Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M12452g74733694e-48
YDR170C (SEC7)200932562.6
ADL366W68026553.2
Scas_481.1*32715544.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M12452g
         (73 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M12452g 1239468..1239692 no similarity, hypothetical start       146   4e-48
YDR170C (SEC7) [1012] chr4 complement(796187..802216) Component ...    26   2.6  
ADL366W [1375] [Homologous to ScYPR074C (TKL1) - SH; ScYBR117C (...    26   3.2  
Scas_481.1*                                                            25   4.3  

>CAGL0M12452g 1239468..1239692 no similarity, hypothetical start
          Length = 74

 Score =  146 bits (369), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 73/73 (100%), Positives = 73/73 (100%)

Query: 1  MAKKFLVFLTLRAPSPNALPGREGKKNDIMWEKGKSPVLFPTIAAVARRKISTQVLLWKK 60
          MAKKFLVFLTLRAPSPNALPGREGKKNDIMWEKGKSPVLFPTIAAVARRKISTQVLLWKK
Sbjct: 1  MAKKFLVFLTLRAPSPNALPGREGKKNDIMWEKGKSPVLFPTIAAVARRKISTQVLLWKK 60

Query: 61 RVGSLAKPHGGVG 73
          RVGSLAKPHGGVG
Sbjct: 61 RVGSLAKPHGGVG 73

>YDR170C (SEC7) [1012] chr4 complement(796187..802216) Component of
            non-clathrin vesicle coat required for protein
            trafficking within the Golgi [6030 bp, 2009 aa]
          Length = 2009

 Score = 26.2 bits (56), Expect = 2.6,   Method: Composition-based stats.
 Identities = 12/32 (37%), Positives = 17/32 (53%)

Query: 17   NALPGREGKKNDIMWEKGKSPVLFPTIAAVAR 48
            +AL    GK ND  WEK    +LFP    +++
Sbjct: 1564 DALVAYGGKFNDDFWEKICKKLLFPIFGVLSK 1595

>ADL366W [1375] [Homologous to ScYPR074C (TKL1) - SH; ScYBR117C
           (TKL2) - SH] complement(63092..65134) [2043 bp, 680 aa]
          Length = 680

 Score = 25.8 bits (55), Expect = 3.2,   Method: Composition-based stats.
 Identities = 15/26 (57%), Positives = 17/26 (65%), Gaps = 1/26 (3%)

Query: 31  WEKGKSPVLFPTIAAVARRKISTQVL 56
           WE  K PV  PT +AVA RK+S  VL
Sbjct: 342 WES-KLPVYKPTDSAVASRKLSEIVL 366

>Scas_481.1*
          Length = 327

 Score = 25.4 bits (54), Expect = 4.3,   Method: Composition-based stats.
 Identities = 10/15 (66%), Positives = 12/15 (80%)

Query: 48 RRKISTQVLLWKKRV 62
          RRK   Q+LLWKKR+
Sbjct: 49 RRKEVVQILLWKKRM 63

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.136    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,411,133
Number of extensions: 76248
Number of successful extensions: 108
Number of sequences better than 10.0: 6
Number of HSP's gapped: 108
Number of HSP's successfully gapped: 6
Length of query: 73
Length of database: 16,596,109
Length adjustment: 46
Effective length of query: 27
Effective length of database: 15,003,681
Effective search space: 405099387
Effective search space used: 405099387
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)