Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M12386g1421406238e-85
KLLA0C08349g1401404632e-60
YER057C (HMF1)1291044483e-58
Scas_715.531281044483e-58
Sklu_2193.31281264473e-58
YIL051C (MMF1)1451314484e-58
Scas_704.341481374485e-58
ADL077C1421404372e-56
Kwal_23.58041411284251e-54
Kwal_23.28071291051633e-15
Kwal_47.165901261001582e-14
Kwal_55.212471341031479e-13
CAGL0M04521g6881051471e-11
KLLA0B14817g1311011261e-09
Scas_506.36891041311e-09
KLLA0E03894g1371031076e-07
YLR143W685821116e-07
AGL164W6861041101e-06
KLLA0D16984g6961061055e-06
Kwal_27.1131068887993e-05
CAGL0H03993g47270613.0
YNR001C (CIT1)47967578.4
KLLA0F12760g48267579.2
YJL044C (GYP6)45866579.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M12386g
         (140 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M12386g 1234993..1235421 similar to sp|P40037 Saccharomyces...   244   8e-85
KLLA0C08349g 731629..732051 highly similar to sp|P40185 Saccharo...   182   2e-60
YER057C (HMF1) [1487] chr5 complement(270735..271124) Protein th...   177   3e-58
Scas_715.53                                                           177   3e-58
Sklu_2193.3 YIL051C, Contig c2193 5846-6232 reverse complement        176   3e-58
YIL051C (MMF1) [2616] chr9 complement(257842..258279) Protein im...   177   4e-58
Scas_704.34                                                           177   5e-58
ADL077C [1664] [Homologous to ScYIL051C (MMF1) - SH; ScYER057C (...   172   2e-56
Kwal_23.5804                                                          168   1e-54
Kwal_23.2807                                                           67   3e-15
Kwal_47.16590                                                          65   2e-14
Kwal_55.21247                                                          61   9e-13
CAGL0M04521g 496157..498223 similar to tr|Q12429 Saccharomyces c...    61   1e-11
KLLA0B14817g 1301705..1302100 similar to sp|Q8XCD0 Escherichia c...    53   1e-09
Scas_506.3                                                             55   1e-09
KLLA0E03894g complement(364475..364888) some similarities with s...    46   6e-07
YLR143W (YLR143W) [3552] chr12 (427330..429387) Protein containi...    47   6e-07
AGL164W [4148] [Homologous to ScYLR143W - SH] complement(388842....    47   1e-06
KLLA0D16984g 1439669..1441759 similar to sgd|S0004133 Saccharomy...    45   5e-06
Kwal_27.11310                                                          43   3e-05
CAGL0H03993g complement(372155..373573) highly similar to sp|P00...    28   3.0  
YNR001C (CIT1) [4585] chr14 complement(629621..631060) Citrate s...    27   8.4  
KLLA0F12760g 1177776..1179224 gi|28565058|gb|AAO32612.1 Kluyvero...    27   9.2  
YJL044C (GYP6) [2868] chr10 complement(358216..359592) GTPase-ac...    27   9.7  

>CAGL0M12386g 1234993..1235421 similar to sp|P40037 Saccharomyces
           cerevisiae YER057c HIG1 Heat-shock induceable Inhibiter
           of cell Growth, hypothetical start
          Length = 142

 Score =  244 bits (623), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 123/140 (87%), Positives = 123/140 (87%)

Query: 1   MFGLKARSLIMTRQLSKLTXXXXXXXXXXXXXXXXXMKVNNLIYVSGQIPYTKDNKPVEG 60
           MFGLKARSLIMTRQLSKLT                 MKVNNLIYVSGQIPYTKDNKPVEG
Sbjct: 1   MFGLKARSLIMTRQLSKLTPVISANAPPAAASYSHAMKVNNLIYVSGQIPYTKDNKPVEG 60

Query: 61  SISDKAEQVIQNVQNILKDSNSDLNRIVKVNIFLADMNNFAEFNKVYAKYFNVHKPARSC 120
           SISDKAEQVIQNVQNILKDSNSDLNRIVKVNIFLADMNNFAEFNKVYAKYFNVHKPARSC
Sbjct: 61  SISDKAEQVIQNVQNILKDSNSDLNRIVKVNIFLADMNNFAEFNKVYAKYFNVHKPARSC 120

Query: 121 VAVAALPLGVDLEMEVIATE 140
           VAVAALPLGVDLEMEVIATE
Sbjct: 121 VAVAALPLGVDLEMEVIATE 140

>KLLA0C08349g 731629..732051 highly similar to sp|P40185
           Saccharomyces cerevisiae YIL051c MMD1 required for
           maintenance of mitochondrial DNA, start by similarity
          Length = 140

 Score =  182 bits (463), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 92/140 (65%), Positives = 108/140 (77%), Gaps = 2/140 (1%)

Query: 1   MFGLKARSLIMTRQLSKLTXXXXXXXXXXXXXXXXXMKVNNLIYVSGQIPYTKDNKPVEG 60
           MF    +S +  R+++ LT                 +KVNNLI+VSGQIPYT +NKPVEG
Sbjct: 1   MFRQALKSTV--RRMNTLTPVKTQLAPPPAASYSQAIKVNNLIFVSGQIPYTAENKPVEG 58

Query: 61  SISDKAEQVIQNVQNILKDSNSDLNRIVKVNIFLADMNNFAEFNKVYAKYFNVHKPARSC 120
           SI+DKAEQVIQNV+NIL ++NSDL++IVKVNIFLAD+N+FAEFN VYAKYFNVHKPARSC
Sbjct: 59  SIADKAEQVIQNVKNILVEANSDLDKIVKVNIFLADINSFAEFNSVYAKYFNVHKPARSC 118

Query: 121 VAVAALPLGVDLEMEVIATE 140
           VA  ALPL VDLEMEVIA E
Sbjct: 119 VAAKALPLNVDLEMEVIAVE 138

>YER057C (HMF1) [1487] chr5 complement(270735..271124) Protein that
           inhibits cell growth and contributes to cell death at
           high temperature, member of the p14.5 family [390 bp,
           129 aa]
          Length = 129

 Score =  177 bits (448), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 83/104 (79%), Positives = 95/104 (91%)

Query: 37  MKVNNLIYVSGQIPYTKDNKPVEGSISDKAEQVIQNVQNILKDSNSDLNRIVKVNIFLAD 96
           MKVNNLI++SGQIP T DNK VEGSI+DKAEQVIQN++N+L+ SNS L+R+VKVNIFLAD
Sbjct: 24  MKVNNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQNIKNVLEASNSSLDRVVKVNIFLAD 83

Query: 97  MNNFAEFNKVYAKYFNVHKPARSCVAVAALPLGVDLEMEVIATE 140
           +N+FAEFN VYAKYFN HKPARSCVAVAALPLGVD+EME IA E
Sbjct: 84  INHFAEFNSVYAKYFNTHKPARSCVAVAALPLGVDMEMEAIAAE 127

>Scas_715.53
          Length = 128

 Score =  177 bits (448), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 83/104 (79%), Positives = 94/104 (90%)

Query: 37  MKVNNLIYVSGQIPYTKDNKPVEGSISDKAEQVIQNVQNILKDSNSDLNRIVKVNIFLAD 96
           MK NNLI++SGQIP T +NKPVEGSI+DKAEQVIQN++N+L+ SNS L +IVKVNIFLAD
Sbjct: 23  MKANNLIFLSGQIPMTAENKPVEGSIADKAEQVIQNIKNVLEASNSSLEKIVKVNIFLAD 82

Query: 97  MNNFAEFNKVYAKYFNVHKPARSCVAVAALPLGVDLEMEVIATE 140
           +N+FAEFN VYAKYFNVHKPARSCVAVAALPL  DLEMEVIA E
Sbjct: 83  INSFAEFNTVYAKYFNVHKPARSCVAVAALPLNADLEMEVIAVE 126

>Sklu_2193.3 YIL051C, Contig c2193 5846-6232 reverse complement
          Length = 128

 Score =  176 bits (447), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 101/126 (80%)

Query: 15  LSKLTXXXXXXXXXXXXXXXXXMKVNNLIYVSGQIPYTKDNKPVEGSISDKAEQVIQNVQ 74
           +S LT                 +KVNN+++VSGQIPYT +NKPVEGSI+DKAEQVIQNV+
Sbjct: 1   MSTLTPVRTQLAPPPAASYSQAIKVNNMVFVSGQIPYTHENKPVEGSIADKAEQVIQNVK 60

Query: 75  NILKDSNSDLNRIVKVNIFLADMNNFAEFNKVYAKYFNVHKPARSCVAVAALPLGVDLEM 134
           NIL+++NS LN+IVKVN+FLAD+N+FAEFN VYAKYFN HKPARSCVAV +LPL VDLEM
Sbjct: 61  NILEEANSSLNKIVKVNVFLADINDFAEFNGVYAKYFNEHKPARSCVAVKSLPLNVDLEM 120

Query: 135 EVIATE 140
           EVIA E
Sbjct: 121 EVIAVE 126

>YIL051C (MMF1) [2616] chr9 complement(257842..258279) Protein
           important for maintenance of mitochondrial DNA, may be
           involved in isoleucine-dependent transaminase activity,
           member of the p14.5 family [438 bp, 145 aa]
          Length = 145

 Score =  177 bits (448), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 98/131 (74%)

Query: 10  IMTRQLSKLTXXXXXXXXXXXXXXXXXMKVNNLIYVSGQIPYTKDNKPVEGSISDKAEQV 69
           ++ R ++ LT                 MK NN +YVSGQIPYT DNKPV+GSIS+KAEQV
Sbjct: 13  VLRRGITTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPDNKPVQGSISEKAEQV 72

Query: 70  IQNVQNILKDSNSDLNRIVKVNIFLADMNNFAEFNKVYAKYFNVHKPARSCVAVAALPLG 129
            QNV+NIL +SNS L+ IVKVN+FLADM NFAEFN VYAK+F+ HKPARSCV VA+LPL 
Sbjct: 73  FQNVKNILAESNSSLDNIVKVNVFLADMKNFAEFNSVYAKHFHTHKPARSCVGVASLPLN 132

Query: 130 VDLEMEVIATE 140
           VDLEMEVIA E
Sbjct: 133 VDLEMEVIAVE 143

>Scas_704.34
          Length = 148

 Score =  177 bits (448), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 87/137 (63%), Positives = 103/137 (75%), Gaps = 1/137 (0%)

Query: 4   LKARSLIMTRQLSKLTXXXXXXXXXXXXXXXXXMKVNNLIYVSGQIPYTKDNKPVEGSIS 63
           L++R  I+ R L+ LT                 MK NN +YVSGQIPYT +NKPVEG+IS
Sbjct: 8   LRSRQPIV-RSLTTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPENKPVEGTIS 66

Query: 64  DKAEQVIQNVQNILKDSNSDLNRIVKVNIFLADMNNFAEFNKVYAKYFNVHKPARSCVAV 123
           DKAEQV QN++NILK+S S +++IVKVN+FLAD+NNF EFN VYAKYFNVHKPARSCVAV
Sbjct: 67  DKAEQVFQNIKNILKESGSSMDKIVKVNVFLADINNFKEFNGVYAKYFNVHKPARSCVAV 126

Query: 124 AALPLGVDLEMEVIATE 140
             LPL VDLE+EVIA E
Sbjct: 127 KDLPLNVDLEVEVIAVE 143

>ADL077C [1664] [Homologous to ScYIL051C (MMF1) - SH; ScYER057C
           (HMF1) - SH] (549526..549954) [429 bp, 142 aa]
          Length = 142

 Score =  172 bits (437), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 82/140 (58%), Positives = 98/140 (70%)

Query: 1   MFGLKARSLIMTRQLSKLTXXXXXXXXXXXXXXXXXMKVNNLIYVSGQIPYTKDNKPVEG 60
           M  L   + ++ R +S LT                 M+ N +++VSGQIPYT DNKPVEG
Sbjct: 1   MRRLTQTATVLARSMSSLTPVRTTAAPPPAASYSQAMRANGMVFVSGQIPYTPDNKPVEG 60

Query: 61  SISDKAEQVIQNVQNILKDSNSDLNRIVKVNIFLADMNNFAEFNKVYAKYFNVHKPARSC 120
           S++DK EQVI NV+N+L+ SNS L+R+ KVN+FLADM  FAEFN VYAKYF  HKPARSC
Sbjct: 61  SVADKTEQVIANVRNVLEASNSGLDRVAKVNVFLADMAYFAEFNSVYAKYFGEHKPARSC 120

Query: 121 VAVAALPLGVDLEMEVIATE 140
           VAV ALPL VDLEMEVIA E
Sbjct: 121 VAVRALPLNVDLEMEVIALE 140

>Kwal_23.5804
          Length = 141

 Score =  168 bits (425), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 98/128 (76%)

Query: 13  RQLSKLTXXXXXXXXXXXXXXXXXMKVNNLIYVSGQIPYTKDNKPVEGSISDKAEQVIQN 72
           R +S LT                 M+VN +++VSGQIPYT +NK VEG+I+DKAEQVIQN
Sbjct: 12  RSMSTLTPVRTQLSPPPAASYSQAMRVNKMVFVSGQIPYTAENKRVEGTIADKAEQVIQN 71

Query: 73  VQNILKDSNSDLNRIVKVNIFLADMNNFAEFNKVYAKYFNVHKPARSCVAVAALPLGVDL 132
           V+NIL+++NS L++IVKVNIFLAD+ +FAEFN VY KYFN HKPARSCVAV ALPL VDL
Sbjct: 72  VRNILEEANSGLDKIVKVNIFLADIKDFAEFNGVYGKYFNEHKPARSCVAVKALPLDVDL 131

Query: 133 EMEVIATE 140
           EMEV+A E
Sbjct: 132 EMEVVAVE 139

>Kwal_23.2807
          Length = 129

 Score = 67.4 bits (163), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 64/105 (60%), Gaps = 9/105 (8%)

Query: 38  KVNNLIYVSGQIPYTKDNKPVEGSISDKAEQVI----QNVQNILKDSNSDLNRIVKVNIF 93
           K N+L++ SG +       PV G++ +  EQ I    +N++N+L  S S L R++KV +F
Sbjct: 27  KSNDLVFTSGCV----GTDPVTGNLPEDLEQQIINALENLKNVLHASGSSLERVLKVLLF 82

Query: 94  LADMNNFAEFNKVYAKYFNVHKPARSCVAVAALPLGVDLEMEVIA 138
           ++D +  +  N+VY++YF  + PARSC+ VA     + +E+E IA
Sbjct: 83  VSDASYASTVNEVYSRYFP-NAPARSCIVVAFPAPALKVELECIA 126

>Kwal_47.16590
          Length = 126

 Score = 65.5 bits (158), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 53/100 (53%), Gaps = 1/100 (1%)

Query: 40  NNLIYVSGQIPYTKDNKPVEGSISDKAEQVIQNVQNILKDSNSDLNRIVKVNIFLADMNN 99
           N  ++ SG I        V   I D+    I+N++ +L    S L+++ KV +F++  + 
Sbjct: 26  NGHVFTSGIIGANYGTGEVPHEIEDQVHLAIKNLETVLVAGGSSLSKVFKVTMFISHADY 85

Query: 100 FAEFNKVYAKYFNVHKPARSCVAVAALPLGVDLEMEVIAT 139
               N++Y  YF  HKPARSCV VA +   +  E+E IAT
Sbjct: 86  SKVVNEIYGHYFP-HKPARSCVVVAFMDAAIKYELEAIAT 124

>Kwal_55.21247
          Length = 134

 Score = 61.2 bits (147), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 60/103 (58%), Gaps = 9/103 (8%)

Query: 40  NNLIYVSGQIPYTKDNKPVEGSISDKAEQ----VIQNVQNILKDSNSDLNRIVKVNIFLA 95
           ++L++ SG +       PV G +    EQ     ++N++N+L+ S S L +++KV +F++
Sbjct: 28  SDLVFTSGCV----GTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVS 83

Query: 96  DMNNFAEFNKVYAKYFNVHKPARSCVAVAALPLGVDLEMEVIA 138
           D +     NKVY++YF    PARSC+ V+     + +E+E IA
Sbjct: 84  DGSYAPAVNKVYSEYFP-GAPARSCIVVSFPNASLKVELECIA 125

>CAGL0M04521g 496157..498223 similar to tr|Q12429 Saccharomyces
           cerevisiae YLR143w, hypothetical start
          Length = 688

 Score = 61.2 bits (147), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 61/105 (58%), Gaps = 10/105 (9%)

Query: 38  KVNNLIYVSGQIPYTKDNKPVEGSISDKAEQVIQNVQNILKDSNSDLNRIVKVNIFLADM 97
           ++ NL+Y+S   P  KD     G++ ++ + V+Q + NILKD++     ++  ++ L DM
Sbjct: 318 RIGNLLYISNIQPQYKD-----GTVQEQVKDVLQQLDNILKDNHLTAKNVLYSSLLLTDM 372

Query: 98  NNFAEFNKVYAKYFNVHK-----PARSCVAVAALPLGVDLEMEVI 137
           + FA  N+ Y+K+F++ K     PAR+C+    +  G  L++ V+
Sbjct: 373 SLFASVNQEYSKFFDIWKNGPLPPARACIESNIINDGSALQLSVV 417

>KLLA0B14817g 1301705..1302100 similar to sp|Q8XCD0 Escherichia coli
           O157:H7 Orf, hypothetical protein, start by similarity
          Length = 131

 Score = 53.1 bits (126), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 53/101 (52%), Gaps = 1/101 (0%)

Query: 38  KVNNLIYVSGQIPYTKDNKPVEGSISDKAEQVIQNVQNILKDSNSDLNRIVKVNIFLADM 97
           K   L+Y SG +        +   +  +    + N+  +LK SNS  + ++K+ +F+AD 
Sbjct: 27  KDTELVYTSGCVGSDLLTGEIPEDLEKQVRNALDNLGRVLKASNSSFDDVLKILLFVADG 86

Query: 98  NNFAEFNKVYAKYFNVHKPARSCVAVAALPLGVDLEMEVIA 138
           +  +  N VY +YF   +PARSC+ V+     + +E+E +A
Sbjct: 87  SYASTVNAVYKEYFP-ERPARSCIVVSFPDPTLKVELECVA 126

>Scas_506.3
          Length = 689

 Score = 55.1 bits (131), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 62/104 (59%), Gaps = 11/104 (10%)

Query: 38  KVNNLIYVSGQIPYTKDNKPVEGSISDKAEQVIQNVQNILKDSNSDLNRIVKVNIFLADM 97
           KV NL+Y+S   P     K  E ++  +A+QV Q +  I+K+++   ++I+  ++ LA+M
Sbjct: 319 KVGNLLYISNLCP-----KDSELNVEQQAKQVFQQLDKIMKENSLFPSQILFSSLILANM 373

Query: 98  NNFAEFNKVYAKYFNVHK-----PARSCVAVAALPLGVDLEMEV 136
           +NFA  N+VY  +F ++K     P+R+CV  + L   V L++ V
Sbjct: 374 SNFATVNQVYNDFFRINKWGPLPPSRACVG-SVLSNNVQLQLSV 416

>KLLA0E03894g complement(364475..364888) some similarities with
           sp|Q87LF6 Vibrio parahaemolyticus Conserved hypothetical
           protein, hypothetical start
          Length = 137

 Score = 45.8 bits (107), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 58/103 (56%), Gaps = 9/103 (8%)

Query: 40  NNLIYVSGQIPYTKDNKPVEGSISDKAEQVIQN----VQNILKDSNSDLNRIVKVNIFLA 95
           N L++ SG +       PV   + +  EQ  +N    ++ +L+ S S ++ ++K+ +F++
Sbjct: 29  NQLLFSSGCV----GTDPVTNELPEDLEQQARNSMINLKKVLEVSGSSVDSVLKILLFVS 84

Query: 96  DMNNFAEFNKVYAKYFNVHKPARSCVAVAALPLGVDLEMEVIA 138
           D +     NKV+ ++F  ++PARSC+ VA     + +E+E IA
Sbjct: 85  DGSYAGIVNKVFKEFFP-NQPARSCIVVAFPNNKLKVELECIA 126

>YLR143W (YLR143W) [3552] chr12 (427330..429387) Protein containing
           an endoribonuclease L-PSP domain and a DUF71 domain of
           unknown function, has moderate similarity to
           uncharacterized C. albicans Orf6.3850p [2058 bp, 685 aa]
          Length = 685

 Score = 47.4 bits (111), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 45/82 (54%), Gaps = 5/82 (6%)

Query: 61  SISDKAEQVIQNVQNILKDSNSDLNRIVKVNIFLADMNNFAEFNKVYAKYFNVHK----- 115
           ++  ++E +   + +IL  +    N I+  ++ + DM+NF + NK+Y ++ ++ K     
Sbjct: 334 TVEKQSEDIFTELADILHSNQIPRNHILSASLLIRDMSNFGKINKIYNEFLDLSKYGPLP 393

Query: 116 PARSCVAVAALPLGVDLEMEVI 137
           P+R+CV    LP    +++ V+
Sbjct: 394 PSRACVGSKCLPEDCHVQLSVV 415

>AGL164W [4148] [Homologous to ScYLR143W - SH]
           complement(388842..390902) [2061 bp, 686 aa]
          Length = 686

 Score = 47.0 bits (110), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 28/104 (26%), Positives = 48/104 (46%), Gaps = 11/104 (10%)

Query: 39  VNNLIYVSGQIPYTKDNKPVEGSISDKAEQVIQNVQNILKDSNSDLNRIVKVNIFLADMN 98
           V  L+YVS   P  +      G +  +A  V   +   L        +++   + LADM 
Sbjct: 312 VGGLLYVSNIQPRCR------GPLEKQARDVFDQLNESLTRHGVVKAQVLSSVLLLADMG 365

Query: 99  NFAEFNKVYAKYFNVHK-----PARSCVAVAALPLGVDLEMEVI 137
            FAE N  Y  YF++ +     P+R+C+   +L  G+ L++ V+
Sbjct: 366 TFAEINTAYNGYFSIQEIGPLPPSRACIESKSLAPGIGLQLSVV 409

>KLLA0D16984g 1439669..1441759 similar to sgd|S0004133 Saccharomyces
           cerevisiae YLR143w, start by similarity
          Length = 696

 Score = 45.1 bits (105), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 55/106 (51%), Gaps = 12/106 (11%)

Query: 47  GQIPYTKDNKPVEG-SISDKAEQVIQNVQNILKDSNSDLNRIVKVNIFLADMNNFAEFNK 105
           G++ Y  +  P +G S+ +K   V   + +IL   +    +I+  ++ L+DMNNF E N 
Sbjct: 322 GKLLYISNIAPSKGESLKEKCLDVFSQLTSILSSRSIFACQILSSSLLLSDMNNFQEVNS 381

Query: 106 VYAKYFNVHK-----PARSCVAVA------ALPLGVDLEMEVIATE 140
            Y +YFNV K     PAR+CV  +       L + VDL  + + T+
Sbjct: 382 YYNEYFNVTKIGPLPPARACVESSFLKHPVQLSVVVDLSADCVPTD 427

>Kwal_27.11310
          Length = 688

 Score = 42.7 bits (99), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 26/87 (29%), Positives = 48/87 (55%), Gaps = 6/87 (6%)

Query: 57  PVEGSISD-KAEQVIQNVQNILKDSNSDLNRIVKVNIFLADMNNFAEFNKVYAKYFNVHK 115
           P  GS  D K + V + + +IL+D      +I+   + LADM +F++ N+ Y ++F+V +
Sbjct: 326 PKGGSSPDEKVQDVFRQLSDILRDYELSPAQILSSLVLLADMGDFSKVNEHYNEFFHVAR 385

Query: 116 -----PARSCVAVAALPLGVDLEMEVI 137
                P+R+CV  + +     L++ VI
Sbjct: 386 NGPLPPSRACVGSSLVGSENILQLSVI 412

>CAGL0H03993g complement(372155..373573) highly similar to sp|P00890
           Saccharomyces cerevisiae YNR001c CIT1, start by
           similarity
          Length = 472

 Score = 28.1 bits (61), Expect = 3.0,   Method: Composition-based stats.
 Identities = 15/70 (21%), Positives = 37/70 (52%), Gaps = 1/70 (1%)

Query: 43  IYVSGQIPYTKDNKPVEGSISDKAEQVIQNVQNILKDSNSDLNRIVKVNIFLADMNNFAE 102
           + ++G++P     K     ++ ++E V ++V  +L     DL+ + +++I +  +   ++
Sbjct: 127 LLLTGEVPTESQVKAFSADLASRSE-VPEHVLKLLDSLPKDLHPMAQLSIAVNALETESK 185

Query: 103 FNKVYAKYFN 112
           F K YA+  N
Sbjct: 186 FAKAYARGVN 195

>YNR001C (CIT1) [4585] chr14 complement(629621..631060) Citrate
           synthase, mitochondrial, converts acetyl-CoA and
           oxaloacetate into citrate plus CoA [1440 bp, 479 aa]
          Length = 479

 Score = 26.6 bits (57), Expect = 8.4,   Method: Composition-based stats.
 Identities = 14/67 (20%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 43  IYVSGQIPYTKDNKPVEGSISDKAEQVIQNVQNILKDSNSDLNRIVKVNIFLADMNNFAE 102
           + ++G+IP     K +   ++ ++E + ++V  +L     DL+ + + +I +  + + ++
Sbjct: 134 LLLTGEIPTDAQVKALSADLAARSE-IPEHVIQLLDSLPKDLHPMAQFSIAVTALESESK 192

Query: 103 FNKVYAK 109
           F K YA+
Sbjct: 193 FAKAYAQ 199

>KLLA0F12760g 1177776..1179224 gi|28565058|gb|AAO32612.1
           Kluyveromyces lactis CIT1, start by similarity
          Length = 482

 Score = 26.6 bits (57), Expect = 9.2,   Method: Composition-based stats.
 Identities = 12/67 (17%), Positives = 39/67 (58%), Gaps = 1/67 (1%)

Query: 43  IYVSGQIPYTKDNKPVEGSISDKAEQVIQNVQNILKDSNSDLNRIVKVNIFLADMNNFAE 102
           + ++G++P     K +   ++ ++E +  +V+++L +   DL+ + + ++ +  + + ++
Sbjct: 137 LLLTGEVPTETQVKALSADLASRSE-LPAHVESLLDNLPKDLHPMAQFSMAVTALESESK 195

Query: 103 FNKVYAK 109
           F K YA+
Sbjct: 196 FAKAYAQ 202

>YJL044C (GYP6) [2868] chr10 complement(358216..359592)
           GTPase-activating protein for Ypt6p [1377 bp, 458 aa]
          Length = 458

 Score = 26.6 bits (57), Expect = 9.7,   Method: Composition-based stats.
 Identities = 16/66 (24%), Positives = 35/66 (53%), Gaps = 1/66 (1%)

Query: 50  PYTKDNKPVEGSISDKAEQVIQNVQNILKDSNSDLNRIVKVNIFLADMNNFAEFNKVYAK 109
           P + DN   +GS+S  +++    ++  L+  + DL+RI+  +IF  +    A+  ++   
Sbjct: 119 PLSDDNDKTKGSLSKGSDEKPLTLRETLEIIDLDLSRIMLDDIF-QEPKVHAQMRQLLYN 177

Query: 110 YFNVHK 115
           Y  +H+
Sbjct: 178 YLLIHQ 183

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.133    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,737,144
Number of extensions: 143612
Number of successful extensions: 554
Number of sequences better than 10.0: 32
Number of HSP's gapped: 547
Number of HSP's successfully gapped: 32
Length of query: 140
Length of database: 16,596,109
Length adjustment: 91
Effective length of query: 49
Effective length of database: 13,445,871
Effective search space: 658847679
Effective search space used: 658847679
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 56 (26.2 bits)