Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M12342g45745020240.0
Scas_704.354482107654e-97
YER059W (PCL6)4202557034e-88
Kwal_23.58074652146882e-85
ADL075W2072086643e-85
YIL050W (PCL7)2852086383e-80
KLLA0C08305g4092226432e-79
Scas_715.513412185171e-61
KLLA0D01287g3451261769e-14
ACR001C3461381751e-13
Kwal_56.224432801431661e-12
Sklu_2373.43071291652e-12
CAGL0E02541g3421191625e-12
Scas_392.13031321527e-11
YOL001W (PHO80)2931191431e-09
Scas_720.474731281262e-07
YPL219W (PCL8)4921551253e-07
CAGL0E05918g4811561235e-07
YGL134W (PCL10)4331281211e-06
Kwal_56.24151480581182e-06
AFL115W3861201155e-06
Scas_706.34511101121e-05
KLLA0B02024g5271161075e-05
CAGL0H08998g5471341059e-05
YNL289W (PCL1)279125810.051
Kwal_34.1599623161740.33
CAGL0L11946g214088721.1
Sklu_2426.923365701.1
KLLA0D04994g142860683.3
Scas_524.544535664.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M12342g
         (450 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M12342g complement(1232642..1234015) weakly similar to sp|P...   784   0.0  
Scas_704.35                                                           299   4e-97
YER059W (PCL6) [1489] chr5 (272622..273884) Cyclin that associat...   275   4e-88
Kwal_23.5807                                                          269   2e-85
ADL075W [1666] [Homologous to ScYIL050W (PCL7) - SH; ScYER059W (...   260   3e-85
YIL050W (PCL7) [2617] chr9 (258912..259769) Cyclin, associates w...   250   3e-80
KLLA0C08305g complement(728996..730225) some similarities with s...   252   2e-79
Scas_715.51                                                           203   1e-61
KLLA0D01287g 112866..113903 some similarities with sp|P20052 Sac...    72   9e-14
ACR001C [1049] [Homologous to ScYOL001W (PHO80) - SH] (357962..3...    72   1e-13
Kwal_56.22443                                                          69   1e-12
Sklu_2373.4 YOL001W, Contig c2373 11960-12883                          68   2e-12
CAGL0E02541g 244577..245605 similar to sp|P20052 Saccharomyces c...    67   5e-12
Scas_392.1                                                             63   7e-11
YOL001W (PHO80) [4815] chr15 (325249..326130) Cyclin that intera...    60   1e-09
Scas_720.47                                                            53   2e-07
YPL219W (PCL8) [5230] chr16 (136749..138227) Cyclin that associa...    53   3e-07
CAGL0E05918g complement(585723..587168) some similarities with t...    52   5e-07
YGL134W (PCL10) [1853] chr7 (255666..256967) Cyclin that associa...    51   1e-06
Kwal_56.24151                                                          50   2e-06
AFL115W [3080] [Homologous to ScYPL219W (PCL8) - SH; ScYGL134W (...    49   5e-06
Scas_706.3                                                             48   1e-05
KLLA0B02024g 176585..178168 some similarities with sp|P53124 Sac...    46   5e-05
CAGL0H08998g 877952..879595 weakly similar to tr|Q08966 Saccharo...    45   9e-05
YNL289W (PCL1) [4322] chr14 (87895..88734) G1/S-specific cyclin ...    36   0.051
Kwal_34.15996                                                          33   0.33 
CAGL0L11946g complement(1279970..1286392) similar to sp|P32639 S...    32   1.1  
Sklu_2426.9 YHR071W, Contig c2426 11461-12162                          32   1.1  
KLLA0D04994g 427195..431481 similar to sp|P25558 Saccharomyces c...    31   3.3  
Scas_524.5                                                             30   4.5  

>CAGL0M12342g complement(1232642..1234015) weakly similar to
           sp|P40038 Saccharomyces cerevisiae YER059w PCL6 cyclin
           like protein interacting with PHO85P, hypothetical start
          Length = 457

 Score =  784 bits (2024), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/450 (86%), Positives = 391/450 (86%)

Query: 1   MSSADPRLGMSYSSGDNXXXXXXXXXXXRSGRTVVNNNASSSTIASYPRTTPSVATTGSG 60
           MSSADPRLGMSYSSGDN           RSGRTVVNNNASSSTIASYPRTTPSVATTGSG
Sbjct: 1   MSSADPRLGMSYSSGDNTSSTPISIPIPRSGRTVVNNNASSSTIASYPRTTPSVATTGSG 60

Query: 61  YLPMGTSVTTEETLASSQSSHSPFRDNTLLQTNSIASNTNTSHLISSNDTVSSTVEVLQS 120
           YLPMGTSVTTEETLASSQSSHSPFRDNTLLQTNSIASNTNTSHLISSNDTVSSTVEVLQS
Sbjct: 61  YLPMGTSVTTEETLASSQSSHSPFRDNTLLQTNSIASNTNTSHLISSNDTVSSTVEVLQS 120

Query: 121 PTNPADEMASLRESIARPAYDHTTRDETILGTTERDEPRVSFAHDENLTRRDHYPGHESA 180
           PTNPADEMASLRESIARPAYDHTTRDETILGTTERDEPRVSFAHDENLTRRDHYPGHESA
Sbjct: 121 PTNPADEMASLRESIARPAYDHTTRDETILGTTERDEPRVSFAHDENLTRRDHYPGHESA 180

Query: 181 XXXXXXXXXXXXXXXXXXXXXXXXHEEQLKFIRSHYRTKLNAKSXXXXXXXXXXXLNIAE 240
                                   HEEQLKFIRSHYRTKLNAKS           LNIAE
Sbjct: 181 TENDNDTCTINNDDDNDDADMLTNHEEQLKFIRSHYRTKLNAKSETEEIEEVEEELNIAE 240

Query: 241 FPTDKLLEMLTALLNKIIKSNDQMEPYXXXXXXXXXXXXXSLTDSKLMSVKGTDKEKYLK 300
           FPTDKLLEMLTALLNKIIKSNDQMEPY             SLTDSKLMSVKGTDKEKYLK
Sbjct: 241 FPTDKLLEMLTALLNKIIKSNDQMEPYKDKDKDEDHDDDESLTDSKLMSVKGTDKEKYLK 300

Query: 301 SILSFKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESADTSPA 360
           SILSFKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESADTSPA
Sbjct: 301 SILSFKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESADTSPA 360

Query: 361 DQLFVMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFLVLCDF 420
           DQLFVMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFLVLCDF
Sbjct: 361 DQLFVMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFLVLCDF 420

Query: 421 ELLISVDKLQRYANLLLRFWNNQGVDDSRS 450
           ELLISVDKLQRYANLLLRFWNNQGVDDSRS
Sbjct: 421 ELLISVDKLQRYANLLLRFWNNQGVDDSRS 450

>Scas_704.35
          Length = 448

 Score =  299 bits (765), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 169/210 (80%), Gaps = 13/210 (6%)

Query: 236 LNIAEFPTDKLLEMLTALLNKIIKSNDQMEPYXXXXXXXXXXXXXSLTDSKLMSVKGTDK 295
           +NIAEFPT+KLLEMLTALL+KI+KSND++                S+ D  ++  +    
Sbjct: 224 INIAEFPTNKLLEMLTALLDKIVKSNDKLN--------VSSSNSESIDD--ILRSEDNSN 273

Query: 296 EKYLKSILSFKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESA 355
             Y+ SIL+F+GKHVPQI+L+QYFQRIQKYCPTTNDVFLSLLVYFDRISK+CN+S +   
Sbjct: 274 NAYVGSILAFRGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQG 333

Query: 356 DTSPAD--QLFVMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQ 413
           D SP +  QLFVMDSYNIHRL+IAGVTVCTKFFSDFFYSNSRYARVGG+SL ELNHLELQ
Sbjct: 334 D-SPTNKSQLFVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQ 392

Query: 414 FLVLCDFELLISVDKLQRYANLLLRFWNNQ 443
           FLVLCDFEL+I  ++LQRYA+LL RFW+ Q
Sbjct: 393 FLVLCDFELMIPTEELQRYADLLSRFWSTQ 422

>YER059W (PCL6) [1489] chr5 (272622..273884) Cyclin that associates
           with the Pho85p cyclin-dependent kinase, involved in
           utilization of alternative carbon and nitrogen sources
           [1263 bp, 420 aa]
          Length = 420

 Score =  275 bits (703), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 144/255 (56%), Positives = 166/255 (65%), Gaps = 56/255 (21%)

Query: 236 LNIAEFPTDKLLEMLTALLNKIIKSNDQMEPYXXXXXXXXXXXXXSLTDSKLMSVKGTDK 295
           LNIAEFPTDKLL+MLTALL KIIKSND+                  + + + +++   +K
Sbjct: 162 LNIAEFPTDKLLKMLTALLTKIIKSNDR-------TAATNPSLTQEIENGRCLALSDNEK 214

Query: 296 EKYLKSILSFKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNS------ 349
            KYL  +L F+GKHVPQI L QYFQRIQKYCPTTNDVFLSLLVYFDRISK+CNS      
Sbjct: 215 -KYLSPVLGFRGKHVPQIGLDQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSVTTTPK 273

Query: 350 ---------------------SDSESA---------------------DTSPADQLFVMD 367
                                +D  SA                     D+    Q+FVMD
Sbjct: 274 TNTAKHESPSNESSLDKANRGADKMSACNSNENNENDDSDDENTGVQRDSRAHPQMFVMD 333

Query: 368 SYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFLVLCDFELLISVD 427
           S+NIHRL+IAG+TV TKF SDFFYSNSRY+RVGGISL ELNHLELQFLVLCDFELLISV+
Sbjct: 334 SHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELLISVN 393

Query: 428 KLQRYANLLLRFWNN 442
           +LQRYA+LL RFWNN
Sbjct: 394 ELQRYADLLYRFWNN 408

>Kwal_23.5807
          Length = 465

 Score =  269 bits (688), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 133/214 (62%), Positives = 154/214 (71%), Gaps = 21/214 (9%)

Query: 236 LNIAEFPTDKLLEMLTALLNKIIKSNDQM---EPYXXXXXXXXXXXXXSLTDSKLMSVKG 292
           + IA FPTD+LL MLTALL+KI+KSNDQ+    P+              L  ++      
Sbjct: 261 IQIATFPTDRLLSMLTALLDKIVKSNDQLNRDRPFDEDQF---------LASARTEDADN 311

Query: 293 TDKEKYLKSILSFKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDS 352
             +      ILSF+GKHVP ITL QYFQRIQKYCPTTNDVFLSLLVYFDRI+K CN    
Sbjct: 312 DTRPNIASEILSFRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHG-- 369

Query: 353 ESADTSPADQLFVMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLEL 412
                   +QLFVMDSYNIHRL+I+ VTV TKFFSDFFYSNSRYARVGGISL ELNHLEL
Sbjct: 370 -------KEQLFVMDSYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLEL 422

Query: 413 QFLVLCDFELLISVDKLQRYANLLLRFWNNQGVD 446
           QFLVLCDFEL+ISV++LQ+Y++LL  FWN +  D
Sbjct: 423 QFLVLCDFELIISVEELQKYSDLLRDFWNREVGD 456

>ADL075W [1666] [Homologous to ScYIL050W (PCL7) - SH; ScYER059W
           (PCL6) - SH] complement(550944..551567) [624 bp, 207 aa]
          Length = 207

 Score =  260 bits (664), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 128/208 (61%), Positives = 152/208 (73%), Gaps = 29/208 (13%)

Query: 236 LNIAEFPTDKLLEMLTALLNKIIKSNDQMEPYXXXXXXXXXXXXXSLTDSKLMSVKGTDK 295
           ++IA+FPTDKLLEMLT LL KIIKSND+++P+                       K    
Sbjct: 16  MDIAQFPTDKLLEMLTGLLYKIIKSNDRLKPFDQE--------------------KHDIN 55

Query: 296 EKYLKSILSFKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESA 355
            KY+  +LSF+GKH+P ITL  YF RIQKYCP TNDVFLSLLVYFDRI+K+CN+ D    
Sbjct: 56  NKYVAHVLSFRGKHIPTITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNALDP--- 112

Query: 356 DTSPADQLFVMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFL 415
                 QLFVMDSYNIHRL+IA VTV TKFFSDFFYSNSRYARVGGISL ELN LELQF 
Sbjct: 113 ------QLFVMDSYNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQFS 166

Query: 416 VLCDFELLISVDKLQRYANLLLRFWNNQ 443
           +LCDFEL++S+ +LQRYA+LL +FW+ +
Sbjct: 167 ILCDFELIVSIQELQRYADLLYKFWHRE 194

>YIL050W (PCL7) [2617] chr9 (258912..259769) Cyclin, associates with
           the Pho85p cyclin-dependent kinase, involved in
           utilization of alternate carbon sources [858 bp, 285 aa]
          Length = 285

 Score =  250 bits (638), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 123/208 (59%), Positives = 152/208 (73%), Gaps = 22/208 (10%)

Query: 236 LNIAEFPTDKLLEMLTALLNKIIKSNDQMEPYXXXXXXXXXXXXXSLTDSKLMSVKGTDK 295
           LNIA+FPTD+L+ M++ALLN+II +ND+                   T      V    +
Sbjct: 100 LNIADFPTDELILMISALLNRIITANDE-------------------TTDVSQQVSDETE 140

Query: 296 EKYLKSILSFKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESA 355
           ++ L  IL+F GK+VP+I + QY +RIQKYCPTTND+FLSLLVYFDRISK    S   S 
Sbjct: 141 DELLTPILAFYGKNVPEIAVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGHS---SE 197

Query: 356 DTSPADQLFVMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFL 415
               A QLFVMDS NIHRL+I GVT+CTKF SDFFYSNSRYA+VGGISL ELNHLELQFL
Sbjct: 198 RNGCAKQLFVMDSGNIHRLLITGVTICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFL 257

Query: 416 VLCDFELLISVDKLQRYANLLLRFWNNQ 443
           +LCDF+LL+SV+++Q+YANLL +FWN+Q
Sbjct: 258 ILCDFKLLVSVEEMQKYANLLYKFWNDQ 285

>KLLA0C08305g complement(728996..730225) some similarities with
           sp|P40038 Saccharomyces cerevisiae YER059w PCL6 cyclin
           like protein interacting with PHO85P, hypothetical start
          Length = 409

 Score =  252 bits (643), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 129/222 (58%), Positives = 153/222 (68%), Gaps = 32/222 (14%)

Query: 236 LNIAEFPTDKLLEMLTALLNKIIKSNDQMEPYXXXXXXXXXXXXXSLTDSKLMSVKGTDK 295
           ++IA FPT KLL+MLT LL KIIKSND                  SL  +          
Sbjct: 189 MDIATFPTYKLLDMLTGLLTKIIKSND------------------SLGSTPNFETSQGKN 230

Query: 296 EKYLKSILSFKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSE-- 353
              ++ ILSF+GK VP ITL QYFQRIQKYCPTTNDV LSLLV+FDRI+KKCN+   E  
Sbjct: 231 IPLMREILSFRGKQVPGITLKQYFQRIQKYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYM 290

Query: 354 -SADTSP-----------ADQLFVMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGG 401
            S  ++P           + QLFVMDS+NIHRL+IA +TV TKF SDFFYSNSRYARVGG
Sbjct: 291 VSVVSTPDKTTASLAHQSSPQLFVMDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGG 350

Query: 402 ISLSELNHLELQFLVLCDFELLISVDKLQRYANLLLRFWNNQ 443
           ISL ELNHLELQFL+LCDF L+ISV++LQRYA+LL +FW+ +
Sbjct: 351 ISLQELNHLELQFLILCDFRLIISVEELQRYADLLYKFWDKE 392

>Scas_715.51
          Length = 341

 Score =  203 bits (517), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 102/218 (46%), Positives = 146/218 (66%), Gaps = 25/218 (11%)

Query: 236 LNIAEFPTDKLLEMLTALLNKIIKSNDQMEPYXXXXXXXXXXXXXSLTDSKLMSVKGTDK 295
           ++I +  T KL++M++ +L K+IKSND++                SL D        +D+
Sbjct: 127 IDITKLSTKKLIKMISTILEKLIKSNDELR----------ERNETSLNDR--TDDDNSDE 174

Query: 296 EKYLKSILSFKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESA 355
            K ++SI SF+GKH+P I L QYF RIQKYCPT N V L++L+YFDRISK  N S    +
Sbjct: 175 SKLVRSIKSFRGKHIPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENES 234

Query: 356 DTSPA-------------DQLFVMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGI 402
           D + +             +  F++DSYNIHRL+I+ +TV TKF+SDFFYSNSRYA+VGGI
Sbjct: 235 DPNISTHHHLLRNYDCKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGI 294

Query: 403 SLSELNHLELQFLVLCDFELLISVDKLQRYANLLLRFW 440
           SL E+N+LELQFL++ +F+L+IS +++QRY+ LL +F+
Sbjct: 295 SLDEMNYLELQFLLISNFDLIISSEEIQRYSGLLSKFY 332

>KLLA0D01287g 112866..113903 some similarities with sp|P20052
           Saccharomyces cerevisiae YOL001w PHO80 cyclin,
           hypothetical start
          Length = 345

 Score = 72.4 bits (176), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 63/126 (50%), Gaps = 14/126 (11%)

Query: 305 FKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESADTSPADQLF 364
           F  K  P IT+YQY  R+ KY    + V LS + Y D +S              P    F
Sbjct: 63  FHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSA-----------VYPE---F 108

Query: 365 VMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFLVLCDFELLI 424
            ++S  +HR ++   T+ +K   D F +N+ Y++VGG+  SELN LE +FL    + ++ 
Sbjct: 109 TLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRIIP 168

Query: 425 SVDKLQ 430
             D ++
Sbjct: 169 RDDNIE 174

>ACR001C [1049] [Homologous to ScYOL001W (PHO80) - SH]
           (357962..359002) [1041 bp, 346 aa]
          Length = 346

 Score = 72.0 bits (175), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 71/138 (51%), Gaps = 15/138 (10%)

Query: 294 DKEKYLKSILSFKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSE 353
           DK K +K +  F  +  P I++Y Y  R+ KY    + V L+ + Y D ++         
Sbjct: 50  DKSKPIK-LTRFHSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLT--------- 99

Query: 354 SADTSPADQLFVMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQ 413
             +  P    F +DS  +HR ++   TV +K   D F +N+ YA+VGG+  SELN LE +
Sbjct: 100 --NVYPE---FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENE 154

Query: 414 FLVLCDFELLISVDKLQR 431
           FL   ++ +L   D ++R
Sbjct: 155 FLERVNYRILPRDDNIRR 172

>Kwal_56.22443
          Length = 280

 Score = 68.6 bits (166), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 70/143 (48%), Gaps = 19/143 (13%)

Query: 300 KSILSFKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESADTSP 359
           K +  F  +  PQI++Y Y  R+ +Y      V ++ + Y D +S    S          
Sbjct: 70  KELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPS---------- 119

Query: 360 ADQLFVMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFLVLCD 419
               F ++S  +HR ++   TV +K   D F +NS YA+VGG+  SEL+ LE +FL   +
Sbjct: 120 ----FSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVN 175

Query: 420 FELL-----ISVDKLQRYANLLL 437
           + +L     IS  K ++ A L +
Sbjct: 176 YRILPRDDNISNCKAEKKAGLFV 198

>Sklu_2373.4 YOL001W, Contig c2373 11960-12883
          Length = 307

 Score = 68.2 bits (165), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 65/129 (50%), Gaps = 15/129 (11%)

Query: 295 KEKYLKSILSFKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSES 354
           K+K LK +  F  +  P I++Y Y  R+ KY      V ++ + Y D +S    S     
Sbjct: 81  KDKNLK-LTRFHSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPS----- 134

Query: 355 ADTSPADQLFVMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQF 414
                    F ++S  +HR ++   TV +K  SD F +N  YA+VGG+  SELN LE +F
Sbjct: 135 ---------FTLNSLTVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEF 185

Query: 415 LVLCDFELL 423
           L   ++ ++
Sbjct: 186 LKRVNYRII 194

>CAGL0E02541g 244577..245605 similar to sp|P20052 Saccharomyces
           cerevisiae YOL001w PHO80 cyclin, start by similarity
          Length = 342

 Score = 67.0 bits (162), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 62/119 (52%), Gaps = 14/119 (11%)

Query: 305 FKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESADTSPADQLF 364
           F  K  P I+++ YF R+ KY    + V LS + Y D +S           +  PA   F
Sbjct: 62  FHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLS-----------NVYPA---F 107

Query: 365 VMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFLVLCDFELL 423
            ++S   HR ++   T+ +K   D F +N+ Y++VGG+  +ELN LE +FL   ++ ++
Sbjct: 108 NLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRII 166

>Scas_392.1
          Length = 303

 Score = 63.2 bits (152), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 65/132 (49%), Gaps = 19/132 (14%)

Query: 305 FKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESADTSPADQLF 364
           F  +  P I+++ Y  R+ KYC   + V LS++ Y D  +               A   F
Sbjct: 100 FHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFT--------------AAYPTF 145

Query: 365 VMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFLVLCDFELL- 423
             +S   HR ++  +TV  K   D F + ++YA++GG+   ELN LE  FL + ++ ++ 
Sbjct: 146 TFNSLTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIP 205

Query: 424 ----ISVDKLQR 431
               +++ KL+R
Sbjct: 206 RSSNVTLIKLER 217

>YOL001W (PHO80) [4815] chr15 (325249..326130) Cyclin that interacts
           with Pho85p cyclin-dependent kinase, regulates the
           phosphate pathway through phosphorylation of Pho4p [882
           bp, 293 aa]
          Length = 293

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 58/119 (48%), Gaps = 14/119 (11%)

Query: 305 FKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESADTSPADQLF 364
           +  K  P I+++ YF R+ K+    + V ++ L Y D +             T   D  F
Sbjct: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQ------------TVYPD--F 112

Query: 365 VMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFLVLCDFELL 423
            ++S   HR ++   TV TK   D F +N+ YA+VGG+   ELN LE  FL   ++ ++
Sbjct: 113 TLNSLTAHRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171

>Scas_720.47
          Length = 473

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 58/128 (45%), Gaps = 20/128 (15%)

Query: 304 SFKGKHVPQITLYQYFQRIQKYCPTTNDVFL-------SLLVYFDRISKKCNSSDSESAD 356
           +FK K  P ++   + QRIQ  C     V+L       +LL+  +  S+K          
Sbjct: 339 NFKMKSPPSLSYADFIQRIQNKCEYDPHVYLIATYLLQTLLLIREEHSRKLKLR------ 392

Query: 357 TSPADQLFVMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFLV 416
                  F  +  ++HRL+IA V + TK   D  +S+  + +V GIS   L+ LE+  L+
Sbjct: 393 -------FKFEKSDVHRLIIATVRIATKLLEDHVHSHEYFCKVSGISKKLLSKLEVSLLL 445

Query: 417 LCDFELLI 424
               E L+
Sbjct: 446 CLKNECLL 453

>YPL219W (PCL8) [5230] chr16 (136749..138227) Cyclin that associates
           with the Pho85p cyclin-dependent kinase, involved in
           control of glycogen accumulation [1479 bp, 492 aa]
          Length = 492

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 72/155 (46%), Gaps = 21/155 (13%)

Query: 288 MSVKGTDKEKYLKSILSFKGKHVPQITLYQYFQRIQKYCPTTNDVFLSL-----LVYFDR 342
           +++   D +K++    +F  K+ P ++   +  RIQ  C     V+L       LV+  R
Sbjct: 343 LAISSEDPQKFV----NFVMKNPPSLSFRDFIDRIQNKCMFGAVVYLGATYLLQLVFLTR 398

Query: 343 ISKKCNSSDSESADTSPADQLFVMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGI 402
                     +  D  P      +     HR++I+ + + TK   DF +S +   +V GI
Sbjct: 399 ----------DEMD-GPIKLKAKLQEDQAHRIIISTIRIATKLLEDFVHSQNYICKVFGI 447

Query: 403 SLSELNHLELQFLVLCDFE-LLISVDKLQRYANLL 436
           S   L  LE+ F+   +F+ L+I+ +KL++  ++L
Sbjct: 448 SKRLLTKLEISFMASVNFDGLMITCEKLEKTLHIL 482

>CAGL0E05918g complement(585723..587168) some similarities with
           tr|Q08966 Saccharomyces cerevisiae YPL219w PCL8,
           hypothetical start
          Length = 481

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 71/156 (45%), Gaps = 21/156 (13%)

Query: 287 LMSVKGTDKEKYLKSILSFKGKHVPQITLYQYFQRIQKYCPTTNDVFLS----LLVYFDR 342
           ++S K  + E Y      F  K  P I+ + + QRIQ  C   + ++L     L + F  
Sbjct: 332 MISEKADNNENYHY----FSMKSAPSISHHDFIQRIQNKCMFGSIIYLGATYLLQILF-- 385

Query: 343 ISKKCNSSDSESADTSPADQLFVMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGI 402
           ++++ N          P      +    +HR+++  + + TK   DF +S+    +V GI
Sbjct: 386 LTREYNDG--------PLRLKHKLQQNEVHRVIVGTIRIATKLLEDFVHSHQYICKVCGI 437

Query: 403 SLSELNHLELQFLVLC--DFELLISVDKLQRYANLL 436
           S   +  LEL  L+ C  D  LLI+ +KL   A +L
Sbjct: 438 SKKLMTKLELA-LIFCLKDNNLLINSEKLSATACIL 472

>YGL134W (PCL10) [1853] chr7 (255666..256967) Cyclin that associates
           with the Pho85p cyclin-dependent kinase, involved in
           glycogen accumulation [1302 bp, 433 aa]
          Length = 433

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 63/128 (49%), Gaps = 10/128 (7%)

Query: 304 SFKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESADTSPADQL 363
           +F  K  P ++   + +RIQ  C     V+L      D +          + D +   QL
Sbjct: 299 NFYMKSKPTLSSADFLKRIQDKCEYQPTVYLVATFLIDTLFL--------TRDGNNILQL 350

Query: 364 FV-MDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFLV-LCDFE 421
            + +    +HR++IA V + TK   DF +S+  +++V GIS   L  LE+  L+ +C+ +
Sbjct: 351 KLNLQEKEVHRMIIAAVRLSTKLLEDFVHSHEYFSKVCGISKRLLTKLEVSLLICVCNTK 410

Query: 422 LLISVDKL 429
           L++S  KL
Sbjct: 411 LMVSNRKL 418

>Kwal_56.24151
          Length = 480

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 36/58 (62%)

Query: 366 MDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFLVLCDFELL 423
           +D+  +HRL+IA + + TK   D  +S++ ++R+ GIS   L  LE+ FL   +FE L
Sbjct: 401 LDNCQVHRLIIASIRLATKLLEDCVHSHTCFSRICGISKKLLTKLEIAFLNCINFEGL 458

>AFL115W [3080] [Homologous to ScYPL219W (PCL8) - SH; ScYGL134W
           (PCL10) - SH] complement(221235..222395) [1161 bp, 386
           aa]
          Length = 386

 Score = 48.9 bits (115), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 55/120 (45%), Gaps = 5/120 (4%)

Query: 305 FKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESADTSPADQLF 364
           F+ K    +T  QY  RI   C     V+ +      R++ K   S+     T P    +
Sbjct: 244 FEMKAPASVTYTQYLDRINAKCMFAPIVYQTAGCLLLRLTLKWPPSE-----TGPVQIRW 298

Query: 365 VMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFLVLCDFELLI 424
            +    +HRL++A + V TK   D  +S+  +++V GIS   L  LEL  +++   E L+
Sbjct: 299 PIAESYVHRLIVALIRVSTKIVEDTVHSHEYFSKVCGISKKLLMRLELALILVLRGEGLM 358

>Scas_706.3
          Length = 451

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 51/110 (46%), Gaps = 7/110 (6%)

Query: 309 HVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESADTSPADQLFVMDS 368
           +VP ++   +  RIQ  C     V++S    F  +    +  D       P      +  
Sbjct: 322 NVPSLSYTDFINRIQSKCMFGAIVYMSATYLFQILLLDRDERDG------PIKLKHKLQE 375

Query: 369 YNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFLVLC 418
             +HR++IA + V TK   DF +S+  + +V G+S   L+ LE+  L+LC
Sbjct: 376 NEVHRMIIATIRVGTKLVEDFVHSHQYFCKVCGVSRKLLSKLEVT-LLLC 424

>KLLA0B02024g 176585..178168 some similarities with sp|P53124
           Saccharomyces cerevisiae YGL134w PCL10 cyclin like
           protein interacting with PHO85P, hypothetical start
          Length = 527

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 58/116 (50%), Gaps = 11/116 (9%)

Query: 305 FKGKHVPQITLYQYFQRIQKYCPTTNDVFLS---LLVYFDRISKKCNSSDSESADTSPAD 361
           F+ K  P +++ QY  RI+  C     ++L+   LLV +  I  K ++   +    +P  
Sbjct: 392 FQMKSAPTLSISQYLDRIESKCSFPPIIYLTASFLLVTYCDI--KFDTGSGKFHLENPIT 449

Query: 362 QLFVMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFLVL 417
           +         HRL+IA + +  K   D  +S+S +++V GIS   L+ LEL  +++
Sbjct: 450 ESMT------HRLLIAFIRLAAKLLEDHVHSHSYFSKVCGISKKLLSKLELNLVLI 499

>CAGL0H08998g 877952..879595 weakly similar to tr|Q08966
           Saccharomyces cerevisiae YPL219w PCL8, hypothetical
           start
          Length = 547

 Score = 45.1 bits (105), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 68/134 (50%), Gaps = 19/134 (14%)

Query: 303 LSFKGKHVPQITLYQYFQRIQKYCPTTNDVFLSL-----LVYFDRISKKCNSSDSESADT 357
           L+F  K  P ++   +  RIQ  C     ++L+      +++  R          ++ D+
Sbjct: 412 LNFTMKSKPSVSAEIFLGRIQNKCEFGPIIYLAAAYLLQILFLTR----------DNPDS 461

Query: 358 SPADQLFVMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFLVL 417
           +   +L + ++  IHRL+I+ V V  K   DF +S+  +++V G+S   L+ LE+  L++
Sbjct: 462 NIRVRLKLREN-EIHRLIISTVRVSAKLVEDFVHSHEYFSKVCGVSKKLLSKLEVS-LIM 519

Query: 418 C--DFELLISVDKL 429
           C  +  L+I+  KL
Sbjct: 520 CIKNERLMITKQKL 533

>YNL289W (PCL1) [4322] chr14 (87895..88734) G1/S-specific cyclin
           that interacts with the Cdc28p-like kinase Pho85p [840
           bp, 279 aa]
          Length = 279

 Score = 35.8 bits (81), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 59/125 (47%), Gaps = 16/125 (12%)

Query: 308 KHVPQI-TLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESADTSPADQLFVM 366
           KH+ ++ +L  +  R+ +Y        L+   Y +++ K+    D+    ++        
Sbjct: 47  KHLTRLPSLMTFITRLVRYTNVYTPTLLTAACYLNKL-KRILPRDATGLPST-------- 97

Query: 367 DSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARV--GGISLSELNHLELQFLVLCDFELLI 424
               IHR+ +A + +  KF +D    N  +AR   G  +L ++N +E Q L L +++L +
Sbjct: 98  ----IHRIFLACLILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNWDLRV 153

Query: 425 SVDKL 429
           + + L
Sbjct: 154 NTEDL 158

>Kwal_34.15996
          Length = 231

 Score = 33.1 bits (74), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 35/61 (57%)

Query: 373 RLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFLVLCDFELLISVDKLQRY 432
           R+ +  + +  KF +D  +S + + R+ G+S  +L+ +E   L   D+ELLI+ + L  +
Sbjct: 127 RVYLCCLILAHKFLNDQTFSMNSWQRISGLSSKDLSTMERWCLSKLDYELLINDENLNSW 186

Query: 433 A 433
           +
Sbjct: 187 S 187

>CAGL0L11946g complement(1279970..1286392) similar to sp|P32639
           Saccharomyces cerevisiae YER172c RNA helicase-related
           protein, start by similarity
          Length = 2140

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 43/88 (48%), Gaps = 8/88 (9%)

Query: 36  NNNASSSTIASYPRTTPSVATTGS-GYLPMGTSVT--TEETLASSQSSHSPFRDNTLLQT 92
           +NN  +  I +      S+   G+  YLP     T  TEE L +   +  P  D  +L +
Sbjct: 245 DNNDYNEKIKNLENDKDSILIKGNKSYLPTDIPATQLTEEYLVNLFKTEIPNNDPYVLYS 304

Query: 93  NSIASNTNTSHLI-----SSNDTVSSTV 115
             IASNT+T+++I     S  D VSST+
Sbjct: 305 KVIASNTDTNNMIQNLIESVGDDVSSTL 332

>Sklu_2426.9 YHR071W, Contig c2426 11461-12162
          Length = 233

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 31/65 (47%)

Query: 373 RLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFLVLCDFELLISVDKLQRY 432
           R+ +  + +  KF  D  +S   + R+ G+   ++  +E   L   D+EL +    LQ +
Sbjct: 125 RIYLVCLILSHKFLKDQTFSMKSWQRISGLPTKDIATMERWCLGKLDYELFLEESALQEW 184

Query: 433 ANLLL 437
           A  +L
Sbjct: 185 AKGVL 189

>KLLA0D04994g 427195..431481 similar to sp|P25558 Saccharomyces
           cerevisiae YCL014w BUD3 budding protein singleton,
           hypothetical start
          Length = 1428

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 50  TTPSVATTGSGYLPMGTSVTTEETLASSQSSHSPFRDNTLLQTNSIASNTNTSHLISSND 109
           TTP V    +G+ P+     +  T+ + +SS S F+DN LL  N+ +S  N   L S+ D
Sbjct: 751 TTPVVNDKTNGFQPVHKKDKSYGTITTFRSSVSDFKDN-LLSNNAKSSKANKKFLKSNKD 809

>Scas_524.5
          Length = 445

 Score = 30.0 bits (66), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%)

Query: 109 DTVSSTVEVLQSPTNPADEMASLRESIARPAYDHT 143
           DTV   VE++  P  P  +M  L+ S  +PAYD+ 
Sbjct: 223 DTVIG-VELINEPLGPVLDMDQLKNSYLKPAYDYV 256

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.128    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,496,184
Number of extensions: 480039
Number of successful extensions: 2712
Number of sequences better than 10.0: 216
Number of HSP's gapped: 2403
Number of HSP's successfully gapped: 364
Length of query: 450
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 345
Effective length of database: 12,961,219
Effective search space: 4471620555
Effective search space used: 4471620555
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 63 (28.9 bits)