Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M12364g78774112e-54
CAGL0H02893g86724562.8
KLLA0B13233g57826563.2
YMR129W (POM152)133740553.5
Kwal_23.630555134529.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M12364g
         (77 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M12364g complement(1234514..1234750) no similarity, possibl...   162   2e-54
CAGL0H02893g complement(266139..268742) similar to sp|P40361 Sac...    26   2.8  
KLLA0B13233g complement(1159097..1160833) highly similar to sp|P...    26   3.2  
YMR129W (POM152) [4086] chr13 (527803..531816) Nuclear pore memb...    26   3.5  
Kwal_23.6305                                                           25   9.5  

>CAGL0M12364g complement(1234514..1234750) no similarity, possibly
          noncoding, hypothetical start
          Length = 78

 Score =  162 bits (411), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 77/77 (100%), Positives = 77/77 (100%)

Query: 1  MQEEFCKNKNQGHFWEVLVVGGKWNCISTVVISQIGYYEIGELLHSKRSKNNNHQHREIT 60
          MQEEFCKNKNQGHFWEVLVVGGKWNCISTVVISQIGYYEIGELLHSKRSKNNNHQHREIT
Sbjct: 1  MQEEFCKNKNQGHFWEVLVVGGKWNCISTVVISQIGYYEIGELLHSKRSKNNNHQHREIT 60

Query: 61 TICSFDTVSMRYLPGKT 77
          TICSFDTVSMRYLPGKT
Sbjct: 61 TICSFDTVSMRYLPGKT 77

>CAGL0H02893g complement(266139..268742) similar to sp|P40361
           Saccharomyces cerevisiae YJL070c, start by similarity
          Length = 867

 Score = 26.2 bits (56), Expect = 2.8,   Method: Composition-based stats.
 Identities = 12/24 (50%), Positives = 13/24 (54%)

Query: 45  HSKRSKNNNHQHREITTICSFDTV 68
           H+  S NN   H  IT ICS D V
Sbjct: 544 HTNNSDNNPDFHYFITNICSLDLV 567

>KLLA0B13233g complement(1159097..1160833) highly similar to
           sp|P50276 Saccharomyces cerevisiae YGR055w MUP1 high
           affinity methionine permease, start by similarity
          Length = 578

 Score = 26.2 bits (56), Expect = 3.2,   Method: Composition-based stats.
 Identities = 10/26 (38%), Positives = 16/26 (61%)

Query: 15  WEVLVVGGKWNCISTVVISQIGYYEI 40
           W +  VGG +  +  VV+ +IG YE+
Sbjct: 499 WGIFAVGGIYWVVWAVVLPKIGKYEL 524

>YMR129W (POM152) [4086] chr13 (527803..531816) Nuclear pore
           membrane glycoprotein, a type II integral membrane
           protein with N-terminal region on pore side and
           C-terminal region in the cisternae [4014 bp, 1337 aa]
          Length = 1337

 Score = 25.8 bits (55), Expect = 3.5,   Method: Composition-based stats.
 Identities = 10/40 (25%), Positives = 21/40 (52%)

Query: 30  VVISQIGYYEIGELLHSKRSKNNNHQHREITTICSFDTVS 69
           V +  IG+Y+I +++ SK+     HQ   +   C   +++
Sbjct: 345 VTLQDIGFYQIKKIVDSKKLNLKIHQSHLVVPYCPIASIT 384

>Kwal_23.6305
          Length = 551

 Score = 24.6 bits (52), Expect = 9.5,   Method: Composition-based stats.
 Identities = 11/34 (32%), Positives = 19/34 (55%)

Query: 40  IGELLHSKRSKNNNHQHREITTICSFDTVSMRYL 73
           I ++   K+ +  NH HR + T+ + D  + RYL
Sbjct: 418 ISDMPKDKQFEMLNHAHRSVETMINDDPENFRYL 451

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.134    0.427 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,775,968
Number of extensions: 89555
Number of successful extensions: 241
Number of sequences better than 10.0: 7
Number of HSP's gapped: 241
Number of HSP's successfully gapped: 7
Length of query: 77
Length of database: 16,596,109
Length adjustment: 49
Effective length of query: 28
Effective length of database: 14,899,827
Effective search space: 417195156
Effective search space used: 417195156
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)