD 162

Query: 168 ----EYMINDKNS-----TRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNA 210
                + I  +N       ++D++R+++       NP   + Q    S   A
Sbjct: 163 GQSSHFSIKSENGREVSNKKRDLQRIVDYFSIPVLNPMCFLSQDAARSFLTA 214

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 32/69 (46%), Gaps = 1/69 (1%)

Query: 1155 TGVSIQVSFNSKKDEQLR-VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQ 1213
            T  ++ V   +  DE  R V+ LSGG+K+   I L+L+      A     DE D  +D+ 
Sbjct: 985  TPGALMVLVKTANDETPRNVDTLSGGEKSFSQITLLLSTWSTMRARIIALDEFDVFMDQV 1044

Query: 1214 YRIAVARTI 1222
             R    R I
Sbjct: 1045 NRTIGTRMI 1053

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 57/106 (53%), Gaps = 1/106 (0%)

Query: 728 LDQYKSNRLDTLRDFKQSKREYKKIQVELQEIKQALQSIEQEIDGLNNVVKDAAAERDAY 787
           +DQ  ++  D    F+++++E  + + + + +K+  + +E+EI  L   +K    +    
Sbjct: 346 VDQKMTSLQDHQIKFEEAEQELGQFREKHEVLKEERRKVEREIASLEVSLKAHRQQVKQL 405

Query: 788 EAGIEKARSQLKAKL-SQKITIDDSIKALKARLNKIDTELEQCRER 832
           E  + +A    K ++ ++K  +D+ IK LK  L  ++ + +QCR+R
Sbjct: 406 EQELAEALGGSKEQMVTEKRQVDEEIKTLKGNLPSLEDKFQQCRDR 451

>YOL034W (SMC5) [4782] chr15 (259923..263204) Protein containing an
           SMC domain N-terminal domain, which bind ATP in
           chromosome-associated proteins, has low similarity to S.
           pombe Spr18p, which is likely to be involved in the
           maintenance of chromosome structure [3282 bp, 1093 aa]
          Length = 1093

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 78/163 (47%), Gaps = 15/163 (9%)

Query: 49  KTDYNTVEMVHIKTVIISGFKTYKNRTVVE-NFSPHHNVVVGSNGSGKSNFFAAIRFVLS 107
           K D ++ +   I  + +  F TY   T+ E N SP  N+++G NGSGKS F  A+   L+
Sbjct: 31  KPDLSSFQPGSIIKIRLQDFVTY---TLTEFNLSPSLNMIIGPNGSGKSTFVCAVCLGLA 87

Query: 108 EENSNLKREDR-KGFIYQGAGQVMSAFVEIIFDDPENLM---LAPLRNDTGEVRIRRTV- 162
            +   + R  + + FI    GQ +S  +EI   +  N+        R++T  ++I R + 
Sbjct: 88  GKPEYIGRSKKVEDFIKN--GQDVSK-IEITLKNSPNVTDIEYIDARDET--IKITRIIT 142

Query: 163 -GLKKDEYMINDKNSTRQDVRRVLENVGFSTSNPYNIVPQGRI 204
              ++ +Y+IND   +   V+ ++  +     N    + Q R+
Sbjct: 143 RSKRRSDYLINDYQVSESVVKTLVAQLNIQLDNLCQFLSQERV 185

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 1177 SGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALD-KQYRIAVARTIKNLS--DTAQFIC 1233
            SGG++ V  +  ++A+Q    APF + DEI+  +D +  RI     ++N    +T+Q+  
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1234 TT 1235
             T
Sbjct: 1047 IT 1048

>Kwal_26.7204
          Length = 1117

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 59/133 (44%), Gaps = 16/133 (12%)

Query: 79  NFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKREDR-KGFIYQGAGQVMSAFVEII 137
           + SP  N+++G NGSGKS F  A+   L+ +   + R  R   FI  G  +     +E+ 
Sbjct: 86  HLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRGKRVDSFIKNGENR---GLIEV- 141

Query: 138 FDDPENLMLAPLRNDT-----GEVRIRRTVGL-KKDEYMINDKNSTRQDVRRVLENVGFS 191
                 L   P R  +     G  ++ R + + KK EY +ND+  +   V+ ++  +   
Sbjct: 142 -----TLKRDPGRTGSFVAVDGTTKVSRVLWVGKKSEYYLNDEPVSELTVKNLMGELNIQ 196

Query: 192 TSNPYNIVPQGRI 204
             N    + Q R+
Sbjct: 197 LDNLCQFLSQERV 209

 Score = 38.9 bits (89), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 1177 SGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALD-KQYRIAVARTIKNLS--DTAQFIC 1233
            SGG++ V  +  ++A+Q    APF + DEI+  +D +  RI     ++N     T+Q+I 
Sbjct: 1012 SGGERAVSTVLYMIALQEFTSAPFRIVDEINQGMDTRNERIVHKAMVENACAEKTSQYIL 1071

Query: 1234 TT 1235
             T
Sbjct: 1072 VT 1073

>CAGL0F02079g 201002..204673 similar to sp|P32908 Saccharomyces
           cerevisiae YFL008w SMC1 chromosome segregation protein,
           start by similarity
          Length = 1223

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 32/57 (56%)

Query: 68  FKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKREDRKGFIYQ 124
           FK+YK    V+    +   ++G NGSGKSN   AI FVL   +S+L+    K  IY+
Sbjct: 12  FKSYKGTVNVDFGDSNFTSIIGPNGSGKSNLMDAISFVLGIRSSSLRSSALKDLIYR 68

>KLLA0E05247g complement(472583..475879) similar to sp|Q12749
           Saccharomyces cerevisiae YLR383w RHC18 recombination
           repair protein, start by similarity
          Length = 1098

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 84/199 (42%), Gaps = 34/199 (17%)

Query: 60  IKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKR-EDR 118
           IK + ++ F  + N ++     P  N +VG+NGSGKS    AI   L  + +   R    
Sbjct: 64  IKEIKLTNFMCHSNFSL--RLGPRLNFIVGNNGSGKSAILTAITIGLGAKATTTNRGTSL 121

Query: 119 KGFIYQGAGQVMSAFVEIIFDDPENLMLAPLRNDTGEVRIRRTVGLKKDEYM-------- 170
           K  I QG     S  V ++ ++  N     +     E+RI RT+  +++ Y         
Sbjct: 122 KDLIKQGCN--TSKIVIVLCNEGLNSFEPGVYGK--EIRIERTI--RREGYSGSFSIRSE 175

Query: 171 ----INDKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAKDLER--LHLLEDVVG 224
               ++DK   ++D+  +L+      +NP   + Q    S   A   +   LH +   + 
Sbjct: 176 ANKEVSDK---KRDLEVILDYFSIPVTNPMCFLSQDAARSFLTASSPQEKYLHFMRGTL- 231

Query: 225 AKSFENKLKESLKKMEAAE 243
                  L+E+ + +E+AE
Sbjct: 232 -------LEETKQNLESAE 243

 Score = 38.1 bits (87), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 40/85 (47%), Gaps = 7/85 (8%)

Query: 1173 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYR-IAVARTIKNL-----S 1226
            V+ LSGG+K+   IAL+LA  +   +     DE D  +D+  R I     I+ L     S
Sbjct: 999  VDTLSGGEKSFSQIALLLATWLTMRSRIIALDEFDVFMDQVNRKIGTNLIIRRLGKDVKS 1058

Query: 1227 DTAQFICTTFRTD-MINVADTFFRV 1250
            DT   I T      M N+ D +F +
Sbjct: 1059 DTQTIIITPQDIGKMANIDDKYFNI 1083

>Scas_719.6
          Length = 1096

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 59  HIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKR 115
           +IK V +  F  ++N  +     P  N +VGSNGSGKS    AI   L  + S+  R
Sbjct: 63  YIKKVSLRNFMCHENFEL--ELGPKLNFIVGSNGSGKSAILTAITIALGAKASDTNR 117

 Score = 35.4 bits (80), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 42/82 (51%), Gaps = 5/82 (6%)

Query: 1168 DEQLR-VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDK-QYRIAVARTIKNL 1225
            DE+ R V+ LSGG+K+   +AL+LA      +     DE D  +D+   RI     +K L
Sbjct: 988  DEKPRNVDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKL 1047

Query: 1226 SDTA--QFICTTFRTDMINVAD 1245
             D A  Q I  T + D+  +AD
Sbjct: 1048 KDLARTQTIIITPQ-DIGKIAD 1068

>Scas_636.14
          Length = 608

 Score = 38.5 bits (88), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 1173 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNL 1225
            V+ LSGG+    AI L L I    PA  YL DE  A LD + RI  ++ I+  
Sbjct: 465  VQHLSGGELQRVAIVLALGI----PADIYLIDEPSAYLDSEQRIICSKVIRRF 513

>CAGL0H05071g 486899..490231 similar to sp|Q12749 Saccharomyces
           cerevisiae YLR383w RHC18, hypothetical start
          Length = 1110

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 63/160 (39%), Gaps = 13/160 (8%)

Query: 59  HIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKREDR 118
           +IK + +  F  ++N  V     P  N +VG NGSGKS    AI   L  + S   R   
Sbjct: 79  YIKKLTLHNFMCHRNFDV--ELGPGLNFIVGKNGSGKSAILTAITIGLGAKASETNRGSS 136

Query: 119 -KGFIYQGAGQVMSAFVEIIFDDPENLMLAPLRNDTGE-VRIRRTVGLKKDE-YMINDKN 175
            K  I  G     S+ + I   +       P     G+ + I RT+       + +  +N
Sbjct: 137 LKDLITAGCN---SSRITIYLSNSGIGAYVPKGKQYGDTIIIERTISRTSTAGFSLKSEN 193

Query: 176 ST-----RQDVRRVLENVGFSTSNPYNIVPQGRIISLTNA 210
            T     ++D++ +L+      SNP   + Q    S   A
Sbjct: 194 GTEISNKKRDLQEILDYFAIPISNPMCFLSQDSARSFLTA 233

>YDR091C (YDR091C) [943] chr4 complement(626702..628528) Putative
            ortholog of human Rnase L inhibitor (RLI) of the
            interferon-regulated 2-5A pathway, putative ortholog of
            C. elegans Y39E4B.1, member of the non-transporter group
            in the ATP-binding cassette (ABC) superfamily [1827 bp,
            608 aa]
          Length = 608

 Score = 38.1 bits (87), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 1173 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNL 1225
            V+ LSGG+    AI L L I    PA  YL DE  A LD + RI  ++ I+  
Sbjct: 465  VQHLSGGELQRVAIVLALGI----PADIYLIDEPSAYLDSEQRIICSKVIRRF 513

>CAGL0G08041g complement(758811..760634) highly similar to tr|Q03195
            Saccharomyces cerevisiae YDR091c, start by similarity
          Length = 607

 Score = 38.1 bits (87), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 38/82 (46%), Gaps = 13/82 (15%)

Query: 1173 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNL----SDT 1228
            V+ LSGG+    AI L L I    PA  YL DE  A LD + RI  ++ I+        T
Sbjct: 464  VKHLSGGELQRVAIVLSLGI----PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 519

Query: 1229 A-----QFICTTFRTDMINVAD 1245
            A      FI  T+  D + V D
Sbjct: 520  AFIVEHDFIMATYLADKVIVFD 541

>AGR125W [4436] [Homologous to ScYDR091C (RLI1) - SH]
            complement(987083..988906) [1824 bp, 607 aa]
          Length = 607

 Score = 37.4 bits (85), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 39/80 (48%), Gaps = 6/80 (7%)

Query: 1146 AEALNESKYTGVSIQVSFNSKKDEQLRVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDE 1205
            A+ LN    T V   +  +   D++  V+ LSGG+    AI L L +    PA  YL DE
Sbjct: 439  AQFLNPQFQTDVCKPLRIDDIIDQE--VQHLSGGELQRVAIVLALGL----PADIYLIDE 492

Query: 1206 IDAALDKQYRIAVARTIKNL 1225
              A LD + RI  ++ I+  
Sbjct: 493  PSAYLDSEQRIICSKVIRRF 512

>Kwal_56.23429
          Length = 539

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 1173 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNL 1225
            V+ LSGG+    AI L L +    PA  YL DE  A LD + RI  ++ I+  
Sbjct: 465  VQHLSGGELQRVAIVLALGL----PADIYLIDEPSAYLDSEQRIICSKVIRRF 513

>Kwal_26.9380
          Length = 1102

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 51/99 (51%), Gaps = 11/99 (11%)

Query: 758 EIKQALQSIEQEIDGLNNVVKDAAAERDAYEAGIEKARSQLKAKLSQ----KITIDDSIK 813
           E   +LQ+ E EI GL   +   +++ D Y A IEK ++ + A   +    +I+I D  K
Sbjct: 799 EASASLQASEMEISGLRESISSMSSKLDTYLADIEKHKTSITAYEHKTEELRISISDFEK 858

Query: 814 ALKARLNKIDTELEQCRERTNAFAADISKP---FVNELD 849
            +K +++  +     C  R +AFA D+ +     VNEL+
Sbjct: 859 GIKGQISNAEI---YC-PRESAFAPDMPQGKEDTVNELE 893

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 47/104 (45%), Gaps = 7/104 (6%)

Query: 60  IKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKREDR- 118
           IK V +  F  +++  +     P  N +VG+NGSGKS    AI   L  + ++  R    
Sbjct: 70  IKKVQLRNFMCHEHFEL--ELGPRLNFIVGNNGSGKSAVLTAITIGLGAKATDTNRGSSL 127

Query: 119 KGFIYQGAGQVMSAFVEIIFDDPENLMLAPLRNDTGEVRIRRTV 162
           K  I +G     S+ + I+ ++ E            E+RI RT+
Sbjct: 128 KDLIREG---CQSSKISIVLNN-EGFGGYDQGTYGSEIRIERTI 167

>Kwal_26.9480
          Length = 719

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 35/71 (49%), Gaps = 8/71 (11%)

Query: 1172 RVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIK----NLSD 1227
            R   +SGG+K   AIA +L    +  AP   FDE  +ALD     A+ RTIK      S 
Sbjct: 596  RGLMISGGEKQRLAIARVL----LKDAPIMFFDEATSALDTHTEQALLRTIKENFTTGSK 651

Query: 1228 TAQFICTTFRT 1238
            T+ +I    RT
Sbjct: 652  TSVYIAHRLRT 662

>YLR383W (RHC18) [3762] chr12 (885288..888632) Protein involved in
            recombination repair, homologous to S. pombe rad18 [3345
            bp, 1114 aa]
          Length = 1114

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 2/75 (2%)

Query: 1158 SIQVSFNSKKDEQLR-VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYR- 1215
            S+++   +  DE+ R V+ LSGG+K+   +AL+LA      +     DE D  +D+  R 
Sbjct: 1000 SLEIYILTTNDEKARNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRK 1059

Query: 1216 IAVARTIKNLSDTAQ 1230
            I     +K L D A+
Sbjct: 1060 IGTTLIVKKLKDIAR 1074

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 2/57 (3%)

Query: 59  HIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKR 115
           +IK VI+  F  +++  +        N +VG+NGSGKS    AI   L  + S   R
Sbjct: 81  YIKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNR 135

>Sklu_2249.2 YFR031C, Contig c2249 627-3873 reverse complement
          Length = 1083

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 1056 EDKRGELTSRAEELDESKQSIENLIDQLKEQKITAIEKTFNKVADNFSRVFATLVPRGIG 1115
            E K   L +  + +++ K  I+  I++L E K   + KT+ KV+ +F  +F  L+P    
Sbjct: 994  EKKETALKTMIKTIEKDKTKIQETIEKLNEYKRDTLLKTWEKVSVDFGNIFGDLLPNSFA 1053

Query: 1116 KLIINHRKN-TDNSEVSTK 1133
            KL+    K+ T+  EV  K
Sbjct: 1054 KLVPCEGKDVTEGLEVKVK 1072

>KLLA0A10131g complement(889688..891850) similar to sp|P40416
            Saccharomyces cerevisiae YMR301c ATM1 ATP-binding
            cassette transporter protein, mitochondrial, hypothetical
            start
          Length = 720

 Score = 34.7 bits (78), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 36/71 (50%), Gaps = 8/71 (11%)

Query: 1172 RVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIK-NLSDTAQ 1230
            R   +SGG+K   AIA +L    +   P   FDE  +ALD     ++ +TIK N SD A+
Sbjct: 589  RGLMISGGEKQRLAIARVL----LKDTPIMFFDEATSALDTHTEQSLLKTIKENFSDVAK 644

Query: 1231 ---FICTTFRT 1238
               +I    RT
Sbjct: 645  TSVYIAHRLRT 655

>KLLA0A00594g complement(53304..58550) gi|5531276|emb|CAB50890.1
            Kluyveromyces lactis MLP1 homologue, start by similarity
          Length = 1748

 Score = 34.3 bits (77), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 68/296 (22%), Positives = 127/296 (42%), Gaps = 75/296 (25%)

Query: 729  DQYKSNRLDTLRDFKQ-SKREYKKIQVELQEIKQALQSIEQEIDGLNNVVKDAAAERDAY 787
            +++KS   D L  +++    E+ K++ E+ ++K  LQ+ +   D L +V+    AE+D +
Sbjct: 1274 ERWKSRSQDILHKYERIDPEEHGKLKEEINDVKNELQTTK---DTLQSVI----AEKDDW 1326

Query: 788  EAGIEKARSQLKAKLSQKITIDDSIKALKARLNKIDTELEQCRERTNAFAADISKPFVNE 847
            E+  ++ R Q +          D + A K +   + +E+ Q  E  +   AD+ K     
Sbjct: 1327 ESKFQRIRLQAR----------DRLNASKEKEQSLSSEINQINEAKSQVEADLGKCKTAC 1376

Query: 848  LDADEKAELLAISNSIQTKETSLNFNLSTLNELSSKLDELNAELNSKLLPKLHELERKPS 907
             + +E+  L  ++   +TKE + N  LS L E                            
Sbjct: 1377 KELEER--LQVVTQEAETKEQTFNSQLSKLQE---------------------------- 1406

Query: 908  SSHSLQISQINNQMELVLMEKQTVTRTKEQVES---ELSVLDSSIKSLRGEKATLQKDLD 964
              HS+Q+     QME     +Q    + E+++S    + +L+S I+ L  E +  QK + 
Sbjct: 1407 DLHSIQV-----QMENASKTEQNNADSDEKIKSLTETVEMLNSKIQELEAEASNAQKIVA 1461

Query: 965  KA-----NSQQRSLVKRI-TNFQKNAEKVLL-------------KKSTLNSRKEEL 1001
            +      N   +S+V  + T F+   E+++              K+S  NSR+EEL
Sbjct: 1462 EHHTPVINEDTKSIVDNLKTEFEAEKEQLIKDKEKELRSKFEAEKESAWNSREEEL 1517

>KLLA0C17556g complement(1544404..1546227) highly similar to
            sgd|S0002498 Saccharomyces cerevisiae YDR091c RLI1, start
            by similarity
          Length = 607

 Score = 33.9 bits (76), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 37/82 (45%), Gaps = 13/82 (15%)

Query: 1173 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNL----SDT 1228
            V+ LSGG+    AI L L +     A  YL DE  A LD + RI  ++ I+        T
Sbjct: 464  VQHLSGGELQRVAIVLSLGMN----ADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 519

Query: 1229 A-----QFICTTFRTDMINVAD 1245
            A      FI  T+  D + V D
Sbjct: 520  AFIVEHDFIMATYLADKVIVFD 541

>Kwal_26.8903
          Length = 815

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 102/240 (42%), Gaps = 52/240 (21%)

Query: 767 EQEIDG-LNNVVKDAAAERDAY-EAGIEKARSQLKAKLSQKITIDDSIKALKARLNKIDT 824
           E E+DG    + +D+  +R+   EA ++K ++ L     Q + +    + ++A L+ +  
Sbjct: 156 EHELDGDSTELTRDSLWKRNQLVEATLQKLQAALDVSRQQNVNLSTQNEEMRAELDNMAK 215

Query: 825 ELEQCRERTNAFAADISKPFVNELDADEKAELLAISNSIQTKETSLNFNLSTLNELSSKL 884
           ELE C++    F +D+                                   T +++  KL
Sbjct: 216 ELENCKQIIEGFHSDV-----------------------------------TYDQIIDKL 240

Query: 885 DELNAELNSK---LLPKLHELERKPSSSHSLQISQINNQMELVLMEKQTVTRTKEQVESE 941
            E N  LNSK   L   + EL  +   +  LQ  QI N +E  L E+  + R + + + +
Sbjct: 241 TEENTALNSKVERLQATVDELRSERVVNKDLQ--QIYNDLEDELSEQLRILREEGRRDKQ 298

Query: 942 LSVLDSSIKSLRGEKATLQKDLD--KANSQQRSLVKRITNFQKNAE--KVLLKKSTLNSR 997
           +  L      L  EKA L  +L   KA S+ R   K+I +     E  + +LKK  LN++
Sbjct: 299 VVSL------LETEKAELLIELKNAKAKSEARESQKQIEDLTAQLEHTQAMLKKENLNAK 352

>YBL047C (EDE1) [147] chr2 complement(127860..132005) Protein with
           role in endocytosis, has similarity to cytoskeletal
           proteins Uso1p and Pan1p and to mouse tyrosine kinase
           substrate eps15 [4146 bp, 1381 aa]
          Length = 1381

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 43/217 (19%), Positives = 99/217 (45%), Gaps = 28/217 (12%)

Query: 290 RELNDITNQIEQLEGEYNSIIENSSEYVNELEKREVLAVELNKRMNSLESEIKIKQS--- 346
           +EL  +T     ++ + N++     + V + E+ E   +++NK   +L  ++ + ++   
Sbjct: 632 QELKRVTEMKNSIQIKLNNLRSTHDQNVKQTEQLEAQVLQVNKENETLAQQLAVSEANYH 691

Query: 347 ----------TDLPQLKASKLEVAGELADLDTRLNDIQMQLDASQAHLESNVKEIGEVKK 396
                     TDL + +    E+  ++ +L++    +Q QL+  Q  ++     +    K
Sbjct: 692 AAESKLNELTTDLQESQTKNAELKEQITNLNSMTASLQSQLNEKQQQVKQERSMVDVNSK 751

Query: 397 QIEINCSSIAEVQPKFQKLSNEAEILKVEIEKLTKRQRELLSK----KGKYEDF------ 446
           Q+E+N  ++A +Q +   L  +  +   + ++L   Q+ +  +    + KY+D       
Sbjct: 752 QLELNQVTVANLQKEIDGLGEKISVYLTKQKELNDYQKTVEEQHAQLQAKYQDLSNKDTD 811

Query: 447 -----RTVNERNDWIQEQINLLNQSLNKSNILKDQLT 478
                + + ERN  I+EQ NL +Q ++K   + D L+
Sbjct: 812 LTDREKQLEERNRQIEEQENLYHQHVSKLQEMFDDLS 848

>CAGL0J01485g 138326..139228 similar to sp|P38747 Saccharomyces
            cerevisiae YHL013c, hypothetical start
          Length = 300

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 28/45 (62%), Gaps = 2/45 (4%)

Query: 963  LDKANSQQRSLVKRITNFQKNAEKVLLKKSTLNSRKEELQQLIRE 1007
            L K   ++R LV RIT  +K A K   K+  +NS+ E+L+Q +RE
Sbjct: 8    LAKHRKEKRDLVNRITGMKKQATKA--KRKEVNSKCEQLEQELRE 50

>YHR023W (MYO1) [2310] chr8 (151658..157444) Myosin heavy chain
            (myosin II), coiled-coil protein involved in septation
            and cell wall organization [5787 bp, 1928 aa]
          Length = 1928

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 71/271 (26%), Positives = 123/271 (45%), Gaps = 54/271 (19%)

Query: 308  SIIENSSEYVNELEKREVLAVELNKRMNSLESEIKIKQSTDLPQLKASKLEVAGELADLD 367
            S +E+ S+Y +E+ +   L  ELN    SL++E  +K+  +   LK  KLE +    D +
Sbjct: 1577 SAVEDRSQYTDEINR---LKEELN---CSLKAETNLKK--EFATLKY-KLETSTN--DSE 1625

Query: 368  TRLNDIQMQLDASQAHLESNVKEIGEVKKQIEINCSSIAEVQPKFQKLSNEAEILKVEIE 427
             +++D+  QLD    H    V+ +   K  I +   +  E+  K++ L+ E E LK +I 
Sbjct: 1626 AKISDLLKQLD----HYTKVVEMLNNEKDAISL---AEKELYQKYEALNTECESLKGKIV 1678

Query: 428  KLTKRQRELLSKKGKYEDFRTVNERNDWIQEQINLLNQSLNKSNILKDQLTSQLSTLQHD 487
             LTK ++EL S          +N++ D +Q     L+ S  K+  + +++     TLQ  
Sbjct: 1679 SLTKIKQELES---------DLNQKTDALQISNAALSSSTQKNKEITEKIKYLEETLQLQ 1729

Query: 488  LE--NLNAE-IEDLADSVNGMGSVAQQEDLQNKVTQAKKEYLTKIDQRKQ----LWRTEQ 540
            +E  + N E ++ L  S NG                    Y  K D  KQ    L+   Q
Sbjct: 1730 MEQNSRNGELVKTLQASCNG--------------------YKDKFDDEKQKNIDLYEENQ 1769

Query: 541  RLQTISTSLDNDVKRFESDMNETIDRSLALG 571
             LQ ++T L   +K     +++T +++  L 
Sbjct: 1770 TLQKLNTDLQLQLKNLHERLSDTTEKNAWLS 1800

>YHR138C (YHR138C) [2425] chr8 complement(377356..377700) Protein
           possibly involved in vacuolar fusion, has similarity to
           Pbi2p, which is a protease B inhibitor [345 bp, 114 aa]
          Length = 114

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 38/71 (53%), Gaps = 6/71 (8%)

Query: 162 VGLKKDEYMINDKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAKDL-----ERL 216
           V   K + M  D+NS  +DV++ + ++G   ++ Y+++ +G  + L ++  +     ERL
Sbjct: 27  VTFPKTDNMATDQNSIIEDVKKYVVDIGGKITHEYSLI-KGFTVDLPDSDQILDGLKERL 85

Query: 217 HLLEDVVGAKS 227
             +E   GAK 
Sbjct: 86  SYIESEYGAKC 96

>KLLA0C10879g 936212..938479 weakly similar to sp|P31111 Saccharomyces
            cerevisiae YDR285w ZIP1 synaptonemal complex protein,
            start by similarity
          Length = 755

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 62/216 (28%), Positives = 97/216 (44%), Gaps = 22/216 (10%)

Query: 876  TLNELSSKLDELNAELNSKLLPKLHELERKPSSSHSLQ--ISQINNQMELVLMEKQTVTR 933
            T++ L SK  E+  ELN+ LL K+ ELE     +  LQ   S I    E  + E   +TR
Sbjct: 467  TVSMLRSKDHEI-EELNNNLLSKIKELEELSDKNAILQTEFSSITVSNEAYVRE---ITR 522

Query: 934  TKEQVESELSVLDSSIKSLRGEKATLQKDLDKANSQQRSLVKRITNFQKNAEKVLLKKST 993
             K++ E  ++ LDS + +     + LQKD++          K I + +K   + L + ++
Sbjct: 523  IKKENEEAITSLDSKLTAQTEISSILQKDMNDTK-------KEIDSLKKKHTQALDENNS 575

Query: 994  LNSRKEELQQLIREVGLLAEESLKKYKPLASDEILKKLNTTTGHLSKMTNVNKRASENYT 1053
            +  + E LQQ   ++ +   +S  K K L   EI + L      L   +N     S ++ 
Sbjct: 576  IKHKYENLQQQFHKINVELVQS--KAKELEFGEINRNLREQFEELESASN---HTSNSFK 630

Query: 1054 RFEDKRGELTSRAEELDESK----QSIENLIDQLKE 1085
            R  DK   L      L+  K      IE L D+LKE
Sbjct: 631  RVNDKVHALEKEKSALNLEKLDLMDKIEELEDKLKE 666

>KLLA0B11121g 976252..976965 weakly similar to sp|P53271
           Saccharomyces cerevisiae YGR120c SEC35 required for ER
           to golgi vesicle docking singleton, start by similarity
          Length = 237

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 41/73 (56%), Gaps = 1/73 (1%)

Query: 551 NDVKRFESDMNETIDRSLALGLQNVNDIVNRLNLHEHVFGPVGELIKVSDKYKICAEVVG 610
           ND+++F   + +  D S+A   +     ++ L   +++FG + ++ K+S+  KIC ++V 
Sbjct: 100 NDLQQFNKQLLQLCDSSVAETREKTVTALSYLKSLDNLFGKLDDITKLSESLKICQQLVS 159

Query: 611 G-NSLFNVVVDNE 622
              S+  + +D+E
Sbjct: 160 SLQSMVQLNIDDE 172

>Kwal_26.9386
          Length = 1215

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 67/130 (51%), Gaps = 13/130 (10%)

Query: 289 DRELNDITNQIEQLEGEYNSIIENSSEYVNELEKREVLAVELNKRMNSLESEIKIKQST- 347
           D+EL D T+  +++ GE   +     + VNE    +++ +E  K   +L  E K K+   
Sbjct: 565 DKELKDTTHSHDKIVGELG-MTSTKLDKVNE----KLITIE--KEKTALADECKKKEEEY 617

Query: 348 --DLPQLKASKLEVAGELADLDTRLNDIQMQLDASQAHLESNVKEIGEVKKQIEINCSSI 405
              +  L + KL++  +++DL   LND ++  D + A LES ++ + EV+     + SS+
Sbjct: 618 ILKVESLNSEKLKLEAKVSDLQKCLNDERLNWDRTTASLESEIERLREVEN---TSSSSM 674

Query: 406 AEVQPKFQKL 415
            E+  K Q L
Sbjct: 675 NELVLKVQSL 684

>Kwal_27.12530
          Length = 1087

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 43/79 (54%), Gaps = 4/79 (5%)

Query: 748 EYKKIQVELQEIKQALQSIEQEIDGLNNVVKDAAAERDAYE---AGIEKARSQLKAKLSQ 804
           E +K++ EL++ K  L S  +E   L + V D   ER+AY+     + +  S+L A+  Q
Sbjct: 637 EVQKLKYELEQQKLELASSREECKQLRSRVVDFEDERNAYQETLVNLNQELSRLTAEREQ 696

Query: 805 KITI-DDSIKALKARLNKI 822
           ++   +DS   LKA +N I
Sbjct: 697 QMLAKNDSFSTLKAEMNTI 715

>CAGL0E01265g complement(112930..119217) weakly similar to tr|Q03767
           Saccharomyces cerevisiae YDR150w nuclear migration
           protein, hypothetical start
          Length = 2095

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 52/243 (21%), Positives = 106/243 (43%), Gaps = 38/243 (15%)

Query: 728 LDQYKSNRLDTLRDFKQSKREYKKIQVELQEIKQALQSIEQEIDGLNNVVKDAAAERDAY 787
           ++Q K    D + D ++     +K+Q EL ++K     +E  +D  NN ++    E++  
Sbjct: 93  IEQLKQENHDLVEDQQKHTTGTEKLQQELDDLKHLNWDLEANLDSCNNALRLIRNEKNDL 152

Query: 788 EAGIEKARSQLKA-------------KLSQKIT-----IDDSIKALKARLNKIDTELEQC 829
           +   +  R QL A             KL  +++     ID   K+++ RL+ ++ E ++ 
Sbjct: 153 DENYKTTREQLDAIRTESEVLKLENQKLQSQLSSHVANIDQESKSMRQRLSNLNDENDEL 212

Query: 830 RERTNAFAADIS------------KPFVNELDADEKAELLAISNSIQTKETSLNFNLSTL 877
             + N+    +S            +  V E  +D + +    + SI T  T +N +L   
Sbjct: 213 SSKVNSLETSLSTLKNGLLRFLKKQKLVEEDTSDLEDDFFD-TRSIDTMATEINNDLPI- 270

Query: 878 NELSSKLDELNAELNSKLLPKLHELERKPSSSHSLQ--ISQINNQMELVLMEKQTVTRTK 935
                KL+ +    N KL+P   + E    +S  L+  I++IN+  +  ++ ++ +   +
Sbjct: 271 ----EKLETMAQSHNCKLIPIDQDTESYKLNSLPLESIINKINDSEDFEVISRKELETLR 326

Query: 936 EQV 938
           EQV
Sbjct: 327 EQV 329

>AGL335W [3977] [Homologous to ScYMR301C (ATM1) - SH]
            complement(82640..84715) [2076 bp, 691 aa]
          Length = 691

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 35/71 (49%), Gaps = 8/71 (11%)

Query: 1172 RVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTI-KNLSD--- 1227
            R   +SGG+K   AIA +L    +  AP   FDE  +ALD     A+  TI +N S    
Sbjct: 568  RGLMISGGEKQRLAIARVL----LKDAPLMFFDEATSALDTHTEQALLHTIQQNFSSNSK 623

Query: 1228 TAQFICTTFRT 1238
            T+ ++    RT
Sbjct: 624  TSVYVAHRLRT 634

>AFR730W [3923] [Homologous to ScYCL050C (APA1) - SH; ScYDR530C
           (APA2) - SH] complement(1780621..1781577) [957 bp, 318
           aa]
          Length = 318

 Score = 31.6 bits (70), Expect = 4.5,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 40/85 (47%)

Query: 737 DTLRDFKQSKREYKKIQVELQEIKQALQSIEQEIDGLNNVVKDAAAERDAYEAGIEKARS 796
           D +R+  Q+K E       +Q  +    ++  E  G+  VV  AA+ +   E G E+ + 
Sbjct: 7   DDVRELVQAKYEAAVASGHVQFTETTQTAVRDEASGMQYVVSYAASLQQKPERGSEELKE 66

Query: 797 QLKAKLSQKITIDDSIKALKARLNK 821
              AK   ++T+ +++   +  LNK
Sbjct: 67  DPFAKAEPELTVLENVGPHRLVLNK 91

>AFL058C [3135] [Homologous to ScYGL093W (SPC105) - SH]
           (325923..328613) [2691 bp, 896 aa]
          Length = 896

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 48/89 (53%), Gaps = 7/89 (7%)

Query: 755 ELQEIKQALQSIEQ----EIDGLNNVVKDAAAERDAYEAGIEKARSQLKA---KLSQKIT 807
           E+ +IK  LQ++EQ    E++ L N  K       A    IEK +S+LKA   KL+    
Sbjct: 601 EISDIKHRLQALEQSLRHELELLRNGEKPMRVTTLADRLKIEKIKSELKANMIKLNNTAN 660

Query: 808 IDDSIKALKARLNKIDTELEQCRERTNAF 836
           +++  +A+ A +N + ++++  RE  ++ 
Sbjct: 661 LEEQKEAISADINALRSQIKDVREEISSL 689

>KLLA0E13035g 1151967..1153988 similar to sp|P40460 Saccharomyces
            cerevisiae YIL144w TID3 DMC1P interacting protein, start
            by similarity
          Length = 673

 Score = 31.2 bits (69), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 43/79 (54%), Gaps = 2/79 (2%)

Query: 1008 VGLLAEESLKKYKPLASDEILKKLNTTTGHLS-KMTNVNKRASENYTRFEDKRGELTSRA 1066
            +GL  EE +   K   +D I K LN     +  ++TN+    S+   + ED R E+T++ 
Sbjct: 494  IGLTVEELIGDKKSF-TDPIKKNLNKIAEDIKMRITNIQTENSKLQIKLEDLRNEITTKN 552

Query: 1067 EELDESKQSIENLIDQLKE 1085
            E+LD+ +Q + ++  + +E
Sbjct: 553  EDLDQLEQQLSSIKSEYEE 571

>CAGL0B04851g complement(463474..468096) similar to sp|P25558
            Saccharomyces cerevisiae YCL014w BUD3 budding protein,
            hypothetical start
          Length = 1540

 Score = 31.2 bits (69), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 36/73 (49%), Gaps = 4/73 (5%)

Query: 1005 IREVGLLAEESLKKYKPLASDEILKKLNTTTGHLSKMTNVNKRASENYTR----FEDKRG 1060
            +  +  +  +SLK   P  S E+LK  N T  +  K    ++ A++N+++    F +  G
Sbjct: 301  VTRINCIFLDSLKAAVPFGSFEVLKACNITIPYFYKAYTRHEAATKNFSKDIKLFLENFG 360

Query: 1061 ELTSRAEELDESK 1073
            ++  + EE  E K
Sbjct: 361  DVIPKKEEYTEMK 373

>YBR156C (SLI15) [341] chr2 complement(551060..553156) Mitotic
           spindle protein required for proper chromosome
           segregation [2097 bp, 698 aa]
          Length = 698

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 82/190 (43%), Gaps = 44/190 (23%)

Query: 509 AQQEDLQNK-------VTQAKKEYLT-KIDQRKQLWRTEQRLQTISTSLDNDVK------ 554
           A+++DL+ K       + ++++E+   K +++K++   EQ L+   TS  ND K      
Sbjct: 519 AERDDLKKKFDKRLSGIMRSQQEHHRRKQEKQKRMSHLEQDLKK-QTSFSNDYKDIRLKE 577

Query: 555 ---RFESDMNETIDRSLALGLQNVNDIVNRLNLHEHVFGPVGELIKVSDKYKICAEVVGG 611
               F++ + +TI+++ A    N+   +N ++ H  + G V   I         A V   
Sbjct: 578 SLAPFDNHVRDTINKNTAFSTDNILATINTVD-HREIIGNVTPKI---------ASV--N 625

Query: 612 NSLFNVVVDNEETASLLIKELFATK------------GGRVTFIPLNKLHVDTNFTYP-- 657
           +SL  +  D+E+ AS+ +     +               +  F P+  LH D  F  P  
Sbjct: 626 DSLPEINTDSEDEASVTLAAWAKSPYLQEQLIRQQDINPQTIFGPIPPLHTDEIFPNPRL 685

Query: 658 NNLEKNQCTP 667
           N L+  Q  P
Sbjct: 686 NRLKPRQIVP 695

>Sklu_2355.3 YLR045C, Contig c2355 7060-9666 reverse complement
          Length = 868

 Score = 31.2 bits (69), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 57/99 (57%), Gaps = 8/99 (8%)

Query: 416 SNEAEILKVEIEKLTKRQRELLSKKGKYEDFRT-VNERNDWIQEQINLLNQSLN-KSNIL 473
           ++E E LK++ +K  K ++ELL+K   +++  + +N  N  +Q+Q+N L  +L+ K+  L
Sbjct: 640 AHELEELKLQKQKWLKERQELLAKMVTFQNQTSQLNNENAMLQQQVNRLQTNLHEKATEL 699

Query: 474 KD---QLT---SQLSTLQHDLENLNAEIEDLADSVNGMG 506
           +    QL+    ++STL+ +LE  N+      D+  G+ 
Sbjct: 700 RSKEIQLSKAHDRISTLEQELETKNSTPHSSLDTKPGLS 738

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.129    0.339 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 38,203,400
Number of extensions: 1708938
Number of successful extensions: 11780
Number of sequences better than 10.0: 788
Number of HSP's gapped: 10865
Number of HSP's successfully gapped: 1532
Length of query: 1260
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1147
Effective length of database: 12,684,275
Effective search space: 14548863425
Effective search space used: 14548863425
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)