Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M12430g24924511691e-164
CAGL0M11660g24824011301e-158
YIL053W (RHR2)27124210571e-147
Scas_701.825024210451e-145
YER062C (HOR2)25024210361e-144
Kwal_23.583124924510351e-144
ADL071C2532419411e-129
KLLA0C08217g2562419351e-128
CAGL0I05874g2472439231e-127
Scas_704.322472439001e-123
Sklu_2394.32432262911e-31
CAGL0D04092g2512462832e-30
YHR043C (DOG2)2462402552e-26
Scas_690.302592262562e-26
CAGL0M12925g2462232441e-24
YHR044C (DOG1)2462372431e-24
KLLA0C11143g2682322371e-23
Scas_690.312442272316e-23
AAL123W2892402321e-22
CAGL0A01386g110229750.19
Kwal_55.2125485358681.3
Kwal_55.20214127567643.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M12430g
         (245 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M12430g complement(1238150..1238899) highly similar to sp|P...   454   e-164
CAGL0M11660g complement(1158566..1159312) highly similar to sp|P...   439   e-158
YIL053W (RHR2) [2614] chr9 (255050..255865) DL-glycerol phosphat...   411   e-147
Scas_701.8                                                            407   e-145
YER062C (HOR2) [1493] chr5 complement(279928..280680) DL-glycero...   403   e-144
Kwal_23.5831                                                          403   e-144
ADL071C [1670] [Homologous to ScYIL053W (RHR2) - SH; ScYER062C (...   367   e-129
KLLA0C08217g 721753..722523 highly similar to sp|P41277 Saccharo...   364   e-128
CAGL0I05874g complement(558102..558845) highly similar to sp|P41...   360   e-127
Scas_704.32                                                           351   e-123
Sklu_2394.3 YHR043C, Contig c2394 2120-2851 reverse complement        116   1e-31
CAGL0D04092g 405613..406368 similar to sp|P38773 Saccharomyces c...   113   2e-30
YHR043C (DOG2) [2331] chr8 complement(192797..193537) 2-Deoxyglu...   102   2e-26
Scas_690.30                                                           103   2e-26
CAGL0M12925g 1274919..1275659 similar to sp|P38773 Saccharomyces...    99   1e-24
YHR044C (DOG1) [2332] chr8 complement(194060..194800) 2-Deoxyglu...    98   1e-24
KLLA0C11143g 956474..957280 similar to sp|P38773 Saccharomyces c...    96   1e-23
Scas_690.31                                                            94   6e-23
AAL123W [64] [Homologous to ScYHR043C (DOG2) - SH; ScYHR044C (DO...    94   1e-22
CAGL0A01386g 136693..140001 some similarities with sp|P08640 Sac...    33   0.19 
Kwal_55.21254                                                          31   1.3  
Kwal_55.20214                                                          29   3.2  

>CAGL0M12430g complement(1238150..1238899) highly similar to
           sp|P41277 Saccharomyces cerevisiae YIL053w RHR2 or
           sp|P40106 Saccharomyces cerevisiae YER062c GPP2,
           hypothetical start
          Length = 249

 Score =  454 bits (1169), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 226/245 (92%), Positives = 226/245 (92%)

Query: 1   MSLAKPVSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDA 60
           MSLAKPVSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDA
Sbjct: 1   MSLAKPVSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDA 60

Query: 61  IAKFAPDYADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCTDLNKLPKEKWAVATSGTRDM 120
           IAKFAPDYADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCTDLNKLPKEKWAVATSGTRDM
Sbjct: 61  IAKFAPDYADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCTDLNKLPKEKWAVATSGTRDM 120

Query: 121 AQKWFKFLNIDRPEYFITANDVKQGKPFPEPYIKGREGLGYPINKEDPSKSKVVVFEDXX 180
           AQKWFKFLNIDRPEYFITANDVKQGKPFPEPYIKGREGLGYPINKEDPSKSKVVVFED  
Sbjct: 121 AQKWFKFLNIDRPEYFITANDVKQGKPFPEPYIKGREGLGYPINKEDPSKSKVVVFEDAP 180

Query: 181 XXXXXXXXXXXXXXXXXTTFDVDFLKEKGCDIIVKNHESIRVGGYNPETDEVEFIFDDYL 240
                            TTFDVDFLKEKGCDIIVKNHESIRVGGYNPETDEVEFIFDDYL
Sbjct: 181 AGIAAGQAAGCKIIGIATTFDVDFLKEKGCDIIVKNHESIRVGGYNPETDEVEFIFDDYL 240

Query: 241 YAKDD 245
           YAKDD
Sbjct: 241 YAKDD 245

>CAGL0M11660g complement(1158566..1159312) highly similar to
           sp|P41277 Saccharomyces cerevisiae YIL053w RHR2 or
           sp|P40106 Saccharomyces cerevisiae YER062c GPP2,
           hypothetical start
          Length = 248

 Score =  439 bits (1130), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 217/240 (90%), Positives = 220/240 (91%)

Query: 6   PVSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKFA 65
           PVSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKFA
Sbjct: 5   PVSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKFA 64

Query: 66  PDYADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCTDLNKLPKEKWAVATSGTRDMAQKWF 125
           PDYADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCTDLNKLPKEKWAVATSGTRDMAQKWF
Sbjct: 65  PDYADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCTDLNKLPKEKWAVATSGTRDMAQKWF 124

Query: 126 KFLNIDRPEYFITANDVKQGKPFPEPYIKGREGLGYPINKEDPSKSKVVVFEDXXXXXXX 185
           K LNI+RPEYFITANDVKQGKPFPEPY+KGREGLG+PINKEDPSKSKVVVFED       
Sbjct: 125 KILNIERPEYFITANDVKQGKPFPEPYLKGREGLGFPINKEDPSKSKVVVFEDAPAGIAA 184

Query: 186 XXXXXXXXXXXXTTFDVDFLKEKGCDIIVKNHESIRVGGYNPETDEVEFIFDDYLYAKDD 245
                       TTFDVDFLKEKGCDIIVKNHESIRVGGYNPETDEVEFIFDDYLYAKDD
Sbjct: 185 GKAAGCKIIGIATTFDVDFLKEKGCDIIVKNHESIRVGGYNPETDEVEFIFDDYLYAKDD 244

>YIL053W (RHR2) [2614] chr9 (255050..255865) DL-glycerol phosphate
           phosphatase (sn-glycerol-3-phosphatase) [816 bp, 271 aa]
          Length = 271

 Score =  411 bits (1057), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 201/242 (83%), Positives = 210/242 (86%)

Query: 4   AKPVSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAK 63
            KP+SLK+NAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAK
Sbjct: 26  TKPLSLKINAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAK 85

Query: 64  FAPDYADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCTDLNKLPKEKWAVATSGTRDMAQK 123
           FAPD+ADEEYVNKLEGEIPEKYGEHSIEVPGAVKLC  LN LPKEKWAVATSGTRDMA+K
Sbjct: 86  FAPDFADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCNALNALPKEKWAVATSGTRDMAKK 145

Query: 124 WFKFLNIDRPEYFITANDVKQGKPFPEPYIKGREGLGYPINKEDPSKSKVVVFEDXXXXX 183
           WF  L I RPEYFITANDVKQGKP PEPY+KGR GLG+PIN++DPSKSKVVVFED     
Sbjct: 146 WFDILKIKRPEYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKVVVFEDAPAGI 205

Query: 184 XXXXXXXXXXXXXXTTFDVDFLKEKGCDIIVKNHESIRVGGYNPETDEVEFIFDDYLYAK 243
                         TTFD+DFLKEKGCDIIVKNHESIRVG YN ETDEVE IFDDYLYAK
Sbjct: 206 AAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRVGEYNAETDEVELIFDDYLYAK 265

Query: 244 DD 245
           DD
Sbjct: 266 DD 267

>Scas_701.8
          Length = 250

 Score =  407 bits (1045), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 198/242 (81%), Positives = 210/242 (86%)

Query: 4   AKPVSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAK 63
            KP+SLKVNAALFDVDGTIIISQ AIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAK
Sbjct: 5   TKPLSLKVNAALFDVDGTIIISQGAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAK 64

Query: 64  FAPDYADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCTDLNKLPKEKWAVATSGTRDMAQK 123
           FAPD+ADEE V+KLEGEIPEKYGEHSIEVPGAVKLC DLNKLPKEKWAVATSGTR+MA K
Sbjct: 65  FAPDFADEELVSKLEGEIPEKYGEHSIEVPGAVKLCNDLNKLPKEKWAVATSGTREMATK 124

Query: 124 WFKFLNIDRPEYFITANDVKQGKPFPEPYIKGREGLGYPINKEDPSKSKVVVFEDXXXXX 183
           WF  L I RP+YFITANDVKQGKP PEPY+KGR GLG+PIN++DPSKSK +VFED     
Sbjct: 125 WFDLLKIKRPQYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKAIVFEDAPAGI 184

Query: 184 XXXXXXXXXXXXXXTTFDVDFLKEKGCDIIVKNHESIRVGGYNPETDEVEFIFDDYLYAK 243
                         TTFD+DFLKEKGCDIIVKNHESIRVGGY+P TDEVEFIFDDYLYAK
Sbjct: 185 VAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRVGGYDPVTDEVEFIFDDYLYAK 244

Query: 244 DD 245
           DD
Sbjct: 245 DD 246

>YER062C (HOR2) [1493] chr5 complement(279928..280680) DL-glycerol
           phosphate phosphatase (sn-glycerol-3-phosphatase) [753
           bp, 250 aa]
          Length = 250

 Score =  403 bits (1036), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 198/242 (81%), Positives = 209/242 (86%)

Query: 4   AKPVSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAK 63
            KP+SLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVI +SHGWRT+DAIAK
Sbjct: 5   TKPLSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIQVSHGWRTFDAIAK 64

Query: 64  FAPDYADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCTDLNKLPKEKWAVATSGTRDMAQK 123
           FAPD+A+EEYVNKLE EIP KYGE SIEVPGAVKLC  LN LPKEKWAVATSGTRDMAQK
Sbjct: 65  FAPDFANEEYVNKLEAEIPVKYGEKSIEVPGAVKLCNALNALPKEKWAVATSGTRDMAQK 124

Query: 124 WFKFLNIDRPEYFITANDVKQGKPFPEPYIKGREGLGYPINKEDPSKSKVVVFEDXXXXX 183
           WF+ L I RP+YFITANDVKQGKP PEPY+KGR GLGYPIN++DPSKSKVVVFED     
Sbjct: 125 WFEHLGIRRPKYFITANDVKQGKPHPEPYLKGRNGLGYPINEQDPSKSKVVVFEDAPAGI 184

Query: 184 XXXXXXXXXXXXXXTTFDVDFLKEKGCDIIVKNHESIRVGGYNPETDEVEFIFDDYLYAK 243
                         TTFD+DFLKEKGCDIIVKNHESIRVGGYN ETDEVEFIFDDYLYAK
Sbjct: 185 AAGKAAGCKIIGIATTFDLDFLKEKGCDIIVKNHESIRVGGYNAETDEVEFIFDDYLYAK 244

Query: 244 DD 245
           DD
Sbjct: 245 DD 246

>Kwal_23.5831
          Length = 249

 Score =  403 bits (1035), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 195/245 (79%), Positives = 213/245 (86%)

Query: 1   MSLAKPVSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDA 60
           M+L+KP+S KVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIH SHGWRTYDA
Sbjct: 1   MTLSKPLSFKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHESHGWRTYDA 60

Query: 61  IAKFAPDYADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCTDLNKLPKEKWAVATSGTRDM 120
           IAKFAPD+ADE+Y  +LE EIPEKYGEHSIEVPGAVKLC DLN LPKEKWAVATSGTR M
Sbjct: 61  IAKFAPDFADEDYATQLEAEIPEKYGEHSIEVPGAVKLCKDLNALPKEKWAVATSGTRPM 120

Query: 121 AQKWFKFLNIDRPEYFITANDVKQGKPFPEPYIKGREGLGYPINKEDPSKSKVVVFEDXX 180
           A KWF+ L I++PEYFITANDVKQGKPFPEPY+KGR GLG+PIN++DPSKSKV+VFED  
Sbjct: 121 ASKWFEHLGIEKPEYFITANDVKQGKPFPEPYLKGRNGLGFPINEQDPSKSKVIVFEDAP 180

Query: 181 XXXXXXXXXXXXXXXXXTTFDVDFLKEKGCDIIVKNHESIRVGGYNPETDEVEFIFDDYL 240
                            TTFD+DFLKEKGCDIIVK+HESIRVGGY+ ETDEVEFIFDD+L
Sbjct: 181 AGIAAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKDHESIRVGGYDAETDEVEFIFDDFL 240

Query: 241 YAKDD 245
           YAKDD
Sbjct: 241 YAKDD 245

>ADL071C [1670] [Homologous to ScYIL053W (RHR2) - SH; ScYER062C
           (HOR2) - SH] (556136..556897) [762 bp, 253 aa]
          Length = 253

 Score =  367 bits (941), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 175/241 (72%), Positives = 196/241 (81%)

Query: 5   KPVSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKF 64
           +P+SLKVN ALFDVDGTIIISQPA+AAFWR+FGKDKPYFDAEHVI  +HGWRTYDAIA F
Sbjct: 9   QPISLKVNGALFDVDGTIIISQPALAAFWREFGKDKPYFDAEHVISATHGWRTYDAIATF 68

Query: 65  APDYADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCTDLNKLPKEKWAVATSGTRDMAQKW 124
           APDY  EEYV +LEGEIP+KYG+ S+EVPGAV LC  LN+LPKEKWAV TSGT +MA KW
Sbjct: 69  APDYLSEEYVTRLEGEIPDKYGKFSVEVPGAVTLCNALNELPKEKWAVGTSGTFEMAHKW 128

Query: 125 FKFLNIDRPEYFITANDVKQGKPFPEPYIKGREGLGYPINKEDPSKSKVVVFEDXXXXXX 184
           F  L I RP  FITANDVKQGKP PEPYIKGR  LG+PIN+++P  SKV+VFED      
Sbjct: 129 FDVLGIKRPSTFITANDVKQGKPHPEPYIKGRNALGFPINEQNPKGSKVIVFEDAPAGIA 188

Query: 185 XXXXXXXXXXXXXTTFDVDFLKEKGCDIIVKNHESIRVGGYNPETDEVEFIFDDYLYAKD 244
                        TTFDV++LKE+GCDIIVK+H SIRVGGYNPETDEVEF+FDDYLYAKD
Sbjct: 189 AGKAAGCKIVGVATTFDVEYLKERGCDIIVKDHRSIRVGGYNPETDEVEFVFDDYLYAKD 248

Query: 245 D 245
           D
Sbjct: 249 D 249

>KLLA0C08217g 721753..722523 highly similar to sp|P41277
           Saccharomyces cerevisiae YIL053w RHR2 DL-glycerol
           phosphatase, start by similarity
          Length = 256

 Score =  364 bits (935), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 172/241 (71%), Positives = 196/241 (81%)

Query: 5   KPVSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKF 64
           +P+SL+VNAALFDVDGT+IISQPAIA FWRDFGKDKPYFD++HVI ISHGWRTYD I +F
Sbjct: 12  QPISLRVNAALFDVDGTLIISQPAIAEFWRDFGKDKPYFDSQHVIDISHGWRTYDVIKQF 71

Query: 65  APDYADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCTDLNKLPKEKWAVATSGTRDMAQKW 124
           APDYA+EEYV KLEGEIPEK+G+H+IEVPGA KLC +LNKLPKEKWAVATSGT +MA KW
Sbjct: 72  APDYANEEYVTKLEGEIPEKFGQHAIEVPGASKLCGELNKLPKEKWAVATSGTYEMAHKW 131

Query: 125 FKFLNIDRPEYFITANDVKQGKPFPEPYIKGREGLGYPINKEDPSKSKVVVFEDXXXXXX 184
           F  L I RP  FITANDVK GKP PEPY+KGR GL YPINKE+P+ SKV+VFED      
Sbjct: 132 FDILGIKRPSNFITANDVKNGKPHPEPYLKGRNGLSYPINKENPAASKVIVFEDAPAGIL 191

Query: 185 XXXXXXXXXXXXXTTFDVDFLKEKGCDIIVKNHESIRVGGYNPETDEVEFIFDDYLYAKD 244
                        TTFD +FL EKGCDI++K+H  +RV  Y+PETDEVEFIFD+YLYAKD
Sbjct: 192 AGKAAGCKIVGIATTFDKEFLIEKGCDIVIKDHTKLRVAAYHPETDEVEFIFDEYLYAKD 251

Query: 245 D 245
           D
Sbjct: 252 D 252

>CAGL0I05874g complement(558102..558845) highly similar to sp|P41277
           Saccharomyces cerevisiae YIL053w RHR2 or sp|P40106
           Saccharomyces cerevisiae YER062c GPP2, hypothetical
           start
          Length = 247

 Score =  360 bits (923), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 171/243 (70%), Positives = 195/243 (80%)

Query: 3   LAKPVSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIA 62
           + +P++L+VNAALFDVDGTIIISQPA+AAFWRDFGKDKPYFDAEHVIH+SHGWRTYDAIA
Sbjct: 1   MPEPITLRVNAALFDVDGTIIISQPALAAFWRDFGKDKPYFDAEHVIHVSHGWRTYDAIA 60

Query: 63  KFAPDYADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCTDLNKLPKEKWAVATSGTRDMAQ 122
           KFAPD+ADEE V KLEGEIP+KYG+ +IEV GAVKLC   N+LPKEKWAVATSGTR+MA 
Sbjct: 61  KFAPDFADEETVTKLEGEIPDKYGKEAIEVAGAVKLCNSFNELPKEKWAVATSGTREMAS 120

Query: 123 KWFKFLNIDRPEYFITANDVKQGKPFPEPYIKGREGLGYPINKEDPSKSKVVVFEDXXXX 182
           KWF  L I +P YFITANDVK+GKP PEPY+KGREGLGYPIN   P KSKVVVFED    
Sbjct: 121 KWFAVLGIKKPTYFITANDVKKGKPNPEPYLKGREGLGYPINTHYPEKSKVVVFEDAPAG 180

Query: 183 XXXXXXXXXXXXXXXTTFDVDFLKEKGCDIIVKNHESIRVGGYNPETDEVEFIFDDYLYA 242
                          TTF    L+EKGCDI++K+H S+RV GY+ ETDEV  +FDDYLY 
Sbjct: 181 IAAGKAAGCKIIGIATTFSASSLREKGCDIVIKDHRSVRVAGYDKETDEVILVFDDYLYV 240

Query: 243 KDD 245
           +DD
Sbjct: 241 RDD 243

>Scas_704.32
          Length = 247

 Score =  351 bits (900), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 163/243 (67%), Positives = 196/243 (80%)

Query: 3   LAKPVSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIA 62
           +  P++L+VNAALFDVDGTIIISQPA+AAFW+ FG+DKPYFDA+ V H +HGWRTYDAI 
Sbjct: 1   MNNPIALRVNAALFDVDGTIIISQPALAAFWKHFGEDKPYFDADLVTHATHGWRTYDAIE 60

Query: 63  KFAPDYADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCTDLNKLPKEKWAVATSGTRDMAQ 122
           KFAPD+AD EYV +LEGEIP K+G+H++EVPGAVKLC + NKLPKE+WAVATSGT +MA 
Sbjct: 61  KFAPDWADREYVTQLEGEIPTKFGQHALEVPGAVKLCNEFNKLPKERWAVATSGTFEMAS 120

Query: 123 KWFKFLNIDRPEYFITANDVKQGKPFPEPYIKGREGLGYPINKEDPSKSKVVVFEDXXXX 182
           KWF+ L I+RP  FITANDV++GKP P+PY+KGR GLG+PIN  +PSKSKVVVFED    
Sbjct: 121 KWFELLKIERPTNFITANDVERGKPHPDPYLKGRNGLGFPINATNPSKSKVVVFEDAPAG 180

Query: 183 XXXXXXXXXXXXXXXTTFDVDFLKEKGCDIIVKNHESIRVGGYNPETDEVEFIFDDYLYA 242
                          TTFD +FLKEKGCD+IV NHESI++ GY PETDE+E +F DYL+A
Sbjct: 181 IESGKAAGCKIVGVATTFDEEFLKEKGCDLIVSNHESIKLNGYYPETDEIELVFHDYLFA 240

Query: 243 KDD 245
           KDD
Sbjct: 241 KDD 243

>Sklu_2394.3 YHR043C, Contig c2394 2120-2851 reverse complement
          Length = 243

 Score =  116 bits (291), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 81/226 (35%), Positives = 113/226 (50%), Gaps = 16/226 (7%)

Query: 9   LKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKFAP-- 66
            KVN  LFD+DGTI+ +  A  + W++  K K   D E +   SHG RT +  +KF P  
Sbjct: 4   FKVNLCLFDLDGTIVSTTIAAESAWKELCK-KHGVDPEELFKCSHGARTSEIFSKFFPSI 62

Query: 67  DYADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCTDLNK--------LPKEKWAVATSGTR 118
           D  D + V KLE  I   Y +    +PGA +L   L+K          K KWA+ TSG+ 
Sbjct: 63  DNTDNQAVKKLELAIAHDYLDSVGLIPGASELLLSLDKCSDPPFDNFSKRKWAIVTSGSS 122

Query: 119 DMAQKWFKFL--NIDRPEYFITANDVKQGKPFPEPYIKGREGLGYPINKEDPSKSKVVVF 176
           D+A  WF  +  +I +P+ FITA DV +GKP PE Y K R+ L    + E P   ++VVF
Sbjct: 123 DLAFSWFDTILQHIGKPDVFITAFDVVKGKPDPEGYSKARDQLSKIWSLEFP---EIVVF 179

Query: 177 EDXXXXXXXXXXXXXXXXXXXTTFDVDFLKEKGCDIIVKNHESIRV 222
           ED                   +T+  D L E G D +V +  ++ V
Sbjct: 180 EDAPVGIKAGKEIGAITVGITSTYSKDVLFEAGADYVVSDLTNVIV 225

>CAGL0D04092g 405613..406368 similar to sp|P38773 Saccharomyces
           cerevisiae YHR043c DOG2 2-deoxyglucose-6-phosphate
           phosphatase, hypothetical start
          Length = 251

 Score =  113 bits (283), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 79/246 (32%), Positives = 118/246 (47%), Gaps = 15/246 (6%)

Query: 1   MSLAKPVSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDA 60
           M++ K     V+  LFD+DGTI+ +  A  + WR     K   D E +   SHG RT + 
Sbjct: 1   MTVKKDNQFSVDVCLFDLDGTIVSTTVAAESAWRMLCA-KEGVDPEELFKFSHGVRTSEV 59

Query: 61  IAKFAP--DYADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCTDLNK--------LPKEKW 110
           +AKF P  D  D +   +LE  +   + +    +PGA  L   L+K          + KW
Sbjct: 60  LAKFFPNIDNTDNKMTRELELSMANNFLDTVSLIPGAKDLLLTLDKDTARQGAKFNERKW 119

Query: 111 AVATSGTRDMAQKWFKFL--NIDRPEYFITANDVKQGKPFPEPYIKGREGLGYPINKEDP 168
           A+ TSG+ D+A  WFK +   + +P+ FITA DV +GKP PE Y K ++ L   +  E  
Sbjct: 120 AIVTSGSPDLAFSWFKTILKEVGKPDVFITAFDVTKGKPDPEGYAKAKKLLCERLQYESA 179

Query: 169 SKSKVVVFEDXXXXXXXXXXXXXXXXXXXTTFDVDFLKEKGCDIIVKNHESIRVGGYNPE 228
           S +  VVFED                   +T+D+  L + G D +VK+   + V   N E
Sbjct: 180 SATS-VVFEDAPAGIKAGKAMGAITVGITSTYDLQTLIDAGADYVVKDLTQVEV-LKNTE 237

Query: 229 TDEVEF 234
            D++  
Sbjct: 238 GDQITL 243

>YHR043C (DOG2) [2331] chr8 complement(192797..193537)
           2-Deoxyglucose-6-phosphate phosphatase, converts
           2-deoxy-D-glucose 6-phosphate to 2-deoxy-D-glucose and
           orthophosphate [741 bp, 246 aa]
          Length = 246

 Score =  102 bits (255), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 115/240 (47%), Gaps = 22/240 (9%)

Query: 11  VNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKFAP--DY 68
           V+  LFD+DGTI+ +  A  + W+   +       E   H SHG R+ + + KF P  D 
Sbjct: 6   VDLCLFDLDGTIVSTTTAAESAWKKLCRQHGVDPVELFKH-SHGARSQEMMKKFFPKLDN 64

Query: 69  ADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCTDLN-------KLPKEKWAVATSGTRDMA 121
            D + V  LE ++ + Y +    +PGA  L   L+       KLP+ KWA+ TSG+  +A
Sbjct: 65  TDNKGVLALEKDMADNYLDTVSLIPGAENLLLSLDVDTETQKKLPERKWAIVTSGSPYLA 124

Query: 122 QKWFKFL--NIDRPEYFITANDVKQGKPFPEPYIKGREGLGYPINKEDPSKSKVVVFEDX 179
             WF+ +  N+ +P+ FIT  DVK GKP PE Y + R+ L   +        K VVFED 
Sbjct: 125 FSWFETILKNVGKPKVFITGFDVKNGKPDPEGYSRARDLLRQDLQLTGKQDLKYVVFEDA 184

Query: 180 XXXXXXXXXXXXXXXXXXTTFDVDFLKEKG-----CDI----IVKNHES-IRVGGYNPET 229
                             +++D   L + G     CD+    +VKN+E+ I +   NP T
Sbjct: 185 PVGIKAGKAMGAITVGITSSYDKSVLFDAGADYVVCDLTQVSVVKNNENGIVIQVNNPLT 244

>Scas_690.30
          Length = 259

 Score =  103 bits (256), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 74/226 (32%), Positives = 109/226 (48%), Gaps = 13/226 (5%)

Query: 8   SLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKFAP- 66
           S  V+  LFD+DGT++ +  A  A W D   +      E   H SHG +T + +A++ P 
Sbjct: 5   SFNVDVCLFDLDGTLVNTIKASEAVWTDLCNEHGVNPQELFKH-SHGVKTSEVLAEWFPM 63

Query: 67  -DYADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCTDLN-------KLPKEKWAVATSGTR 118
            D  D++ V  LE  +   +      VPGA+ L   L+       K   +KWA+ TSG+ 
Sbjct: 64  LDNTDDKAVKYLEESMGRDHLSSVFAVPGAIDLLKQLDIDTDTGKKFKDKKWAIVTSGST 123

Query: 119 DMAQKWFKFL--NIDRPEYFITANDVKQGKPFPEPYIKGREGLGYPINKEDPSKSKVVVF 176
            +A  WFK +   +++PE F+TA DVK GKP PE Y K R+ L    N  D   +K VVF
Sbjct: 124 YIAFGWFKSILSELEKPEVFVTAFDVKNGKPDPEGYSKARDELCKTWN-FDVKTAKSVVF 182

Query: 177 EDXXXXXXXXXXXXXXXXXXXTTFDVDFLKEKGCDIIVKNHESIRV 222
           ED                   +T+D   L + G D +V++   I +
Sbjct: 183 EDAPVGIQAGKAMGAITVGITSTYDKKVLFDAGADYVVRDLSQITI 228

>CAGL0M12925g 1274919..1275659 similar to sp|P38773 Saccharomyces
           cerevisiae YHR043c DOG2 2-deoxyglucose-6-phosphate
           phosphatase, hypothetical start
          Length = 246

 Score = 98.6 bits (244), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 69/223 (30%), Positives = 100/223 (44%), Gaps = 14/223 (6%)

Query: 11  VNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKFAPDY-- 68
           V+  LFD+DGTI+ +  A+   W+    +    D E +   SHG RT +  AKF PD   
Sbjct: 7   VDLCLFDLDGTIVSTTRAVEMTWKKLCAEHD-VDPEELFRFSHGTRTGEVFAKFFPDIDN 65

Query: 69  ADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCTDLNK-------LPKEKWAVATSGTRDMA 121
                    E  I +     S+ +PGA +L   L+K       + + KWA+ TSG+ ++ 
Sbjct: 66  TGNRAAVAFELSIADDLSLISL-IPGAQELLLKLDKNTTDGSAVGERKWAIVTSGSPELT 124

Query: 122 QKWFK--FLNIDRPEYFITANDVKQGKPFPEPYIKGREGLGYPINKEDPSKSKVVVFEDX 179
             WF      + RP  FI+  DV +GKP PE Y  GR  L   +   D S ++ VVFED 
Sbjct: 125 LSWFDNVLKEVGRPPVFISGADVAKGKPDPEGYYTGRNLLCQKLGL-DASHARTVVFEDA 183

Query: 180 XXXXXXXXXXXXXXXXXXTTFDVDFLKEKGCDIIVKNHESIRV 222
                              T+D D L   G D +V +   ++V
Sbjct: 184 PVGIMAGKAIGAITVGIAGTYDKDLLYSAGADYVVSDLNQVKV 226

>YHR044C (DOG1) [2332] chr8 complement(194060..194800)
           2-Deoxyglucose-6-phosphate phosphatase [741 bp, 246 aa]
          Length = 246

 Score = 98.2 bits (243), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 77/237 (32%), Positives = 111/237 (46%), Gaps = 22/237 (9%)

Query: 14  ALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKFAP--DYADE 71
            LFD+DGTI+ +  A    W     +     +E   H SHG RT + + +F P  D  D 
Sbjct: 9   CLFDLDGTIVSTTVAAEKAWTKLCYEYGVDPSELFKH-SHGARTQEVLRRFFPKLDDTDN 67

Query: 72  EYVNKLEGEIPEKYGEHSIEVPGAVKLCTDLN-------KLPKEKWAVATSGTRDMAQKW 124
           + V  LE +I   Y +    +PGA  L   L+       KLP+ KWA+ TSG+  +A  W
Sbjct: 68  KGVLALEKDIAHSYLDTVSLIPGAENLLLSLDVDTETQKKLPERKWAIVTSGSPYLAFSW 127

Query: 125 FKFL--NIDRPEYFITANDVKQGKPFPEPYIKGREGLGYPINKEDPSKSKVVVFEDXXXX 182
           F+ +  N+ +P+ FIT  DVK GKP PE Y + R+ L   +        K VVFED    
Sbjct: 128 FETILKNVGKPKVFITGFDVKNGKPDPEGYSRARDLLRQDLQLTGKQDLKYVVFEDAPVG 187

Query: 183 XXXXXXXXXXXXXXXTTFDVDFLKEKG-----CDI----IVKNHES-IRVGGYNPET 229
                          +++D   L + G     CD+    +VKN+E+ I +   NP T
Sbjct: 188 IKAGKAMGAITVGITSSYDKSVLFDAGADYVVCDLTQVSVVKNNENGIVIQVNNPLT 244

>KLLA0C11143g 956474..957280 similar to sp|P38773 Saccharomyces
           cerevisiae YHR043c DOG2 2-deoxyglucose-6-phosphate
           phosphatase, start by similarity
          Length = 268

 Score = 95.9 bits (237), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 71/232 (30%), Positives = 108/232 (46%), Gaps = 15/232 (6%)

Query: 8   SLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKFAP- 66
           S+ V+  LFD+DGT++ S  A    W     DK   D   +  +SHG RT + +AKF P 
Sbjct: 3   SIAVDYVLFDLDGTLVSSTDAAEEAWNKLC-DKYGVDYSTLSKVSHGSRTAEILAKFFPN 61

Query: 67  -DYADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCTDLNK---------LPKEKWAVATSG 116
            D  + + V + E  I   Y +    +PG++ L   L++             KWAV TSG
Sbjct: 62  VDNTNNQAVKEFELSIANDYMDIVCLIPGSIDLLISLDRPTGAHPGEVFHHRKWAVVTSG 121

Query: 117 TRDMAQKWFKFL--NIDRPEYFITANDVKQGKPFPEPYIKGREGLGYPINKEDPSKSKVV 174
           +  +A  WF  L  +I +PE FITA DV +GKP P  +    + L   I ++D  + + V
Sbjct: 122 SPWVAHAWFDNLLKSIKKPEVFITAFDVSKGKPDPAGFALATKRLK-EIWQDDRKEVRTV 180

Query: 175 VFEDXXXXXXXXXXXXXXXXXXXTTFDVDFLKEKGCDIIVKNHESIRVGGYN 226
           VFED                   +T+D + L   G D +V++   + +   N
Sbjct: 181 VFEDAPVGVQAGKANGSIVVALTSTYDKELLFAAGADYVVEDLSQVCLQSNN 232

>Scas_690.31
          Length = 244

 Score = 93.6 bits (231), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 72/227 (31%), Positives = 109/227 (48%), Gaps = 17/227 (7%)

Query: 8   SLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKFAP- 66
           +  V+  LFD+DGTI+ +  A+   W  F K K   +AE +   SHG R+ + +A+F P 
Sbjct: 3   TFTVDLCLFDLDGTIVSTTIAVERAWIKFCK-KHNVNAEELFEHSHGARSGEIMARFFPH 61

Query: 67  -DYADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCTDLNKLP-----KEKWAVATSGTRDM 120
            D  D +   +LE  +     +    +PG+ KL   L+K       K KWA+ TSG+  +
Sbjct: 62  VDNTDNKATKELELSMAYDNIDTVSLIPGSEKLLLALDKATTKDATKRKWAIVTSGSPYL 121

Query: 121 AQKWFKFL--NIDRPEYFITANDVKQGKPFPEPYIKGREGLGY---PINKEDPSKSKVVV 175
           A  WF  +  ++ +P+ FIT  DV++GKP PE Y K R+ L     P NK      + VV
Sbjct: 122 AFSWFDTILKDVGKPDVFITGFDVEKGKPDPEGYGKARDQLCKNWGPDNKH----VRTVV 177

Query: 176 FEDXXXXXXXXXXXXXXXXXXXTTFDVDFLKEKGCDIIVKNHESIRV 222
           FED                    T+D + L + G D +V +   + V
Sbjct: 178 FEDAPVGIKAGKAIGAITVGITFTYDKNLLFDAGADYVVADLTHVSV 224

>AAL123W [64] [Homologous to ScYHR043C (DOG2) - SH; ScYHR044C (DOG1)
           - SH] complement(131449..132318) [870 bp, 289 aa]
          Length = 289

 Score = 94.0 bits (232), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 68/240 (28%), Positives = 110/240 (45%), Gaps = 20/240 (8%)

Query: 9   LKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKFAPDY 68
           + V+  LFD+DGTI+ +  A+ A W+  G+     DA  +   SHG R  +   ++ PD 
Sbjct: 4   ITVDVCLFDLDGTIVDTTDAVEAAWQKVGR-AHQVDAAKIRRNSHGRRASETFKQYFPDA 62

Query: 69  ADEEYVNKLEGEIPEKYGEHSIE-VPGAVKLCTDLNK---------LPKEKWAVATSGTR 118
            ++  V + E  +  +   H +  +PGA  L   L++             +WA+ TS T 
Sbjct: 63  DNDAAVKEFEHALVSQ--SHYVGLIPGANDLLLTLDRPSGCNPGEVFRDNRWAIVTSATP 120

Query: 119 DMAQKWFKFL--NIDRPEYFITANDVKQGKPFPEPYIKGREGLG--YPINKEDPSKSKVV 174
            +A+ WF  L   +  P+ FIT+ DV +GKP PE Y K ++ L     +NK+   K + V
Sbjct: 121 SLARSWFNTLLKKVKPPKVFITSADVAKGKPDPEGYQKAKDQLADILGLNKD---KVRAV 177

Query: 175 VFEDXXXXXXXXXXXXXXXXXXXTTFDVDFLKEKGCDIIVKNHESIRVGGYNPETDEVEF 234
           VFED                   +T+  D L   G D +V++   + V    P+   +E 
Sbjct: 178 VFEDSALGIRAAKAMGAIAVGITSTYSKDVLYRSGADYVVEDLAQVCVMQNGPDGITLEI 237

>CAGL0A01386g 136693..140001 some similarities with sp|P08640
           Saccharomyces cerevisiae YIR019c STA1, hypothetical
           start
          Length = 1102

 Score = 33.5 bits (75), Expect = 0.19,   Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 17/29 (58%)

Query: 217 HESIRVGGYNPETDEVEFIFDDYLYAKDD 245
           H    VG Y P T+E+ + FD YLY  DD
Sbjct: 260 HSKFMVGFYPPNTEEITYDFDGYLYMLDD 288

>Kwal_55.21254
          Length = 853

 Score = 30.8 bits (68), Expect = 1.3,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 2/58 (3%)

Query: 64  FAPDYADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCTDLNKLPKEKWAVATSGTRDMA 121
           + P Y    Y   + G + + YG  +I+ PGA   C  +N   K K + ++S  R+M+
Sbjct: 558 YQPAYTPSAYPT-IAGPVSDYYGTAAIKAPGASAPCLKMNPFEK-KGSTSSSRNRNMS 613

>Kwal_55.20214
          Length = 1275

 Score = 29.3 bits (64), Expect = 3.2,   Method: Composition-based stats.
 Identities = 20/67 (29%), Positives = 30/67 (44%), Gaps = 3/67 (4%)

Query: 18  VDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKFAPDYADEEYVNKL 77
           +D +I+I  P    F   FG D  Y  A+ +I    G  +  +I KF  +  D  Y+  L
Sbjct: 926 IDDSIVIPAPLGTTFQLLFGNDTSY--AKQIIE-KQGNHSLSSIPKFRNNTRDFNYIKPL 982

Query: 78  EGEIPEK 84
            G +  K
Sbjct: 983 NGPVGPK 989

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.139    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,501,286
Number of extensions: 365534
Number of successful extensions: 841
Number of sequences better than 10.0: 27
Number of HSP's gapped: 803
Number of HSP's successfully gapped: 27
Length of query: 245
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 146
Effective length of database: 13,168,927
Effective search space: 1922663342
Effective search space used: 1922663342
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 60 (27.7 bits)