Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M11308g1452143071460.0
YOR291W1472144546650.0
Scas_665.301439119243630.0
Kwal_26.92071469144743580.0
KLLA0B08217g1439142742340.0
AFR567W1449144341550.0
CAGL0L01419g12147437388e-80
KLLA0E22352g12067957316e-79
AFR354C12107867201e-77
YEL031W (SPF1)12157967164e-77
Scas_583.14*8755415233e-54
Kwal_14.14989398213076e-28
AEL301W9577943051e-27
CAGL0I04312g9517532754e-24
KLLA0A08910g12808532739e-24
KLLA0A03157g9388222711e-23
YGL167C (PMR1)9507582683e-23
Kwal_23.316011008422683e-23
CAGL0A00517g11226492674e-23
YDR038C (ENA5)10917562674e-23
YDR039C (ENA2)10917562665e-23
YDR040C (ENA1)10917562656e-23
AGL097C10967492504e-21
KLLA0E14630g10828402471e-20
Scas_707.48*7417152432e-20
Kwal_47.1754712404382442e-20
AFL011W12428672415e-20
YGL006W (PMC1)11734392335e-19
CAGL0K12034g10874132318e-19
Sklu_2193.111435302254e-18
YIL048W (NEO1)11516032237e-18
KLLA0F20658g10825422211e-17
ADL079C11666072121e-16
CAGL0J01870g9464212093e-16
Kwal_23.578911335192093e-16
Kwal_26.707013154822032e-15
KLLA0A04015g13435062004e-15
ADR350W13113581979e-15
KLLA0C08393g11485581951e-14
Scas_704.3811615321951e-14
Scas_297.18002791913e-14
CAGL0G06270g13283281923e-14
CAGL0L11814g15763231852e-13
YMR162C (DNF3)16562491817e-13
CAGL0L00715g11445311799e-13
Scas_499.33461711731e-12
YDR093W (DNF2)16123241781e-12
Scas_576.815913201763e-12
KLLA0C17644g15763171682e-11
CAGL0H04477g16262561673e-11
AGR120C15475131663e-11
YAL026C (DRS2)13553881664e-11
Scas_89.12712081576e-11
Scas_636.1615543241647e-11
YER166W (DNF1)15713291611e-10
CAGL0G08085g15783221611e-10
Kwal_23.355615972541566e-10
AFL191W15751991556e-10
KLLA0E01650g15502481548e-10
Scas_669.316382501469e-09
Scas_688.19132931333e-07
AGL085C9092951333e-07
YGL008C (PMA1)9182911314e-07
Scas_710.419042891297e-07
KLLA0A09031g8992951288e-07
YPL036W (PMA2)9472911281e-06
Kwal_47.175228992911281e-06
Scas_569.0d468971197e-06
CAGL0A00495g9022921209e-06
KLLA0F07447g975501000.002
ACR086C81049960.005
CAGL0M08602g101250960.005
Kwal_55.2157598949930.013
Scas_505.41025149890.033
Scas_615.994249880.051
KLLA0D04092g115277860.083
AGL041C123352820.24
YDR270W (CCC2)100450810.31
YBR295W (PCA1)1216237770.88
Kwal_26.9455525128732.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M11308g
         (1430 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...  2757   0.0  
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...  1801   0.0  
Scas_665.30                                                          1685   0.0  
Kwal_26.9207                                                         1683   0.0  
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...  1635   0.0  
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...  1605   0.0  
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...   288   8e-80
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...   286   6e-79
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...   281   1e-77
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...   280   4e-77
Scas_583.14*                                                          206   3e-54
Kwal_14.1498                                                          122   6e-28
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...   122   1e-27
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...   110   4e-24
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...   109   9e-24
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....   108   1e-23
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...   107   3e-23
Kwal_23.3160                                                          107   3e-23
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...   107   4e-23
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...   107   4e-23
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...   107   5e-23
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...   106   6e-23
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....   100   4e-21
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...   100   1e-20
Scas_707.48*                                                           98   2e-20
Kwal_47.17547                                                          99   2e-20
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...    97   5e-20
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...    94   5e-19
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...    94   8e-19
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement          91   4e-18
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...    91   7e-18
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...    90   1e-17
ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...    86   1e-16
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...    85   3e-16
Kwal_23.5789                                                           85   3e-16
Kwal_26.7070                                                           83   2e-15
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...    82   4e-15
ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...    80   9e-15
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...    80   1e-14
Scas_704.38                                                            80   1e-14
Scas_297.1                                                             78   3e-14
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...    79   3e-14
CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...    76   2e-13
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...    74   7e-13
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...    74   9e-13
Scas_499.3                                                             71   1e-12
YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloaci...    73   1e-12
Scas_576.8                                                             72   3e-12
KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...    69   2e-11
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...    69   3e-11
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...    69   3e-11
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...    69   4e-11
Scas_89.1                                                              65   6e-11
Scas_636.16                                                            68   7e-11
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...    67   1e-10
CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharo...    67   1e-10
Kwal_23.3556                                                           65   6e-10
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...    64   6e-10
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...    64   8e-10
Scas_669.3                                                             61   9e-09
Scas_688.1                                                             56   3e-07
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...    56   3e-07
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...    55   4e-07
Scas_710.41                                                            54   7e-07
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...    54   8e-07
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...    54   1e-06
Kwal_47.17522                                                          54   1e-06
Scas_569.0d                                                            50   7e-06
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...    51   9e-06
KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces c...    43   0.002
ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH] (511968..51...    42   0.005
CAGL0M08602g complement(856349..859387) similar to sp|P38995 Sac...    42   0.005
Kwal_55.21575                                                          40   0.013
Scas_505.4                                                             39   0.033
Scas_615.9                                                             39   0.051
KLLA0D04092g complement(344666..348124) some similarities with s...    38   0.083
AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) ...    36   0.24 
YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transportin...    36   0.31 
YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transpo...    34   0.88 
Kwal_26.9455                                                           33   2.6  

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score = 2757 bits (7146), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1340/1430 (93%), Positives = 1340/1430 (93%)

Query: 1    MPYSQHGSSSHAQRTRASFSSARSNATSATLTSSVIIDHNNSESYAGAAFEAVPSSIVSF 60
            MPYSQHGSSSHAQRTRASFSSARSNATSATLTSSVIIDHNNSESYAGAAFEAVPSSIVSF
Sbjct: 1    MPYSQHGSSSHAQRTRASFSSARSNATSATLTSSVIIDHNNSESYAGAAFEAVPSSIVSF 60

Query: 61   HRPHSFQSSHMMGSSLNSNMLERTTGAIHETEPLYQGNDHXXXXXXXXXXXXXTDEQVSQ 120
            HRPHSFQSSHMMGSSLNSNMLERTTGAIHETEPLYQGNDH             TDEQVSQ
Sbjct: 61   HRPHSFQSSHMMGSSLNSNMLERTTGAIHETEPLYQGNDHSRSSSNNRNFRFFTDEQVSQ 120

Query: 121  AEGIATLENTDYDIDWDAAPAYEQENRAGSYMGXXXXXXXXXXXXXXXXXXPYGSIDHRG 180
            AEGIATLENTDYDIDWDAAPAYEQENRAGSYMG                  PYGSIDHRG
Sbjct: 121  AEGIATLENTDYDIDWDAAPAYEQENRAGSYMGSRRSSIRDISRRSSLSTSPYGSIDHRG 180

Query: 181  RSASKSRPRYDXXXXXXXXXXXXXXXXXXXERIPVEVEDQDDNSLDVHXXXXXXXXXXXN 240
            RSASKSRPRYD                   ERIPVEVEDQDDNSLDVH           N
Sbjct: 181  RSASKSRPRYDQVYQTSTHSSSSLSRYSVRERIPVEVEDQDDNSLDVHSSDQSLASSHSN 240

Query: 241  TSNYGGNEGSVNPHDDTTQRKSQNHHEFLKPQYHDKFYPEFKADRHIQRAYISEEDMVIV 300
            TSNYGGNEGSVNPHDDTTQRKSQNHHEFLKPQYHDKFYPEFKADRHIQRAYISEEDMVIV
Sbjct: 241  TSNYGGNEGSVNPHDDTTQRKSQNHHEFLKPQYHDKFYPEFKADRHIQRAYISEEDMVIV 300

Query: 301  IAGYKTSKFMSLVYNLLCIFTLGGLFLIGKWLPKYKVRIVGRKAPLAKAEWLVLENEHGE 360
            IAGYKTSKFMSLVYNLLCIFTLGGLFLIGKWLPKYKVRIVGRKAPLAKAEWLVLENEHGE
Sbjct: 301  IAGYKTSKFMSLVYNLLCIFTLGGLFLIGKWLPKYKVRIVGRKAPLAKAEWLVLENEHGE 360

Query: 361  FTIEEPTREWYNRTLSTILMLDSKTETEEFEHGFQRHHHTSEENPNLPILISFQYRYIKF 420
            FTIEEPTREWYNRTLSTILMLDSKTETEEFEHGFQRHHHTSEENPNLPILISFQYRYIKF
Sbjct: 361  FTIEEPTREWYNRTLSTILMLDSKTETEEFEHGFQRHHHTSEENPNLPILISFQYRYIKF 420

Query: 421  VYSPLDDIFKTNNNWVDFDWVDLETTSKGLSSGIQEDRVLAFDKNQINLKMKTTSQILFD 480
            VYSPLDDIFKTNNNWVDFDWVDLETTSKGLSSGIQEDRVLAFDKNQINLKMKTTSQILFD
Sbjct: 421  VYSPLDDIFKTNNNWVDFDWVDLETTSKGLSSGIQEDRVLAFDKNQINLKMKTTSQILFD 480

Query: 481  EVLHPFYIFQVLSIILWSLDEYYYYAGCXXXXXXXXXXXXXXETKKISRTLAEMSHFNCE 540
            EVLHPFYIFQVLSIILWSLDEYYYYAGC              ETKKISRTLAEMSHFNCE
Sbjct: 481  EVLHPFYIFQVLSIILWSLDEYYYYAGCIFLISLLSILDTLIETKKISRTLAEMSHFNCE 540

Query: 541  VRVLREGFWSSIHSSELVPGDIYEISDPNLNLLPCDSILLSGDCIVNESMLTGESVPVSK 600
            VRVLREGFWSSIHSSELVPGDIYEISDPNLNLLPCDSILLSGDCIVNESMLTGESVPVSK
Sbjct: 541  VRVLREGFWSSIHSSELVPGDIYEISDPNLNLLPCDSILLSGDCIVNESMLTGESVPVSK 600

Query: 601  YPASEETILQLFDDFQSTQISTFLSKSFLFNGTTLIRAKIPNGGSVALAMAVRTGFSTTK 660
            YPASEETILQLFDDFQSTQISTFLSKSFLFNGTTLIRAKIPNGGSVALAMAVRTGFSTTK
Sbjct: 601  YPASEETILQLFDDFQSTQISTFLSKSFLFNGTTLIRAKIPNGGSVALAMAVRTGFSTTK 660

Query: 661  GSLIRSMVFPKPSGFKFYSDSFKYXXXXXXXXXXXXXXXCINFIKLGLDKRTMILRALDI 720
            GSLIRSMVFPKPSGFKFYSDSFKY               CINFIKLGLDKRTMILRALDI
Sbjct: 661  GSLIRSMVFPKPSGFKFYSDSFKYIGFMAIIAFFGFSISCINFIKLGLDKRTMILRALDI 720

Query: 721  ITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNIGGKIDVMCFDKTGTLTEDGLD 780
            ITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNIGGKIDVMCFDKTGTLTEDGLD
Sbjct: 721  ITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNIGGKIDVMCFDKTGTLTEDGLD 780

Query: 781  VLGVRVSCAATRNKASFSDLISDTHDIFPKFSLKDCSNPDDYKRRNFLISLLTCHSLRVV 840
            VLGVRVSCAATRNKASFSDLISDTHDIFPKFSLKDCSNPDDYKRRNFLISLLTCHSLRVV
Sbjct: 781  VLGVRVSCAATRNKASFSDLISDTHDIFPKFSLKDCSNPDDYKRRNFLISLLTCHSLRVV 840

Query: 841  DGELLGDPLDFKMFQFTGWSYEEDFQNHQFHSLYEERHEGQNFPENNDIIPAIVHPNDSD 900
            DGELLGDPLDFKMFQFTGWSYEEDFQNHQFHSLYEERHEGQNFPENNDIIPAIVHPNDSD
Sbjct: 841  DGELLGDPLDFKMFQFTGWSYEEDFQNHQFHSLYEERHEGQNFPENNDIIPAIVHPNDSD 900

Query: 901  ERNKFVQNDPNNILGIIRSFEFLSELRRMSVIVKPNNENVYWAYTKGAPEVIIDICNPAT 960
            ERNKFVQNDPNNILGIIRSFEFLSELRRMSVIVKPNNENVYWAYTKGAPEVIIDICNPAT
Sbjct: 901  ERNKFVQNDPNNILGIIRSFEFLSELRRMSVIVKPNNENVYWAYTKGAPEVIIDICNPAT 960

Query: 961  LPSDYDDILNFYTHSGYRVIACAGKTLPKNTWLYSQKVRREEVESNMEFLGFIIFQNKLK 1020
            LPSDYDDILNFYTHSGYRVIACAGKTLPKNTWLYSQKVRREEVESNMEFLGFIIFQNKLK
Sbjct: 961  LPSDYDDILNFYTHSGYRVIACAGKTLPKNTWLYSQKVRREEVESNMEFLGFIIFQNKLK 1020

Query: 1021 DATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIH 1080
            DATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIH
Sbjct: 1021 DATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIH 1080

Query: 1081 WNEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQDNYSEEYVNEILLKGSIF 1140
            WNEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQDNYSEEYVNEILLKGSIF
Sbjct: 1081 WNEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQDNYSEEYVNEILLKGSIF 1140

Query: 1141 ARMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSKIF 1200
            ARMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSKIF
Sbjct: 1141 ARMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSKIF 1200

Query: 1201 DITCVLDVIKEGRASLVTSFACFQYMSLYSAIQFISITILYSRGSNLGDFQFLYIDLLLI 1260
            DITCVLDVIKEGRASLVTSFACFQYMSLYSAIQFISITILYSRGSNLGDFQFLYIDLLLI
Sbjct: 1201 DITCVLDVIKEGRASLVTSFACFQYMSLYSAIQFISITILYSRGSNLGDFQFLYIDLLLI 1260

Query: 1261 IPIAVTMSWSKPYHELAKKRPSANLVSPKILVPLILDIVFLFLFQFLPWIWIQGRPWYIK 1320
            IPIAVTMSWSKPYHELAKKRPSANLVSPKILVPLILDIVFLFLFQFLPWIWIQGRPWYIK
Sbjct: 1261 IPIAVTMSWSKPYHELAKKRPSANLVSPKILVPLILDIVFLFLFQFLPWIWIQGRPWYIK 1320

Query: 1321 PIVGGDDAVQSSDNTVLFYISNFQYILTSVVLSIGPPYREPVHHNVQYVRDIALSVLVSF 1380
            PIVGGDDAVQSSDNTVLFYISNFQYILTSVVLSIGPPYREPVHHNVQYVRDIALSVLVSF
Sbjct: 1321 PIVGGDDAVQSSDNTVLFYISNFQYILTSVVLSIGPPYREPVHHNVQYVRDIALSVLVSF 1380

Query: 1381 VIMLVNPDSKLGNLLQLTSIPTGLIILIPIWCMLNYYVLTHVPPKVKQYF 1430
            VIMLVNPDSKLGNLLQLTSIPTGLIILIPIWCMLNYYVLTHVPPKVKQYF
Sbjct: 1381 VIMLVNPDSKLGNLLQLTSIPTGLIILIPIWCMLNYYVLTHVPPKVKQYF 1430

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 1801 bits (4665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 895/1445 (61%), Positives = 1083/1445 (74%), Gaps = 25/1445 (1%)

Query: 5    QHGSSSHAQRT--RASFSSARSNATSATLTSSVIIDHNNSESYAGAAFEAVPSSIVSFHR 62
            QHG  S   R   RASFSS  + +T+ATLTS++++D NNSE YAGA FEAVPSSIVSFH 
Sbjct: 10   QHGQRSERNRRMPRASFSSTATTSTAATLTSAMVLDQNNSEPYAGATFEAVPSSIVSFHH 69

Query: 63   PHSFQSSHMMGSSLNSNMLERTTGAIHETEPL--YQGNDHXXXXXXXXXXXXXTDEQVSQ 120
            PHSFQSS++  S  +S  LE+    + E+EPL                     T EQ+S 
Sbjct: 70   PHSFQSSNL-PSPHSSGNLEQRGRRLTESEPLVLSSAEQSRSSSRNPSHFRFFTQEQISN 128

Query: 121  AEGIATLENTDYDIDWDAAPAYEQENRAGSYMGXXXXXXXXXXXXXXXX-XXPYGSIDHR 179
            AEG +TLENTDYD+ WDA PAYEQ+   G+ +                     YGS   R
Sbjct: 129  AEGASTLENTDYDMAWDATPAYEQDRIYGTGLSSRRSSIRSFSRASSLSNAKSYGSFSKR 188

Query: 180  GRSASKSRPRYDXXX------XXXXXXXXXXXXXXXXERIPVEVEDQDDNSLDVHXXXXX 233
            GRS S++  R                           ERIP+E+E Q D  L+       
Sbjct: 189  GRSGSRAPQRLGENSDTGFVYHSATHSSSSLSRYTTRERIPIELESQTDEILEDESSTHS 248

Query: 234  XXXXXXNTSNYGGNEGSVNPHDDTTQRKSQNHHEFLKPQYHDKFYPEFKADRHIQRAYIS 293
                    S    N GS + HDD   +    H E+LKP YH+KFYP++  + H QR YI+
Sbjct: 249  LESSDSRRSASENNRGSFSGHDDVHNQ----HSEYLKPDYHEKFYPQYAPNLHYQRFYIA 304

Query: 294  EEDMVIVIAGYKTSKFMSLVYNLLCIFTLGGLFLIGKWLPKYKVRIVGRKAPLAKAEWLV 353
            EED+VI IA Y+TSKF  ++YNL C  T G ++L+ +WLP  KV++ G K PLAKAEW+V
Sbjct: 305  EEDLVIGIAAYQTSKFWYIIYNLCCFLTFGLVYLLTRWLPHLKVKLYGVKVPLAKAEWVV 364

Query: 354  LENEHGEFTIEEPTREWYNRTLSTILMLDS-KTETEEFEHGFQRHHHTSEENPNLPILIS 412
            +ENE GEF I+   R+WYNR LST+L  ++    + E       HHH +E NPN+PILI+
Sbjct: 365  IENEFGEFVIQPIDRQWYNRPLSTVLPFENYPNPSYEPNDINLSHHHANEINPNVPILIT 424

Query: 413  FQYRYIKFVYSPLDDIFKTNNNWVDFDWVDLETTSKGLSSGIQEDRVLAFDKNQINLKMK 472
            F+YRYIKF+YSPLDD+FKTNNNW+D DWVDL T S GL+ G+QEDR LAF KNQINL+MK
Sbjct: 425  FEYRYIKFIYSPLDDLFKTNNNWIDPDWVDLSTVSNGLTKGVQEDRELAFGKNQINLRMK 484

Query: 473  TTSQILFDEVLHPFYIFQVLSIILWSLDEYYYYAGCXXXXXXXXXXXXXXETKKISRTLA 532
            TTS+ILF+EVLHPFY+FQV SIILW +DEYYYYA C              E KK+SR LA
Sbjct: 485  TTSEILFNEVLHPFYVFQVFSIILWGIDEYYYYAACIFLISVLSIFDSLNEQKKVSRNLA 544

Query: 533  EMSHFNCEVRVLREGFWSSIHSSELVPGDIYEISDPNLNLLPCDSILLSGDCIVNESMLT 592
            EMSHF+C+VRVLR+ FW++I SSELVPGDIYE+SDPN+ +LPCDSILLS DCIVNESMLT
Sbjct: 545  EMSHFHCDVRVLRDKFWTTISSSELVPGDIYEVSDPNITILPCDSILLSSDCIVNESMLT 604

Query: 593  GESVPVSKYPASEETILQLFDDFQSTQISTFLSKSFLFNGTTLIRAKIPNGGSVALAMAV 652
            GESVPVSK+PA+EET+ QL DDFQSTQIS+F+SKSFL+NGT +IRA+I  G + ALAM V
Sbjct: 605  GESVPVSKFPATEETMYQLCDDFQSTQISSFVSKSFLYNGTNIIRARIAPGQTAALAMVV 664

Query: 653  RTGFSTTKGSLIRSMVFPKPSGFKFYSDSFKYXXXXXXXXXXXXXXXCINFIKLGLDKRT 712
            RTGFSTTKGSL+RSMVFPKP+GFKFY DSFKY               C+ FIKLGLDK+T
Sbjct: 665  RTGFSTTKGSLVRSMVFPKPTGFKFYRDSFKYIGFMSLIAIFGFCVSCVQFIKLGLDKKT 724

Query: 713  MILRALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNIGGKIDVMCFDKTG 772
            MILRALDIITIVVPPALPATLTIGT+FAL+RLKEKGIFCI+PTR+NI GKIDVMCFDKTG
Sbjct: 725  MILRALDIITIVVPPALPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMCFDKTG 784

Query: 773  TLTEDGLDVLGVRVSCAATRNKASFSDLISDTHDIFPKFSLKDCSNPDDYKRRNFLISLL 832
            TLTEDGLDVLGV++S         F +L+SD   +FPKFSL DCS+P D+K RNF +SLL
Sbjct: 785  TLTEDGLDVLGVQISEPNGVRGQKFGELLSDIRQVFPKFSLNDCSSPLDFKSRNFFMSLL 844

Query: 833  TCHSLRVVDGELLGDPLDFKMFQFTGWSYEEDFQNHQFHSLYEERHEGQNFPENNDIIPA 892
            TCHSLR VDG LLGDPLDFKMFQFTGWS+EEDFQ   FHSLYE RHE   FPEN++IIPA
Sbjct: 845  TCHSLRSVDGNLLGDPLDFKMFQFTGWSFEEDFQKRAFHSLYEGRHEDDVFPENSEIIPA 904

Query: 893  IVHPNDSDERNKFVQNDPNNILGIIRSFEFLSELRRMSVIVKPNNENVYWAYTKGAPEVI 952
            +VHP+ ++  N F  NDP+N LG++RSFEFLSELRRMSVIVK NN++VYW++TKGAPEVI
Sbjct: 905  VVHPDSNNRENTFTDNDPHNFLGVVRSFEFLSELRRMSVIVKTNNDDVYWSFTKGAPEVI 964

Query: 953  IDICNPATLPSDYDDILNFYTHSGYRVIACAGKTLPKNTWLYSQKVRREEVESNMEFLGF 1012
             +ICN +TLP+D++++L  YTH+GYRVIACAGKTLPK TWLYSQKV REEVESN+EFLGF
Sbjct: 965  SEICNKSTLPADFEEVLRCYTHNGYRVIACAGKTLPKRTWLYSQKVSREEVESNLEFLGF 1024

Query: 1013 IIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSD 1072
            IIFQNKLK  TS TL  L+ ANIRT+MCTGDN+LTAISVG+E  LI   RVYVP++  + 
Sbjct: 1025 IIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSINDTP 1084

Query: 1073 MTVQPVIHWNEISNAEHILDTFTLQPIDDYSGP--------YTLAITGEVFRIIFSNQDN 1124
            +  +PVI W +++  + ILDT TL+P+   +          YTLA++G+VFR++F +++ 
Sbjct: 1085 LHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDENE 1144

Query: 1125 YSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALKAADVGISL 1184
              EEY+NEILL  SI+ARMSPDEKHEL+ QLQK+DYTVGFCGDGANDCGALKAADVGISL
Sbjct: 1145 IPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGALKAADVGISL 1204

Query: 1185 SEAEASVAAPFTSKIFDITCVLDVIKEGRASLVTSFACFQYMSLYSAIQFISITILYSRG 1244
            SEAEASVAAPFTSKIF+I+CVLDVI+EGRA+LVTSFACFQYMSLYSAIQFI+ITILYSRG
Sbjct: 1205 SEAEASVAAPFTSKIFNISCVLDVIREGRAALVTSFACFQYMSLYSAIQFITITILYSRG 1264

Query: 1245 SNLGDFQFLYIDLLLIIPIAVTMSWSKPYHELAKKRPSANLVSPKILVPLILDIVFLFLF 1304
            SNLGDFQFLYIDLLLI+PIA+ MSWSK Y ++ KKRPSANLVSPKILVPL++ +  +FLF
Sbjct: 1265 SNLGDFQFLYIDLLLIVPIAICMSWSKSYEKIDKKRPSANLVSPKILVPLLISVFLVFLF 1324

Query: 1305 QFLPWIWIQGRPWYIKPIVGGDDAVQSSDNTVLFYISNFQYILTSVVLSIGPPYREPVHH 1364
            QF+PWI +Q   WYIKPIVGGDDAVQSSDNTVLF++SNFQYILT++VLS+GPPYREP+  
Sbjct: 1325 QFIPWIIVQKMSWYIKPIVGGDDAVQSSDNTVLFFVSNFQYILTAIVLSVGPPYREPMSK 1384

Query: 1365 NVQYVRDIALSVLVSFVIMLVNPDSKLGNLLQLTSIPTGLIILIPIWCMLNYYVLTHVPP 1424
            N +++ DI +S+  S ++M ++ +S LG +LQLT I     + I +W +LNYY   ++PP
Sbjct: 1385 NFEFIVDITVSIGASLLLMTLDTESYLGKMLQLTPISNSFTMFIIVWVILNYYAQLYIPP 1444

Query: 1425 KVKQY 1429
             +K +
Sbjct: 1445 SIKGW 1449

>Scas_665.30
          Length = 1439

 Score = 1685 bits (4363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 798/1192 (66%), Positives = 969/1192 (81%), Gaps = 8/1192 (0%)

Query: 240  NTSNYGGNEGSVNPHDDTTQRKSQNHHEFLKPQYHDKFYPEFKADRHIQRAYISEEDMVI 299
            N  N    E + + H  TT        E+LKPQYH+KFYP   AD + QR YI+EED+V+
Sbjct: 22   NNGNNLSTEDTHSHHKKTTTSGGGYQTEYLKPQYHEKFYPSNVADLYYQRFYITEEDLVV 81

Query: 300  VIAGYKTSKFMSLVYNLLCIFTLGGLFLIGKWLPKYKVRIVGRKAPLAKAEWLVLENEHG 359
             IAGY TSKF + +YN +CI + G L+L+ +WLP YKV+++G K PL KAEW+VLENE G
Sbjct: 82   GIAGYSTSKFKNAIYNFICIVSFGLLYLLLRWLPSYKVKLIGTKVPLGKAEWVVLENEFG 141

Query: 360  EFTIEEPTREWYNRTLSTILMLDSKTET------EEFEHGFQRHHHTSEENPNLPILISF 413
            EF+IE   REWYNR +STIL LD   +       E ++H    +HH +E+NPN+PILI+F
Sbjct: 142  EFSIEPIKREWYNRPISTILPLDDPFQEIDGINDESYQHRHHHYHHVTEKNPNIPILITF 201

Query: 414  QYRYIKFVYSPLDDIFKTNNNWVDFDWVDLETTSKGLSSGIQEDRVLAFDKNQINLKMKT 473
            QYRYI F+YSP++DIFKTNNNW D DWVDL +T +GLSSG+QEDR+LAFD NQINL++KT
Sbjct: 202  QYRYITFIYSPVEDIFKTNNNWTDPDWVDLSSTLRGLSSGVQEDRILAFDSNQINLRVKT 261

Query: 474  TSQILFDEVLHPFYIFQVLSIILWSLDEYYYYAGCXXXXXXXXXXXXXXETKKISRTLAE 533
             +++LF+EVLHPFY+FQ+ SIILWSLDEYYYYAGC              ET++  ++LA+
Sbjct: 262  VAELLFNEVLHPFYVFQIFSIILWSLDEYYYYAGCIFLISILSIVDTLVETRRTQKSLAD 321

Query: 534  MSHFNCEVRVLREGFWSSIHSSELVPGDIYEISDPNLNLLPCDSILLSGDCIVNESMLTG 593
            MSHF CEVRV R+ FW++++S++LVPGDIYEISDP+L + PCDS+LLSGDCIVNESMLTG
Sbjct: 322  MSHFACEVRVFRDEFWTNVNSADLVPGDIYEISDPSLTVFPCDSLLLSGDCIVNESMLTG 381

Query: 594  ESVPVSKYPASEETILQLFDDFQSTQISTFLSKSFLFNGTTLIRAKIPNGGSVALAMAVR 653
            ESVPVSK+PA  ET+LQL DDFQ+TQIS++LSKSFLFNGTT+IRA+IP G S ALAM VR
Sbjct: 382  ESVPVSKFPAEPETMLQLLDDFQNTQISSYLSKSFLFNGTTIIRARIPYGQSAALAMVVR 441

Query: 654  TGFSTTKGSLIRSMVFPKPSGFKFYSDSFKYXXXXXXXXXXXXXXXCINFIKLGLDKRTM 713
            TGFSTTKGSL+RSMVFPKP+GFKFY DSFKY               CI FIK+GLDKRTM
Sbjct: 442  TGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGVMALIALFGFSISCIQFIKIGLDKRTM 501

Query: 714  ILRALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNIGGKIDVMCFDKTGT 773
            ILRALDIITIVVPPALPATLTIGT FAL+RLK+KGIFCI+PTRVNIGGKID++CFDKTGT
Sbjct: 502  ILRALDIITIVVPPALPATLTIGTGFALSRLKKKGIFCISPTRVNIGGKIDILCFDKTGT 561

Query: 774  LTEDGLDVLGVRVSCAATRNKASFSDLISDTHDIFPKFSLKDCSNPDDYKRRNFLISLLT 833
            LTE+GLDVLGV++   ++ N   F+DL+ D H +FPKFSL DCS+P DY+ +NF ISLLT
Sbjct: 562  LTENGLDVLGVQLCVPSSHNSFQFADLVQDVHKLFPKFSLNDCSSPRDYRAKNFFISLLT 621

Query: 834  CHSLRVVDGELLGDPLDFKMFQFTGWSYEEDFQNHQFHSLYEERHEGQNFPENNDIIPAI 893
            CHSLRVVD EL+GDPLDFKMFQFT WSYEEDFQ  +FHS YEER      PEN DIIPA+
Sbjct: 622  CHSLRVVDNELIGDPLDFKMFQFTKWSYEEDFQEKEFHSTYEERRHDNALPENIDIIPAV 681

Query: 894  VHPNDSDERNKFVQNDPNNILGIIRSFEFLSELRRMSVIVKPNNENVYWAYTKGAPEVII 953
            VHPN +D  N F+ NDP+N LGIIRSFEFLSELRRMSVIVKP+NE+VYWA+TKGAPEVI 
Sbjct: 682  VHPNSADPENTFIDNDPHNFLGIIRSFEFLSELRRMSVIVKPSNEDVYWAFTKGAPEVIT 741

Query: 954  DICNPATLPSDYDDILNFYTHSGYRVIACAGKTLPKNTWLYSQKVRREEVESNMEFLGFI 1013
             ICN ATLP++++++LN+YTH GYRVIACAG+ LP+NTWLYSQKV REEVESNMEFLGFI
Sbjct: 742  QICNKATLPANFEEMLNYYTHKGYRVIACAGRVLPRNTWLYSQKVSREEVESNMEFLGFI 801

Query: 1014 IFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSDM 1073
            IF+NKLK  T+ TL  L+ A+IRTVMCTGDNVLTAISVG++C LI   +VYVP++   D 
Sbjct: 802  IFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDS 861

Query: 1074 TVQPVIHWNEISNAEHILDTFTLQPIDDYSG-PYTLAITGEVFRIIFSNQDN-YSEEYVN 1131
            T Q  I W ++ N +  LD+ TL PI++ S   YTLAITG++FRIIF +++N  SE+Y+N
Sbjct: 862  TGQTSIIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYIN 921

Query: 1132 EILLKGSIFARMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALKAADVGISLSEAEASV 1191
             +LLKG+I+ARMSPDEKHEL+EQLQ+++YTVGFCGDGANDCGALKAADVGISLSEAEASV
Sbjct: 922  TVLLKGTIYARMSPDEKHELMEQLQRLNYTVGFCGDGANDCGALKAADVGISLSEAEASV 981

Query: 1192 AAPFTSKIFDITCVLDVIKEGRASLVTSFACFQYMSLYSAIQFISITILYSRGSNLGDFQ 1251
            AAPFTS++FDI+CVLDVIKEGRA LVTSF+CFQYMSLYSAIQFI+IT+LYSRGSNLGDFQ
Sbjct: 982  AAPFTSQVFDISCVLDVIKEGRACLVTSFSCFQYMSLYSAIQFITITVLYSRGSNLGDFQ 1041

Query: 1252 FLYIDLLLIIPIAVTMSWSKPYHELAKKRPSANLVSPKILVPLILDIVFLFLFQFLPWIW 1311
            FLYIDLLLI+PIA+ MSWSKPY ++ KKRPSANLVSPKIL+PL+  IV + LFQ +PWI 
Sbjct: 1042 FLYIDLLLIVPIAIFMSWSKPYDKIVKKRPSANLVSPKILIPLLASIVVVLLFQIIPWII 1101

Query: 1312 IQGRPWYIKPIVGGDDAVQSSDNTVLFYISNFQYILTSVVLSIGPPYREPVHHNVQYVRD 1371
            +QG  WY+KPIVGGDD V+SSDNT+LF+ISNFQYILT+V+LS+GPPYREP+  N+ ++ D
Sbjct: 1102 VQGEEWYMKPIVGGDDVVESSDNTILFFISNFQYILTAVILSVGPPYREPMSRNIGFIVD 1161

Query: 1372 IALSVLVSFVIMLVNPDSKLGNLLQLTSIPTGLIILIPIWCMLNYYVLTHVP 1423
            + +S+++S  +M ++  S LG   QLT I     + I IW ++NY+V  +VP
Sbjct: 1162 VIISIVLSIWLMFIDSSSFLGKKFQLTEISFKFKLFILIWVVINYFVQLYVP 1213

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 72/121 (59%), Gaps = 8/121 (6%)

Query: 35   VIIDHNNSESYAGAAFEAVPSSIVSFHRPHSFQSSHMMGSSLNSNMLERTTGAIHETEPL 94
            ++ +  N+E+Y+G  FE VPSSIVSFH P SFQSS++ G+S+ S+ L R      +TEPL
Sbjct: 1295 ILGNQPNTETYSGVTFETVPSSIVSFHHPRSFQSSNIFGTSVGSSTLGRRG---RDTEPL 1351

Query: 95   YQGNDHXXXXXXXXXXXX-----XTDEQVSQAEGIATLENTDYDIDWDAAPAYEQENRAG 149
               +                    T++Q++ AEG +TLENTDY+  WDA P+YEQE   G
Sbjct: 1352 ITSHSPSPIRRSRSSSRNPQFHFFTEDQINNAEGTSTLENTDYNTPWDATPSYEQERLYG 1411

Query: 150  S 150
            +
Sbjct: 1412 T 1412

>Kwal_26.9207
          Length = 1469

 Score = 1683 bits (4358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 822/1447 (56%), Positives = 1035/1447 (71%), Gaps = 26/1447 (1%)

Query: 4    SQHGSSS-HAQRTRASFSSARSNATSATLTSSVIIDHNNSESYAGAAFEAVPSSIVSFHR 62
            S  GS++    R R SFSSAR+ ++S TLTS+ ++D+N++E+YAGA FE VPSSIVSFH 
Sbjct: 7    SHRGSTNGRNSRMRPSFSSARTGSSSNTLTSATVVDNNSTEAYAGATFETVPSSIVSFHH 66

Query: 63   PHSFQSS--HMMGSSLNSNMLERTTGAIHETEPLYQGN---DHXXXXXXXXXXXXXTDEQ 117
            PHSF ++   M+ S+ NSN L   +   HE E L                      ++E+
Sbjct: 67   PHSFHTNGNSMLESASNSNELHSRS---HEAESLLSSRHSYSRSQGPSRTPNFRYFSEEE 123

Query: 118  VSQAEGIA-TLENTDYDIDWDAAPAYEQEN------------RAGSYMGXXXXXXXXXXX 164
            +  AEG++ TLE+ DYDI+WD  P YEQE             R+G+              
Sbjct: 124  IELAEGVSSTLESADYDINWDGTPTYEQERLHYHNPSGRSSIRSGT-GHSLSSYQSRSSS 182

Query: 165  XXXXXXXPYGSIDHRGRSASKSRPRYDXXXXXXXXXXXXXXXXXXXERIPVEVEDQDDNS 224
                    YG+     R +   R   +                   +R+P  ++D    S
Sbjct: 183  RSGRSARGYGTSRSPTRQSQNRRENANQVFGTSPHSSSSSSRYSYRDRVPAGIDDDSGQS 242

Query: 225  LDVHXXXXXXXXXXXNTSNYGGNEGSVNPHDDTTQRKSQNHHEFLKPQYHDKFYPEFKAD 284
            +                 +   N  S +   +T ++ S  H E+LKPQYHD+F+P+    
Sbjct: 243  MHSEHSSESGDSDRRFLDDEDRNS-SQDQASETKKKTSSYHAEYLKPQYHDRFFPQNIPH 301

Query: 285  RHIQRAYISEEDMVIVIAGYKTSKFMSLVYNLLCIFTLGGLFLIGKWLPKYKVRIVGRKA 344
               QR YI+EED+V+ IAG++TSKF  + Y L+ + TLG  +L+ +W+P+YKVR+ G+K 
Sbjct: 302  LQFQRFYIAEEDLVVGIAGFRTSKFGKICYYLMSVITLGLFYLLLRWVPRYKVRLCGKKT 361

Query: 345  PLAKAEWLVLENEHGEFTIEEPTREWYNRTLSTILMLDSKTE-TEEFEHGFQRHHHTSEE 403
             LAKAEW+V+ENE GE +I E +R WYNR LST+L +D   + TE+  +  QRHHH S+E
Sbjct: 362  HLAKAEWVVVENEFGELSIIEVSRRWYNRPLSTLLSMDKIADITEDIPNHHQRHHHESKE 421

Query: 404  NPNLPILISFQYRYIKFVYSPLDDIFKTNNNWVDFDWVDLETTSKGLSSGIQEDRVLAFD 463
            NPN+PI+ISF YRY   +YSP++D+FK N+NW D DW+ L +  KGL + + EDR+LAF 
Sbjct: 422  NPNIPIMISFSYRYFNLIYSPIEDLFKINSNWTDADWLSLSSIQKGLPTSVVEDRMLAFG 481

Query: 464  KNQINLKMKTTSQILFDEVLHPFYIFQVLSIILWSLDEYYYYAGCXXXXXXXXXXXXXXE 523
            +N INLK KT+ +ILFDEVLHPFY+FQ+ SI+LW  D YYYYA C              E
Sbjct: 482  RNNINLKQKTSLEILFDEVLHPFYVFQIFSILLWLADNYYYYAACIFIISMLSIIDTLVE 541

Query: 524  TKKISRTLAEMSHFNCEVRVLREGFWSSIHSSELVPGDIYEISDPNLNLLPCDSILLSGD 583
            TKK S+ LAE+SH +CEVRV R+GFW  + SSELVPGD+YEISDP+L+  PCDS+LLSGD
Sbjct: 542  TKKTSQRLAEVSHSHCEVRVYRDGFWVQVSSSELVPGDVYEISDPSLSTFPCDSLLLSGD 601

Query: 584  CIVNESMLTGESVPVSKYPASEETILQLFDDFQSTQISTFLSKSFLFNGTTLIRAKIPNG 643
            CIVNESMLTGESVPVSK PAS+ETI QL +DFQ TQIS FL+KSFLFNGT +IR +I   
Sbjct: 602  CIVNESMLTGESVPVSKIPASDETIYQLLEDFQKTQISNFLAKSFLFNGTKIIRVRIGGE 661

Query: 644  GSVALAMAVRTGFSTTKGSLIRSMVFPKPSGFKFYSDSFKYXXXXXXXXXXXXXXXCINF 703
             S ALAM VRTGFSTTKGSL+RSM+FPKPSGFKFY DSFKY               CINF
Sbjct: 662  QSTALAMVVRTGFSTTKGSLLRSMIFPKPSGFKFYEDSFKYIGFMTLIALAGFSISCINF 721

Query: 704  IKLGLDKRTMILRALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNIGGKI 763
            I+LGL  + MILRALDIITIVVPPALPATL+IG SFA+ RLK+KGIFCIAPTRVN+ GKI
Sbjct: 722  IRLGLAYKVMILRALDIITIVVPPALPATLSIGASFAIARLKKKGIFCIAPTRVNVSGKI 781

Query: 764  DVMCFDKTGTLTEDGLDVLGVRVSCAATRNKASFSDLISDTHDIFPKFSLKDCSNPDDYK 823
            DVMCFDKTGTLTEDGLDVLGV V+         F  LI++   +F K+SL DC +P D+K
Sbjct: 782  DVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGALITNVRGLFNKYSLNDCGSPIDFK 841

Query: 824  RRNFLISLLTCHSLRVVDGELLGDPLDFKMFQFTGWSYEEDFQNHQFHSLYEERHEGQNF 883
             RNFL+SLLTCHSLRVVDGELLGDPLDFKMFQFT WSY EDFQ+ +FHSL EER+     
Sbjct: 842  SRNFLVSLLTCHSLRVVDGELLGDPLDFKMFQFTNWSYAEDFQDFKFHSLNEERNNKSTL 901

Query: 884  PENNDIIPAIVHPNDSDERNKFVQNDPNNILGIIRSFEFLSELRRMSVIVKPNNENVYWA 943
            PEN  I PA+VHPN     NKF +NDP+N+LG+IRSFEF+SELRRMSVIVKP  ENV+W 
Sbjct: 902  PENAGIAPAVVHPNAESTENKFTENDPHNLLGVIRSFEFVSELRRMSVIVKPYGENVFWG 961

Query: 944  YTKGAPEVIIDICNPATLPSDYDDILNFYTHSGYRVIACAGKTLPKNTWLYSQKVRREEV 1003
            +TKGAPEVI +ICN +TLP++Y+ IL  YTH+GYRVIACAGKTLPK TW ++QKV REEV
Sbjct: 962  FTKGAPEVISEICNKSTLPANYEQILQQYTHNGYRVIACAGKTLPKRTWRFAQKVSREEV 1021

Query: 1004 ESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRV 1063
            ESNMEFLGF++F+NKLK +T+PTL+ L+ A IR++MCTGDNVLTAISVG+E  LITE  V
Sbjct: 1022 ESNMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESHV 1081

Query: 1064 YVPTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQD 1123
            +VP +  +    + +I W ++ + + ILD  TL+P++  S  YT+A+TG+VFR++F N +
Sbjct: 1082 FVPQINDNMDPNEDLIIWRDVDDCDLILDGVTLEPMNG-SSDYTIAVTGDVFRLLFKNNE 1140

Query: 1124 NYSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALKAADVGIS 1183
               E Y+N +LLK SI+ARMSPDEKHELV QLQ +DY VGFCGDGANDCGALKAADVG+S
Sbjct: 1141 VLPESYINMVLLKSSIYARMSPDEKHELVGQLQGLDYVVGFCGDGANDCGALKAADVGVS 1200

Query: 1184 LSEAEASVAAPFTSKIFDITCVLDVIKEGRASLVTSFACFQYMSLYSAIQFISITILYSR 1243
            LSEAEASVAAPFTS +F+I+C+LDVIKEGRASL TSF+CFQYMSLYSAIQF+++T+LYSR
Sbjct: 1201 LSEAEASVAAPFTSSVFEISCILDVIKEGRASLTTSFSCFQYMSLYSAIQFVTVTMLYSR 1260

Query: 1244 GSNLGDFQFLYIDLLLIIPIAVTMSWSKPYHELAKKRPSANLVSPKILVPLILDIVFLFL 1303
            G NLGDFQFLYIDL LI+PIA+ MSWSKPYH+L KKRPSANLVSPKIL PL+ +I  + +
Sbjct: 1261 GINLGDFQFLYIDLFLIVPIAIFMSWSKPYHKLVKKRPSANLVSPKILAPLVANIAIILV 1320

Query: 1304 FQFLPWIWIQGRPWYIKPIVGGDDAVQSSDNTVLFYISNFQYILTSVVLSIGPPYREPVH 1363
            FQ  PW+ +Q   WY  P+VGGDDAVQSSDNTVLF+ SNFQY+LT++VLS+GPPYREP+ 
Sbjct: 1321 FQATPWLVVQAMRWYQAPVVGGDDAVQSSDNTVLFFFSNFQYVLTAIVLSVGPPYREPMS 1380

Query: 1364 HNVQYVRDIALSVLVSFVIMLVNPDSKLGNLLQLTSIPTGLIILIPIWCMLNYYVLTHVP 1423
             N+ ++ D+ +S++++ V+M+V  DS LG + QLT I +G    + IW +LNY+   ++P
Sbjct: 1381 KNLGFITDVVISIILNVVLMMVPVDSTLGKVFQLTDISSGFKGYLLIWAVLNYFAQLYIP 1440

Query: 1424 PKVKQYF 1430
             + K  F
Sbjct: 1441 CRCKGLF 1447

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score = 1635 bits (4234), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 808/1427 (56%), Positives = 1017/1427 (71%), Gaps = 29/1427 (2%)

Query: 10   SHAQRTRASFSSARSNATSATLTSSVIIDHNNSESYAGAAFEAVPSSIVSFHRPHSFQSS 69
            S  +  R SFSS R+ +++ T TSS I++ NN+E Y+GAA E VPSSIVSF+ PHSFQSS
Sbjct: 14   SANKSARPSFSSTRTGSSANTTTSSAILEQNNTEPYSGAAVETVPSSIVSFYHPHSFQSS 73

Query: 70   HMMGSSLNSNMLERTTGAIHETEPLYQGNDHXXXXXXXXXXXXX--TDEQVSQAEGI-AT 126
                S+ +S  LER  G   E +PL                     T+EQV  AEGI ++
Sbjct: 74   GYGASAGSSTNLERR-GRSSEHDPLLLSTTTSRRSSSSRGRGFQFFTEEQVENAEGITSS 132

Query: 127  LENTDYDIDWDAAPAYEQENRAGSYMGXXXXXXXXXXXXXXXXXXPYGSIDHRGRSASKS 186
            +EN DYD+DWDA P YEQE                          P        + + +S
Sbjct: 133  VENADYDMDWDAIPTYEQERLHIQPRSSKTSLRQDGNDYAMRTFTP------NRKYSVRS 186

Query: 187  RPRYDXXXXXXXXXXXXXXXXXXXERIPVEVEDQDDNSLDVHXXXXXXXXXXXNTSNYGG 246
            R   D                   +RIP E+E    + +D             +      
Sbjct: 187  RKSEDRLYSTSPRSSSSSSRYTLRDRIPAELEISTTHDVDDSELRSSASSESEDEEAEAN 246

Query: 247  NEGSVNPHDDTTQRKSQNHHEFLKPQYHDKFYPEFKADRHIQRAYISEEDMVIVIAGYKT 306
            ++ +    +D  Q K   H EFLKPQYH +F+P      H QR YI+EED+V+ IAGY+T
Sbjct: 247  DDYNSRAEEDQEQNKKSYHSEFLKPQYHSRFFPNNVPYLHYQRFYIAEEDLVVAIAGYRT 306

Query: 307  SKFMSLVYNLLCIFTLGGLFLIGKWLPKYKVRIVGRKAPLAKAEWLVLENEHGEFTIEEP 366
            S+F    Y LLCI TLG  FL+ +W P  +V+++G K PL KAEW+V+ENE GE T+E  
Sbjct: 307  SRFRLQCYYLLCIITLGLAFLVFRWKPTMRVKMIGEKTPLGKAEWVVVENEFGELTVESV 366

Query: 367  TREWYNRTLSTILML--DSKTETEEFEHGFQRHHHTSEENPNLPILISFQYRYIKFVYSP 424
             R WYNR LST+LM   + +  T E  H    HHH +E NPNLPILISFQYRY   VYSP
Sbjct: 367  KRRWYNRPLSTVLMETNEDRIGTPESRH---YHHHETEWNPNLPILISFQYRYFTLVYSP 423

Query: 425  LDDIFKTNNNWVDFDWVDLETTSKGLSSGIQEDRVLAFDKNQINLKMKTTSQILFDEVLH 484
            +DDIF++N+NW D DW+DLE    GL+S IQEDR LAF KN +NLK KT ++ILFDE LH
Sbjct: 424  IDDIFRSNSNWADPDWLDLEVVQHGLTSSIQEDRTLAFGKNSVNLKQKTVTEILFDEALH 483

Query: 485  PFYIFQVLSIILWSLDEYYYYAGCXXXXXXXXXXXXXXETKKISRTLAEMSHFNCEVRVL 544
            PFY+FQ+ SIILW  D+YYYYAGC              ETKK S  LA++SHFNCEVRV 
Sbjct: 484  PFYVFQIFSIILWLADDYYYYAGCIFLISVLSIIDTVIETKKNSEKLADISHFNCEVRVY 543

Query: 545  REGFWSSIHSSELVPGDIYEISDPNLNLLPCDSILLSGDCIVNESMLTGESVPVSKYPAS 604
            ++ FW+ ++SS+LVPGD++EISDP+L +LPCD++L+SGDCIVNESMLTGESVPVSKY A+
Sbjct: 544  KDRFWTQVNSSDLVPGDLFEISDPSLVVLPCDAVLISGDCIVNESMLTGESVPVSKYAAT 603

Query: 605  EETILQLFDDFQSTQISTFLSKSFLFNGTTLIRAKIPNGGSVALAMAVRTGFSTTKGSLI 664
            E T+ QL  DF+S+Q+S+F+SKSFLFNGT +IR +   G  +ALA+ +RTGFSTTKGSL+
Sbjct: 604  EATMAQLLQDFKSSQVSSFVSKSFLFNGTKIIRVRNQPGQGMALALVIRTGFSTTKGSLV 663

Query: 665  RSMVFPKPSGFKFYSDSFKYXXXXXXXXXXXXXXXCINFIKLGLDKRTMILRALDIITIV 724
            RSMVFPKP GFKFY DSFKY               CI FI+LGL+ + MILRALDIITIV
Sbjct: 664  RSMVFPKPVGFKFYEDSFKYIGFMTLIAMFGFSISCIQFIRLGLEYKVMILRALDIITIV 723

Query: 725  VPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNIGGKIDVMCFDKTGTLTEDGLDVLGV 784
            VPPALPATLTIGTSFAL RLK+KGIFCI+PTRVN+GGK+D+MCFDKTGTLTE+GLDVLG+
Sbjct: 724  VPPALPATLTIGTSFALGRLKKKGIFCISPTRVNVGGKVDMMCFDKTGTLTEEGLDVLGI 783

Query: 785  RVSC-AATRNKASFSDLISDTHDIFPKFSLKDCSNPDDYKRRNFLISLLTCHSLRVVDGE 843
              +    +      SDLI+D  ++  K +L DC++ +++K +NFL+SLLTCHSL+ +DGE
Sbjct: 784  HFAKPEGSSTILQLSDLITDCDEVLQKHTLSDCNSAEEFKAKNFLVSLLTCHSLKHIDGE 843

Query: 844  LLGDPLDFKMFQFTGWSYEEDFQNHQFHSLYEERHEGQNFPENNDIIPAIVHPNDSDERN 903
            LLGDPLD KMF+FT W+YEE +++ +F          +N  +   I PA+VHP  +    
Sbjct: 844  LLGDPLDLKMFEFTKWAYEEGYESWKF----------KNAEDKTGISPAVVHPTSN---C 890

Query: 904  KFVQNDPNNILGIIRSFEFLSELRRMSVIVKPNNENVYWAYTKGAPEVIIDICNPATLPS 963
             F++NDP+N++G+IRSFEFLSELRRMSVIVK   EN YW++TKGAPEVI DICNPAT+P 
Sbjct: 891  NFIENDPDNLIGVIRSFEFLSELRRMSVIVKGFKENTYWSFTKGAPEVIADICNPATIPK 950

Query: 964  DYDDILNFYTHSGYRVIACAGKTLPKNTWLYSQKVRREEVESNMEFLGFIIFQNKLKDAT 1023
            D+ ++L+ YTH+G+R+IACAGKTLPK++WLYSQKV REEVE N+EFLGFI+F+NKLK  T
Sbjct: 951  DFHELLHHYTHNGFRIIACAGKTLPKSSWLYSQKVSREEVEDNLEFLGFIVFENKLKSRT 1010

Query: 1024 SPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHWNE 1083
               L +L+ ANIRTVMCTGDNVLTA+SVG++  LI+ +RV++P +  +    + ++ W +
Sbjct: 1011 KAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRD 1070

Query: 1084 ISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQDNYSEEYVNEILLKGSIFARM 1143
            +     +LD  TL+P++D    YTLAITG++FRI+F N +   ++Y++ +L+KGSI+ARM
Sbjct: 1071 VDEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARM 1130

Query: 1144 SPDEKHELVEQLQKMDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSKIFDIT 1203
            SPDEKHELVEQLQK+DY VGFCGDGANDCGALKAA++GISLSEAEASVAAPFTS +FDI+
Sbjct: 1131 SPDEKHELVEQLQKLDYNVGFCGDGANDCGALKAANIGISLSEAEASVAAPFTSAVFDIS 1190

Query: 1204 CVLDVIKEGRASLVTSFACFQYMSLYSAIQFISITILYSRGSNLGDFQFLYIDLLLIIPI 1263
            CVLDVIKEGRASLVTSF+CFQYMSLYSAIQFI+ITILYSRGSNLGDFQFLYIDLLLI+PI
Sbjct: 1191 CVLDVIKEGRASLVTSFSCFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLLIVPI 1250

Query: 1264 AVTMSWSKPYHELAKKRPSANLVSPKILVPLILDIVFLFLFQFLPWIWIQGRPWYIKPIV 1323
            A++MSWSKP  +L KKRPSANLVSPKILVPL L+I  + +FQ LPWI +Q   WY+KP+V
Sbjct: 1251 AISMSWSKPNSKLVKKRPSANLVSPKILVPLCLNITLILIFQLLPWIAVQYTSWYMKPVV 1310

Query: 1324 GGDDAVQSSDNTVLFYISNFQYILTSVVLSIGPPYREPVHHNVQYVRDIALSVLVSFVIM 1383
            GGDDAVQSSDNTVLF++SNFQYILT+VVLS GPPYREP+  N+ ++ DI+LS+LVSF +M
Sbjct: 1311 GGDDAVQSSDNTVLFFVSNFQYILTAVVLSQGPPYREPMIKNIGFILDISLSMLVSFGLM 1370

Query: 1384 LVNPDSKLGNLLQLTSIPTGLIILIPIWCMLNYYVLTHVPPKVKQYF 1430
             +N  + LG LLQLT+I      LI      NYY   ++P K K  F
Sbjct: 1371 YLNVQTWLGELLQLTNISDTFKWLILTTAAANYYASKYIPEKFKHLF 1417

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score = 1605 bits (4155), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 814/1443 (56%), Positives = 1015/1443 (70%), Gaps = 48/1443 (3%)

Query: 9    SSHAQRTRASFSSARSNATSATLTSSVIIDHNNSESYAGAAFEAVPSSIVSFHRPHSFQS 68
            SS+  R RASFSS ++ ++S T+TSS I++  NSE+YAGA+FEAVPSSIVSFH PHS++S
Sbjct: 12   SSNNARFRASFSSTKTTSSSNTMTSSTILEQRNSEAYAGASFEAVPSSIVSFHHPHSYRS 71

Query: 69   SHMMGSSLNSNMLERTTGAIHETEPLY-----QGNDHXXXXXXXXXXXXXTDEQVSQAEG 123
                G+  + +MLER+         L      + ++              +++Q+  AEG
Sbjct: 72   ----GAFGSVDMLERSRRNTGSESVLLSPVRSRTSEISRTPSRATHFRFFSEQQLENAEG 127

Query: 124  IA-TLENTDYDIDWDAAPAYEQEN-----RAGSYMGXXXXXXXXXXXXXXXXXXPYGSID 177
             A TLE TDYD DWDA PAYEQE      R+                        YG++D
Sbjct: 128  AASTLEYTDYDTDWDATPAYEQERLHMNPRSSRSSLRNGSVGRGPSSTRAQSIQSYGAMD 187

Query: 178  -HRGRSA-SKSRPRYDXXXXXXXXXXXXXXXXXXXERIPVEVED-------QDDNSLDVH 228
             HRGR+      PR                     ERIP+EVE+        DDN    H
Sbjct: 188  NHRGRAPYDGGSPR----------SSSSSSQYTFRERIPIEVEEEVGSVELADDNISSGH 237

Query: 229  XXXXXXXXXXXNTSNYGGNEGSVNPHDDTTQRKSQNHHEFLKPQYHDKFYPEFKADRHIQ 288
                       + + +  +E S          K   H E+LKP+YHD+FYP      H+Q
Sbjct: 238  SDAESEDGLLNDDNRFTIDEVS---EPQYVSGKKAYHAEYLKPRYHDRFYPRNVPHLHMQ 294

Query: 289  RAYISEEDMVIVIAGYKTSKFMSLVYNLLCIFTLGGLFLIGKWLPKYKVRIVGRKAPLAK 348
            R YI+EEDMV+ IAGY+TS + + +YN+ C  TLG L+++ KW+P+YKV+  G K  L K
Sbjct: 295  RFYIAEEDMVVGIAGYRTSAWKTYIYNIFCCLTLGMLYILCKWIPRYKVKFCGSKTFLGK 354

Query: 349  AEWLVLENEHGEFTIEEPTREWYNRTLSTILMLDSKTETEEFEHGFQRHHHTSEENPNLP 408
            AEW+V+EN++ E +I    R WYNR LST+L L             + +HH SEENPN+P
Sbjct: 355  AEWVVVENQYSELSIINVKRIWYNRPLSTVLPLKRGLLNS------RHYHHESEENPNIP 408

Query: 409  ILISFQYRYIKFVYSPLDDIFKTNNNWVDFDWVDLETTSKGLSSGIQEDRVLAFDKNQIN 468
            ILISF+YRY+  +YSPL DIF+TN NW D DW DL   S+GL + I EDR++AF KN IN
Sbjct: 409  ILISFEYRYLTLIYSPLTDIFQTNTNWADPDWTDLSLVSRGLPNNIHEDRMIAFGKNSIN 468

Query: 469  LKMKTTSQILFDEVLHPFYIFQVLSIILWSLDEYYYYAGCXXXXXXXXXXXXXXETKKIS 528
            L+ KTTSQILFDE LHPFYIFQ+ SIILW  D YYYYA C              ETK+ S
Sbjct: 469  LRQKTTSQILFDEALHPFYIFQIFSIILWMFDAYYYYATCIFIISVLSVIDTLVETKQSS 528

Query: 529  RTLAEMSHFNCEVRVLREGFWSSIHSSELVPGDIYEISDPNLNLLPCDSILLSGDCIVNE 588
              L+E+S F C+VRV R+GFWS + SS+LVPGDIYE++DP+L+LLPCDSIL+SGDC+VNE
Sbjct: 529  ERLSELSQFYCDVRVYRDGFWSQVPSSDLVPGDIYELTDPSLSLLPCDSILISGDCLVNE 588

Query: 589  SMLTGESVPVSKYPASEETILQLFDDFQSTQISTFLSKSFLFNGTTLIRAKIPNGGSVAL 648
            SMLTGESVPVSK  A+ ET+LQL DDF  TQ+S+F+SKSFLFNGT LIR +   G S+AL
Sbjct: 589  SMLTGESVPVSKVAATRETMLQLLDDFMDTQLSSFVSKSFLFNGTKLIRVRATAGQSIAL 648

Query: 649  AMAVRTGFSTTKGSLIRSMVFPKPSGFKFYSDSFKYXXXXXXXXXXXXXXXCINFIKLGL 708
             M  RTGFSTTKGSL+RSMVFPKP+GFKFY DSFKY                I F++LGL
Sbjct: 649  GMVARTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGYISIIALFGFAVSFIQFLRLGL 708

Query: 709  DKRTMILRALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNIGGKIDVMCF 768
            DKRTMILRALDIIT+VVPPALPA+L+IGT FALNRLK+KGIFCI+PTRVN+GGKIDVMCF
Sbjct: 709  DKRTMILRALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNVGGKIDVMCF 768

Query: 769  DKTGTLTEDGLDVLGVRVSCAATRNKASFSDLISDTHDIFPKFSLKDCSNPDDYKRRNFL 828
            DKTGTLTEDGLDVLGV V     + +   S L++D  D+    SL DC +  D K +NFL
Sbjct: 769  DKTGTLTEDGLDVLGVHV-VQPLQQEMKISKLVTDVKDLLQSLSLSDCVSTRDMKAKNFL 827

Query: 829  ISLLTCHSLRVVDGELLGDPLDFKMFQFTGWSYEEDFQNHQFHSLYEERHEGQNFPENND 888
            +SLLTCHSLR+VDGELLGDP DFKM QFT WS EE+  N + HSLYEERH+G   PEN+ 
Sbjct: 828  VSLLTCHSLRMVDGELLGDPFDFKMVQFTKWSDEEETGNRKVHSLYEERHDGSTMPENSR 887

Query: 889  IIPAIVHPNDSDERNKFVQNDPNNILGIIRSFEFLSELRRMSVIVKPNNENVYWAYTKGA 948
              PAIVHP+    + +F++ +P+N++GI+RSFEFLS LRRMSVIVKP +ENV+ ++TKGA
Sbjct: 888  FAPAIVHPSG---KGRFIEREPSNVIGIVRSFEFLSNLRRMSVIVKPFSENVFMSFTKGA 944

Query: 949  PEVIIDICNPATLPSDYDDILNFYTHSGYRVIACAGKTLPKNTWLYSQKVRREEVESNME 1008
            PEVI ++C+  TLP DY+ +L+ YTH+GYRVIACAGK L + +WLYSQKV REE+ESN+E
Sbjct: 945  PEVIFELCSKQTLPLDYEALLHHYTHNGYRVIACAGKKLTRQSWLYSQKVSREEIESNLE 1004

Query: 1009 FLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTV 1068
            FLGFIIF+NKLK  T  TL  L  A+IRT+MCTGDNVLTAISVG+E  L+   RV+V  +
Sbjct: 1005 FLGFIIFENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVI 1064

Query: 1069 AYSDMTVQ-PVIHWNEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQDNYSE 1127
               D + +  +I W  ++N+   LD+ TL+P+   +  YTLA+TGEVFR++F    +  E
Sbjct: 1065 NDIDTSQEGDIITWQNVANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIE 1124

Query: 1128 EYVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALKAADVGISLSEA 1187
            E +N ILLK SI+ARMSPDEKHELVE+LQ + Y VGFCGDGANDCGALKAAD+GISLSEA
Sbjct: 1125 EVINNILLKTSIYARMSPDEKHELVERLQSIGYQVGFCGDGANDCGALKAADIGISLSEA 1184

Query: 1188 EASVAAPFTSKIFDITCVLDVIKEGRASLVTSFACFQYMSLYSAIQFISITILYSRGSNL 1247
            EASVAAPFTS++F+I+CVLDV+KEGRA+LVTSFACFQYMSLYSA QF++I ILYSRGSNL
Sbjct: 1185 EASVAAPFTSRLFEISCVLDVMKEGRAALVTSFACFQYMSLYSATQFVTILILYSRGSNL 1244

Query: 1248 GDFQFLYIDLLLIIPIAVTMSWSKPYHELAKKRPSANLVSPKILVPLILDIVFLFLFQFL 1307
            GDFQFLYIDL LI+P+AV MSWSKPY  LAKKRP+ANLVSPKIL+PL++ IV LF+FQ +
Sbjct: 1245 GDFQFLYIDLFLIVPLAVFMSWSKPYEVLAKKRPTANLVSPKILIPLLVHIVILFVFQLV 1304

Query: 1308 PWIWIQGRPWYIKPIVGGDDAVQSSDNTVLFYISNFQYILTSVVLSIGPPYREPVHHNVQ 1367
            PW+ +Q   WY +P+VG D+ V SSDNT+LF++SNFQYIL +VVLS+GPPYREP+  NV 
Sbjct: 1305 PWLAVQHMKWYRQPVVGDDEHVASSDNTILFFVSNFQYILVAVVLSVGPPYREPMSKNVG 1364

Query: 1368 YVRDIALSVLVSFVIMLVNPDSKLGNLLQLTSIPTGLIILIPIWCMLNYYVLTHVPPKVK 1427
            ++ D+ +S++ S  IM ++PDS LG L QLT       +LI  W  LNYY   ++PP  K
Sbjct: 1365 FIADVLVSLVASCRIMFLSPDSTLGRLFQLTEASHPFCLLIIGWVFLNYYAQLYIPPAFK 1424

Query: 1428 QYF 1430
              F
Sbjct: 1425 TLF 1427

>CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharomyces
            cerevisiae YEL031w SPF1 P-type ATPase, hypothetical start
          Length = 1214

 Score =  288 bits (738), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 216/743 (29%), Positives = 343/743 (46%), Gaps = 106/743 (14%)

Query: 462  FDKNQINLKMKTTSQILFDEVLHPFYIFQVLSIILWSLDEYYYYAGCXXXXXXXXXXXXX 521
            +  N+ ++ + T  ++  +  + P ++FQV  + LW LDEY+Y +               
Sbjct: 175  YGNNEFDIPIPTFLELFKEHAVAPLFVFQVFCVALWLLDEYWYLS------LFNLFMILS 228

Query: 522  XETKKISRTLAEMSHFNC------EVRVLREGFWSSIHSSELVPGDIYEI-SDPNLNLLP 574
             E   + + L  +  F         + VLR+G W  + ++EL+P D+  +      + LP
Sbjct: 229  MEAASVFQRLTALKEFRTMGVKPYAINVLRDGKWVEMQTNELLPMDVVSVVRTAEDSALP 288

Query: 575  CDSILLSGDCIVNESMLTGESVPVSKYPASEETILQLFDDFQSTQISTFLSKSFLFNGTT 634
            CD IL+ G CIVNE+ML+GES P+ K     E+I +L    +  QI      S L  GT 
Sbjct: 289  CDLILVDGTCIVNEAMLSGESTPLLK-----ESI-RLRPGNEELQIEGTDKISVLHGGTK 342

Query: 635  LIRAKIP----------NGGSVALAMAVRTGFSTTKGSLIRSMVFPKPSGFKFYSDSFKY 684
            +++   P          +GG  A+A+  +TGF T++GSL+R M++          ++  +
Sbjct: 343  VLQVTTPEKTGKVPSPPDGG--AIAIVTKTGFETSQGSLVRVMIYSSERVGVDNKEALYF 400

Query: 685  XXXXXXXXXXXXXXXCINFIKLGLDKRTMILRALDIITIVVPPALPATLTIGTSFALNRL 744
                            +   K+G  +  +IL  + IIT VVPP LP  LT+  + +L+ L
Sbjct: 401  ILFLLIFAVVASWYVWVEGTKMGRVQSKLILDCILIITSVVPPELPMELTMAVNSSLSAL 460

Query: 745  KEKGIFCIAPTRVNIGGKIDVMCFDKTGTLTEDGLDVLGVRVSCAATRNKASFSDLISDT 804
             +  ++C  P R+   G+IDV CFDKTGTLT + L   G+             + L SD 
Sbjct: 461  SKFYVYCTEPFRIPFAGRIDVCCFDKTGTLTGEDLVFEGL-------------AGLSSDP 507

Query: 805  HDIFPKFSLKDCSNPDDYKRRNFLISLLTCHSL-RVVDGELLGDPLDFKMFQFTGWSYEE 863
             DI   +S  DC N          + +   H+L R+ DGE++GDP++    +   W+   
Sbjct: 508  KDIRHLYSATDCPNSTS-------LVVGAAHALVRLEDGEIVGDPMEKATLKALKWTV-- 558

Query: 864  DFQNHQFHSLYEERHEGQNFPENNDIIPAIVHPNDSDERNKFVQNDPNNILGIIRSFEFL 923
                                                 E+   V N+ N  + I+R F+F 
Sbjct: 559  -------------------------------------EKGDKVFNEKNGQVTILRRFQFS 581

Query: 924  SELRRMSVIVKPNNENVYWAYTKGAPEVIIDICNPATLPSDYDDILNFYTHSGYRVIACA 983
            S L+R S +    ++   ++  KGAPE I +     T+P++YD+I   +T SG RV+A A
Sbjct: 582  SALKRSSSVA--THDGKLYSAVKGAPETIRE--RLFTIPANYDEIYKSFTRSGSRVLALA 637

Query: 984  GKTLPKNTWLYSQKVRREEVESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGD 1043
             K L K +    +   RE  E ++EF GF+IF   LK     T+  L  +  R VM TGD
Sbjct: 638  SKKLEKMSQSQIEDADREHFERDLEFNGFLIFHCPLKHDAIETIQMLNESAHRCVMITGD 697

Query: 1044 NVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHWNEISNAEHIL--DTFTLQPIDD 1101
            N LTA+ V KE  ++  + + V  V   +       +  E  + E ++  D+F    I D
Sbjct: 698  NPLTAVHVAKEVGIVKGETLIVDMVDNGNDDKLVFRNVEETLSFEFVVSKDSFEKYGIFD 757

Query: 1102 YSGPYTLAITGEVFRIIFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDYT 1161
                Y LA+TG     +  +        + +++    I+AR+SP +K  ++  L+ M Y 
Sbjct: 758  ---KYDLAVTGHALEALKGHHQ------LQDLIRHAWIYARVSPAQKEFILNNLKDMGYQ 808

Query: 1162 VGFCGDGANDCGALKAADVGISL 1184
               CGDG ND GALK A VG++L
Sbjct: 809  TLMCGDGTNDVGALKQAHVGVAL 831

 Score = 77.0 bits (188), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 54/187 (28%), Positives = 96/187 (51%), Gaps = 9/187 (4%)

Query: 1183 SLSEAEASVAAPFTSKIFDITCVLDVIKEGRASLVTSFACFQYMSLYSAIQFISITILYS 1242
            +L   +AS AAPFTSK+ +++ V ++I++GR +LV +   ++ ++L   I   S++I+Y 
Sbjct: 950  TLKLGDASCAAPFTSKLANVSAVTNIIRQGRCALVNTIQMYKILALNCLISAYSLSIIYM 1009

Query: 1243 RGSNLGDFQFLYIDLLLIIPIAVTMSWSKPYHELAKKRPSANLVSPKILVPLILDIVFLF 1302
             G   GD Q     LLL +   +++S  KP  +L+K RP A + +    V ++  I+  F
Sbjct: 1010 AGVKFGDGQATTSGLLLSVCF-LSISRGKPLQKLSKARPQAGIFN----VYIMGSILSQF 1064

Query: 1303 LFQFLPWIWIQGRPWYIKP----IVGGDDAVQSSDNTVLFYISNFQYILTSVVLSIGPPY 1358
            +      I++    + ++P    +    +   S  NT +F I   Q + T  V   G P+
Sbjct: 1065 VVHIGTLIYLTNEIYRLEPREPQVDLEKEFAPSLLNTGIFIIQLVQQVSTFAVNYQGEPF 1124

Query: 1359 REPVHHN 1365
            RE +  N
Sbjct: 1125 RENIRSN 1131

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
            Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
            start by similarity
          Length = 1206

 Score =  286 bits (731), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 223/795 (28%), Positives = 368/795 (46%), Gaps = 109/795 (13%)

Query: 411  ISFQYRYIKFVYSPLDDIFKTNNNWVDFDWVDLE-TTSKGLSSGIQEDRVLAFDKNQINL 469
            + FQ++  +F++     +F +    VD      E   SKGL+  +   + L + +N  ++
Sbjct: 125  VFFQFQKKRFLWHEETQVFSSPKFLVDGSPKIAEFQNSKGLNGDLTHHKRL-YGENSFDI 183

Query: 470  KMKTTSQILFDEVLHPFYIFQVLSIILWSLDEYYYYAGCXXXXXXXXXXXXXXETKKISR 529
             + T  ++  +  + PF+IFQ+  + LW  D+ +YY+                E   + +
Sbjct: 184  PIPTFLELFKEHAVAPFFIFQLFCVALWLFDDLWYYS------LFNLFMIVAMEATSVFQ 237

Query: 530  TLAEMSHFNC------EVRVLREGFWSSIHSSELVPGDIYEIS-DPNLNLLPCDSILLSG 582
             L  +  F         + V R+G W  + + +L P D+  I+     + +PCD +L+ G
Sbjct: 238  RLTTLKEFRTMGIKPYAINVFRDGKWVEMQTDKLFPMDLVSITRTAEDSAIPCDLLLIDG 297

Query: 583  DCIVNESMLTGESVPVSKYPASEETILQLFDDFQSTQISTFLSKSFLFNGTTLIRAKIP- 641
             CIVNE+ML+GES P+ K    E   L+  +D    Q+      + L  GT  ++   P 
Sbjct: 298  SCIVNEAMLSGESTPLLK----ESIKLRPAND--QLQLDGVDKNAVLHGGTKALQVTAPE 351

Query: 642  ---------NGGSVALAMAVRTGFSTTKGSLIRSMVFPKPSGFKFYSDSFKYXXXXXXXX 692
                     +GG  ALA+  +TGF T++GSL+R M+F          ++  +        
Sbjct: 352  NRTGVITPPDGG--ALAVVTKTGFETSQGSLVRVMIFSAERVDVGNKEALYFILFLLIFA 409

Query: 693  XXXXXXXCINFIKLGLDKRTMILRALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCI 752
                        ++G  +  +IL  + IIT VVPP LP  LT+  + +L  L +  ++C 
Sbjct: 410  IVASWYVWKEGTRMGRIQSKLILDCILIITSVVPPELPMELTMAVNSSLAALSKFYVYCT 469

Query: 753  APTRVNIGGKIDVMCFDKTGTLTEDGLDVLGVRVSCAATRNKASFSDLISDTHDIFPKFS 812
             P R+   G+IDV CFDKTGTLT + L   G+                + D  DI    S
Sbjct: 470  EPFRIPYAGRIDVCCFDKTGTLTAEDLVFEGLAG--------------LHDGSDIRTLKS 515

Query: 813  LKDCSNPDDYKRRNFLISLLTCHSL-RVVDGELLGDPLDFKMFQFTGWSYEEDFQNHQFH 871
              D S       +  L ++   H+L ++ DGE++GDP++    + + W+   DF++    
Sbjct: 516  ANDAS-------QEVLSAIGAAHALVKLDDGEIVGDPMEKATLKASSWTV--DFKD---- 562

Query: 872  SLYEERHEGQNFPENNDIIPAIVHPNDSDERNKFVQNDPNNILGIIRSFEFLSELRRMSV 931
                                 +V    +D             + I+R F+F S L+R + 
Sbjct: 563  ---------------------VVKRAGADN------------IRILRRFQFSSSLKRSAS 589

Query: 932  IVKPNNENVYWAYTKGAPEVIIDICNPATLPSDYDDILNFYTHSGYRVIACAGKTLPKNT 991
            I   +N   ++A  KGAPE I +  N  ++PSDYDDI   +T SG RV+A A K LPK +
Sbjct: 590  IASQSNR--FFAAVKGAPETIRERLN--SVPSDYDDIYKSFTRSGSRVLALAYKDLPKMS 645

Query: 992  WLYSQKVRREEVESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISV 1051
                  + R+E+E+ + F  F++F   LKD    T+  L  ++ R++M TGDN LTA+ V
Sbjct: 646  NSQIDNIDRDEIETGLTFGAFLVFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHV 705

Query: 1052 GKECQLITEDRVYV--PTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDYSGPYTLA 1109
             KE  ++  + + +  P    S   V   ++   +       DTF  + I      Y LA
Sbjct: 706  AKEVGIVDRETLILDEPIDGSSHALVMRDVNETIVKPFNPDADTFDEKEIFQ---KYDLA 762

Query: 1110 ITGEVFRIIFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVGFCGDGA 1169
            +TG   +++  ++       + +++    I+AR+SP +K  ++  L+ M Y    CGDG 
Sbjct: 763  VTGHALKLLQGHKQ------LRDVIRHTWIYARVSPSQKEFILITLKDMGYQTLMCGDGT 816

Query: 1170 NDCGALKAADVGISL 1184
            ND GALK A VGI+L
Sbjct: 817  NDVGALKQAHVGIAL 831

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 104/200 (52%), Gaps = 10/200 (5%)

Query: 1183 SLSEAEASVAAPFTSKIFDITCVLDVIKEGRASLVTSFACFQYMSLYSAIQFISITILYS 1242
            SL   +AS AAPFTSK+ ++  V ++I++GR +L+ +   ++ ++L   I   S++++Y 
Sbjct: 949  SLKLGDASCAAPFTSKLANVNAVTNIIRQGRCALINTIQMYKILALNCLISAYSLSVIYL 1008

Query: 1243 RGSNLGDFQFLYIDLLLIIPIAVTMSWSKPYHELAKKRPSANLVSPKILVPLILDIVFLF 1302
             G   GD Q     LLL +   +++S  KP  +L+K+RP   + +    + ++  I+  F
Sbjct: 1009 AGVKFGDGQATVSGLLLSVCF-LSISRGKPLEKLSKERPQPGIFN----IYIMGSILGQF 1063

Query: 1303 LFQFLPWIWIQGRPWYIKP----IVGGDDAVQSSDNTVLFYISNFQYILTSVVLSIGPPY 1358
                L  ++I    + I+P    +    + V S  NT +F +   Q + T VV   G P+
Sbjct: 1064 AVHILTLVYITTEIYKIEPREPQVDLEKEFVPSLLNTGIFMVQLAQQVSTFVVNYQGEPF 1123

Query: 1359 REPVHHNV-QYVRDIALSVL 1377
            RE + +N   Y   + +SVL
Sbjct: 1124 RENIKNNKGMYYGIVGVSVL 1143

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
            (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score =  281 bits (720), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 216/786 (27%), Positives = 366/786 (46%), Gaps = 93/786 (11%)

Query: 413  FQYRYIKFVYSPLDDIFKTNNNWVDFD-WVDLETTSKGLSSGIQEDRVLAFDKNQINLKM 471
            FQ++  +F++      F +    VD +  +     S+GLS  +   ++L + +N  ++ +
Sbjct: 128  FQFQKKRFLWQADLQAFSSPKFLVDEEPKLGKLQQSRGLSGDLTHMKLL-YGENTFDIPV 186

Query: 472  KTTSQILFDEVLHPFYIFQVLSIILWSLDEYYYYAGCXXXXXXXXXXXXXXETKKISRTL 531
             +  ++  +  + PF++FQ+  + LW  D+ +Y +                +     +  
Sbjct: 187  PSFLELFKEHAVEPFFVFQIFCVALWLFDQMWYLSLFNLFMIFAMEAVSVFQRLTTLKEF 246

Query: 532  AEMSHFNCEVRVLREGFWSSIHSSELVPGDIYEISDPNLN-LLPCDSILLSGDCIVNESM 590
              M      + V R+  W  + ++EL+P D+  ++  + +  L CD IL+ G CIVNE+M
Sbjct: 247  KTMGIKPYGINVFRDSKWQLLQTNELLPMDLISVTRTDEDSALSCDMILVDGTCIVNEAM 306

Query: 591  LTGESVPVSKYPASEETILQLFDDFQSTQISTFLSKSFLFNGTTLIRAKIPNGGSV---- 646
            L+GES P+ K     E++ +L    +  Q+      S L  GT +++   P  GS     
Sbjct: 307  LSGESTPLLK-----ESV-KLRSSEEKLQVEGLDKNSVLHGGTKVLQVTAPEKGSSSIPA 360

Query: 647  -----ALAMAVRTGFSTTKGSLIRSMVFPKPSGFKFYSDSFKYXXXXXXXXXXXXXXXCI 701
                 ALA+  +TGF T++G+L+R M++          ++  +                +
Sbjct: 361  PPDGGALAVVSKTGFETSQGALVRVMIYSSERVSVGNKEALYFILFLLIFAIAASWYVWV 420

Query: 702  NFIKLGLDKRTMILRALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNIGG 761
               ++G  +  +IL  + IIT VVP  LP  LT+  + +L  L +  ++C  P R+ + G
Sbjct: 421  EGTRMGRVQSKLILDCILIITSVVPSELPMELTMAVNNSLAVLSKFYVYCTEPFRIPLAG 480

Query: 762  KIDVMCFDKTGTLTEDGLDVLGVRVSCAATRNKASFSDLISDTHDIFPKFSLKDCSNPDD 821
            +IDV CFDKTGTLT  G D++   ++  A +N+          + +F     K    P D
Sbjct: 481  RIDVCCFDKTGTLT--GEDLVFEGLAGLAGKNQP--------VNHLF-----KGTEVPLD 525

Query: 822  YKRRNFLISLLTCHSL-RVVDGELLGDPLDFKMFQFTGWSYEEDFQNHQFHSLYEERHEG 880
                N +I     H+L R+ D E++GDP++      TGW                     
Sbjct: 526  ---TNLVIG--AAHALVRLDDDEVVGDPMEKATLAATGWK-------------------- 560

Query: 881  QNFPENNDIIPAIVHPNDSDERNKFVQNDPNNILGIIRSFEFLSELRRMSVIVKPNNENV 940
                         V   DS      + N+    + I+R F+F S L+R S I   N +  
Sbjct: 561  -------------VGVKDS------LSNEKVGDISILRRFQFSSALKRSSTIAVHNKQ-- 599

Query: 941  YWAYTKGAPEVIIDICNPATLPSDYDDILNFYTHSGYRVIACAGKTLPKNTWLYSQKVRR 1000
            +++  KGAPE I +    + +P+DYD +   +T +G RV+A A K LP  +    +K+ R
Sbjct: 600  HYSAVKGAPETIRE--RLSQVPTDYDQVYKSFTRAGSRVLALASKKLPSMSIKQIEKLER 657

Query: 1001 EEVESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITE 1060
            E VES++EF GF++F   LKD    T+  L  ++ R +M TGDN LTA+ V KE  ++  
Sbjct: 658  EAVESDLEFKGFLVFHCPLKDDAIETIKMLNESSHRCIMITGDNPLTAVHVAKEVAIVER 717

Query: 1061 DRVYV--PTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRII 1118
            + + +  P    S   V   I    ++      DTF    +      Y +A+TG   +++
Sbjct: 718  ETLILDEPIDGSSHALVFRNIEETIVNPFNPEKDTFEHSKL---FAKYDIAVTGHALQLL 774

Query: 1119 FSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALKAA 1178
              +        +NE++    ++AR+SP +K  ++  L+ M Y    CGDG ND GALK A
Sbjct: 775  SGHSQ------LNELIRHTWVYARVSPAQKEFIMNSLKDMGYQTLMCGDGTNDVGALKQA 828

Query: 1179 DVGISL 1184
             VGI+L
Sbjct: 829  HVGIAL 834

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 56/202 (27%), Positives = 100/202 (49%), Gaps = 13/202 (6%)

Query: 1168 GANDCGALKAADVGISLSEAEASVAAPFTSKIFDITCVLDVIKEGRASLVTSFACFQYMS 1227
            G ND      +D   +L   +AS AAPFTSK+ +++ V ++I++GR +L+ +   ++ ++
Sbjct: 942  GLND----SESDDAPTLKLGDASCAAPFTSKLANVSAVTNIIRQGRCALINTIQMYKILA 997

Query: 1228 LYSAIQFISITILYSRGSNLGDFQFLYIDLLLIIPIAVTMSWSKPYHELAKKRPSANLVS 1287
            L   I   S++++Y  G   GD Q   +  LLI    +++S  +P  +L+K+RP   + +
Sbjct: 998  LNCLITAYSLSVIYLAGVKFGDVQ-ATVSGLLITVCFLSISRGQPLEKLSKERPQPGIFN 1056

Query: 1288 PKILVPLILDIVFLFLFQFLPWIWIQGRPWYIKP----IVGGDDAVQSSDNTVLFYISNF 1343
                V ++  I+  F        +I    ++++P    I    D   S  NT +F I   
Sbjct: 1057 ----VYIMGSILGQFAVHIAALAYINREIYFLEPREPQIDLEKDFSPSLLNTGIFLIQLA 1112

Query: 1344 QYILTSVVLSIGPPYREPVHHN 1365
            Q + T  V   G P+RE +  N
Sbjct: 1113 QQVSTFAVNYQGEPFRENIRSN 1134

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transporting
            ATPase, member of the P-type ATPase superfamily of
            membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score =  280 bits (716), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 221/796 (27%), Positives = 370/796 (46%), Gaps = 114/796 (14%)

Query: 413  FQYRYIKFVYSPLDDIFKTNNNWVDFD-WVDLETTSKGLSSGIQEDRVLAFDKNQINLKM 471
            FQ++  +F++   + +F +    VD    +      KG S  +   + L + +N  ++ +
Sbjct: 128  FQFQKKRFLWHENEQVFSSPKFLVDESPKIGDFQKCKGHSGDLTHLKRL-YGENSFDIPI 186

Query: 472  KTTSQILFDEVLHPFYIFQVLSIILWSLDEYYYYAGCXXXXXXXXXXXXXXETKKISRTL 531
             T  ++  +  + P ++FQV  + LW LDE++YY+                E   + + L
Sbjct: 187  PTFMELFKEHAVAPLFVFQVFCVALWLLDEFWYYS------LFNLFMIISMEAAAVFQRL 240

Query: 532  AEMSHFNC------EVRVLREGFWSSIHSSELVPGDIYEIS-DPNLNLLPCDSILLSGDC 584
              +  F         + V R   W ++ ++EL+P D+  I+     + +PCD ILL G  
Sbjct: 241  TALKEFRTMGIKPYTINVFRNKKWVALQTNELLPMDLVSITRTAEESAIPCDLILLDGSA 300

Query: 585  IVNESMLTGESVPVSKYPASEETILQLFDDFQSTQISTFLSKSFLFNGTTLIRAKIP--- 641
            IVNE+ML+GES P+ K    E   L+  +D  + Q+      + L  GT  ++   P   
Sbjct: 301  IVNEAMLSGESTPLLK----ESIKLRPSED--NLQLDGVDKIAVLHGGTKALQVTPPEHK 354

Query: 642  -------NGGSVALAMAVRTGFSTTKGSLIRSMVFPKPSGFKFYSDSFKYXXXXXXXXXX 694
                   +GG  ALA+  +TGF T++GSL+R M++          ++  +          
Sbjct: 355  SDIPPPPDGG--ALAIVTKTGFETSQGSLVRVMIYSAERVSVDNKEALMFILFLLIFAVI 412

Query: 695  XXXXXCINFIKLGLDKRTMILRALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAP 754
                  +   K+G  +  +IL  + IIT VVPP LP  LT+  + +L  L +  ++C  P
Sbjct: 413  ASWYVWVEGTKMGRIQSKLILDCILIITSVVPPELPMELTMAVNSSLAALAKFYVYCTEP 472

Query: 755  TRVNIGGKIDVMCFDKTGTLTEDGLDVLGVRVSCAATRNKASFSDLISDTHDIFPKFSLK 814
             R+   G+IDV CFDKTGTLT + L   G+             + + +D+ +I   +S  
Sbjct: 473  FRIPFAGRIDVCCFDKTGTLTGEDLVFEGL-------------AGISADSENIRHLYSAA 519

Query: 815  DCSNPDDYKRRNFLISLLTCHSL-RVVDGELLGDPLDFKMFQFTGWSYEEDFQNHQFHSL 873
            +          + ++ +   H+L ++ DG+++GDP++    +  GW+ E    N++    
Sbjct: 520  EAP-------ESTILVIGAAHALVKLEDGDIVGDPMEKATLKAVGWAVERKNSNYR---- 568

Query: 874  YEERHEGQNFPENNDIIPAIVHPNDSDERNKFVQNDPNNILGIIRSFEFLSELRRMSVIV 933
                 EG                                 L IIR F+F S L+R + I 
Sbjct: 569  -----EG------------------------------TGKLDIIRRFQFSSALKRSASIA 593

Query: 934  KPNNENVYWAYTKGAPEVIIDICNPATLPSDYDDILNFYTHSGYRVIACAGKTLPKNTWL 993
              N  +  +A  KGAPE I +    + +P +YD+I   +T SG RV+A A K+LPK +  
Sbjct: 594  SHN--DALFAAVKGAPETIRE--RLSDIPKNYDEIYKSFTRSGSRVLALASKSLPKMSQS 649

Query: 994  YSQKVRREEVESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGK 1053
                + R++VES + F GF+IF   LKD    T+  L  ++ R++M TGDN LTA+ V K
Sbjct: 650  KIDDLNRDDVESELTFNGFLIFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAK 709

Query: 1054 ECQLITEDRVYVPTVAYSDMTVQPVIHWNEISNAEHI-----LDTFTLQPIDDYSGPYTL 1108
            E  ++  + + +     SD      + + ++     I      DTF    + D    Y +
Sbjct: 710  EVGIVFGETLILDRAGKSD---DNQLLFRDVEETVSIPFDPSKDTFDHSKLFDR---YDI 763

Query: 1109 AITGEVFRIIFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVGFCGDG 1168
            A+TG     +    + +S+  + ++L    ++AR+SP +K  L+  L+ M Y    CGDG
Sbjct: 764  AVTGYALNAL----EGHSQ--LRDLLRHTWVYARVSPSQKEFLLNTLKDMGYQTLMCGDG 817

Query: 1169 ANDCGALKAADVGISL 1184
             ND GALK A VGI+L
Sbjct: 818  TNDVGALKQAHVGIAL 833

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/192 (28%), Positives = 97/192 (50%), Gaps = 9/192 (4%)

Query: 1178 ADVGISLSEAEASVAAPFTSKIFDITCVLDVIKEGRASLVTSFACFQYMSLYSAIQFISI 1237
             D   +L   +AS AAPFTSK+ +++ V ++I++GR +LV +   ++ ++L   I   S+
Sbjct: 947  GDEAPALKLGDASCAAPFTSKLANVSAVTNIIRQGRCALVNTIQMYKILALNCLISAYSL 1006

Query: 1238 TILYSRGSNLGDFQFLYIDLLLIIPIAVTMSWSKPYHELAKKRPSANLVSPKILVPLILD 1297
            +I+Y  G   GD Q     LLL +   +++S  KP  +L+K+RP + + +    V ++  
Sbjct: 1007 SIIYMAGVKFGDGQATVSGLLLSVCF-LSISRGKPLEKLSKQRPQSGIFN----VYIMGS 1061

Query: 1298 IVFLFLFQFLPWIWIQGRPWYIKPIVGGDDAVQ----SSDNTVLFYISNFQYILTSVVLS 1353
            I+  F       ++I    + ++P     D  +    S  NT +F I   Q + T  V  
Sbjct: 1062 ILSQFAVHIATLVYITTEIYKLEPREPQVDLEKEFAPSLLNTGIFIIQLVQQVSTFAVNY 1121

Query: 1354 IGPPYREPVHHN 1365
             G P+RE +  N
Sbjct: 1122 QGEPFRENIRSN 1133

>Scas_583.14*
          Length = 875

 Score =  206 bits (523), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 152/541 (28%), Positives = 251/541 (46%), Gaps = 75/541 (13%)

Query: 647  ALAMAVRTGFSTTKGSLIRSMVFPKPSGFKFYSDSFKYXXXXXXXXXXXXXXXCINFIKL 706
            AL +  +TGF T +GSL+R M++          ++  +                +   K+
Sbjct: 19   ALVVVTKTGFETYQGSLVRVMIYSAERVGVDNKEALMFILFLLNFAVVASWYVWVEGTKM 78

Query: 707  GLDKRTMILRALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNIGGKIDVM 766
            G  +  +IL  + IIT VVPP LP  LT+  + +L  L +  ++C  P R+ + G+IDV 
Sbjct: 79   GRIQSKLILDCILIITYVVPPELPMELTMAVNSSLAALSKFYVYCTEPFRIPLAGRIDVC 138

Query: 767  CFDKTGTLTEDGLDVLGVRVSCAATRNKASFSDLISDTHDIFPKFSLKDCSNPDDYKRRN 826
            CFDKTGTLT + L   G+          A  SD   D   +F         + +D  +  
Sbjct: 139  CFDKTGTLTGEDLVFEGL----------AGLSDKSEDVRHLF---------SSEDASQET 179

Query: 827  FLISLLTCHSLRVVDGELLGDPLDFKMFQFTGWSYEEDFQNHQFHSLYEERHEGQNFPEN 886
             L+       +++ DGE++GDP++    +  GW  E                        
Sbjct: 180  ILVVGAAHALVKLDDGEIVGDPMEKATLKALGWKVE------------------------ 215

Query: 887  NDIIPAIVHPNDSDERNKFVQNDPNNILGIIRSFEFLSELRRMSVIVKPNNENVYWAYTK 946
                            N F        L I+R F+F S L+R S +   ++++  +   K
Sbjct: 216  ---------------GNDFTSRPKTGKLQILRRFQFSSALKRSSSVA--SHKDKLFTAVK 258

Query: 947  GAPEVIIDICNPATLPSDYDDILNFYTHSGYRVIACAGKTLPKNTWLYSQKVRREEVESN 1006
            GAPE I +    A +P +YD+I   +T SG RV+A A K+LP  +      + R+E+E+ 
Sbjct: 259  GAPETIRE--RLAVVPKNYDEIYKSFTRSGSRVLALASKSLPNLSSKQLDDLDRDEIETG 316

Query: 1007 MEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYV- 1065
            + F GF++F   LK     T+  L  +  R++M TGDN LTA+ V KE  ++T + + + 
Sbjct: 317  LTFNGFLVFHCPLKPDAVETIKMLNESAHRSIMITGDNPLTAVHVAKEVAIVTGETLILD 376

Query: 1066 --PTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQD 1123
               TV    +    V    +I   +   D F  + + D    Y +A+TG    ++    +
Sbjct: 377  KSETVGDGKLLFFNVEETIKIP-FDPASDKFDHRELFD---KYDIAVTGYALNLL----E 428

Query: 1124 NYSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALKAADVGIS 1183
            ++S+  + +++    ++AR+SP +K  ++  L++M Y    CGDG ND GALK A VG++
Sbjct: 429  DHSQ--LKDLIRHTWVYARVSPSQKEFILNNLKEMGYQTLMCGDGTNDVGALKQAHVGVA 486

Query: 1184 L 1184
            L
Sbjct: 487  L 487

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 54/187 (28%), Positives = 95/187 (50%), Gaps = 9/187 (4%)

Query: 1183 SLSEAEASVAAPFTSKIFDITCVLDVIKEGRASLVTSFACFQYMSLYSAIQFISITILYS 1242
            +L   +AS AAPFTSK+  ++ V ++I++GR +LV +   ++ ++L   I   S++I+Y 
Sbjct: 610  TLKLGDASCAAPFTSKLSKVSAVTNIIRQGRCALVNTIQMYKILALNCLISAYSLSIIYM 669

Query: 1243 RGSNLGDFQFLYIDLLLIIPIAVTMSWSKPYHELAKKRPSANLVSPKILVPLILDIVFLF 1302
             G   GD Q     LLL +   +++S  KP  +L+K+RP   + +    V ++  I+  F
Sbjct: 670  AGVKFGDAQATVSGLLLSVCF-LSISRGKPIQKLSKQRPQKGIFN----VYIMGSILSQF 724

Query: 1303 LFQFLPWIWIQGRPWYIKPIVGGDDAVQ----SSDNTVLFYISNFQYILTSVVLSIGPPY 1358
                   ++I    + ++P     D  +    S  NT +F I   Q + T  V   G P+
Sbjct: 725  AVHIFTLVYITREIYILEPREPQVDLEKEFAPSLLNTGIFIIQLVQQVSTFAVNYQGEPF 784

Query: 1359 REPVHHN 1365
            RE + +N
Sbjct: 785  RENIRNN 791

>Kwal_14.1498
          Length = 939

 Score =  122 bits (307), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 186/821 (22%), Positives = 318/821 (38%), Gaps = 151/821 (18%)

Query: 540  EVRVLREGFWSSIHSSELVPGDI--YEISDPNLNLLPCD-SILLSGDCIVNESMLTGESV 596
            +  ++R G  S + +S LVPGD+  + + D     +P D  I+ + D  + ES LTGE+ 
Sbjct: 147  QCHLIRCGQESKLLASVLVPGDVVRFRVGDR----IPADLRIIEAVDLSIEESNLTGENE 202

Query: 597  PVSKYPASEETILQLFDDFQSTQISTFLSKSFLFNGTTLIRAKIPNGGSVALAMAVRTGF 656
            PV K  A   T+ + F       I     +S +    TL+R    +G  + +  A  T F
Sbjct: 203  PVHKSTA---TVNKEFYKENLGSIVPVSERSCIAFMGTLVREG--HGRGIVIGTAKNTAF 257

Query: 657  STTKGSLIRSMVFPKPSGFKFYSDSFKYXXXXXXXXXXXXXXXCINFIKLGLDKRTMILR 716
                G +   M   +       +   K                C+  +  G     M   
Sbjct: 258  ----GKVFEMMNAIEKPKTPLQTAMDKLGKDLSFMSFIVIGIICLIGVIQGRSWLEMFQI 313

Query: 717  ALDIITIVVPPALPATLTIGTSFALNRL-KEKGIFCIAPTRVNIGGKIDVMCFDKTGTLT 775
            ++ +    +P  LP  +T+  +  + R+ K + I    P+ V   G ++V+C DKTGTLT
Sbjct: 314  SVSLAVAAIPEGLPIIVTVTLALGVLRMAKRRAIIRRLPS-VETLGSVNVICSDKTGTLT 372

Query: 776  EDGLDVLGVRVSC-AATRNKASFSDLISDTHDIFPKFSLKDCSNPDDYKRRNFLISLLTC 834
             + + V   +V C  +  NK++   L   T   F K   +D       +  N   +    
Sbjct: 373  ANHMSV--NKVWCLGSMSNKSNILKLDKATSGSFKKNLTEDLRAT--LRTGNLCNNSTYS 428

Query: 835  HSLRVVDGELLGDPLDFKMFQFTGWSYEEDFQNHQFHSLYEERHEGQNFPENNDIIPAIV 894
            H       + LG+P D  + +            H+F                        
Sbjct: 429  HE----HAKYLGNPTDIALLEVL----------HKF------------------------ 450

Query: 895  HPNDSDERNKFVQNDPNNILGIIRSFEFLSELRRMSVIVKPNNENVYWAYTKGAPEVIID 954
                 DER +  ++D            F S+ + M+V VK  N   +  + KGA E I++
Sbjct: 451  --GLEDERPQVTRSD---------EISFNSKRKFMAVKVKEANGK-FVVHVKGAYEKILE 498

Query: 955  ------------ICNPATLPSDYDDILNFYTHSGYRVIACAGKTLPKNTWLYSQKVRREE 1002
                        +   + L     D  +     G R +A A   L       S+K+  ++
Sbjct: 499  KSTHFINAENKVVKLDSNLRQAITDSADALASDGLRTLAFAQLELSNGN---SKKLTEDD 555

Query: 1003 VESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDR 1062
            + + + F G +   +  + +    + +L   ++  +M TGD   TA+S+ ++  +     
Sbjct: 556  I-NGLTFAGLLGMNDPPRPSVKAAVERLSEGSVHIIMITGDAENTAVSIARQIGI----- 609

Query: 1063 VYVPTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQ 1122
                          PV++                        P T  +TG+         
Sbjct: 610  --------------PVVN------------------------PETAVLTGDKL------- 624

Query: 1123 DNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALKAADVGI 1182
            D+ SE+ +  I+   +IFAR +P+ K  +V  LQK    V   GDG ND  ALK AD+G+
Sbjct: 625  DHMSEDQLASIIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGV 684

Query: 1183 SLSEAEASVAAPFTSKIF---DITCVLDVIKEGRASL--VTSFACFQYMSLYSAIQFISI 1237
            S+ +    VA   +  +    D + +L  I+EG+     + +F  FQ  +  +A+  ++I
Sbjct: 685  SMGKMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAI 744

Query: 1238 TILYSRGSNLGDFQFLYIDLLLIIPIAVTMSWSKPYHELAKKRPSANLVSPKILVPLILD 1297
               +   + L   Q L+I++L+  P A ++      HE+ KK P     + KIL      
Sbjct: 745  ATAFKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKR--ADKILT----K 798

Query: 1298 IVFLFLFQFLPWIWIQGRPWYIKPIVGGDDAVQSSDNTVLF 1338
             VF  L Q    I I     +IK +   D  V + D T+ F
Sbjct: 799  AVFQRLLQSAALIIIGTIYVFIKEM-AEDGEVTARDTTMTF 838

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
            complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score =  122 bits (305), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 176/794 (22%), Positives = 312/794 (39%), Gaps = 158/794 (19%)

Query: 543  VLREGFWSSIHSSELVPGDI--YEISDPNLNLLPCD-SILLSGDCIVNESMLTGESVPVS 599
            ++R G  + + +S LVPGD+  +++ D     +P D  I+ S D  ++ES LTGE+ PV 
Sbjct: 161  LIRFGAETHVLASCLVPGDLVYFKVGDR----IPADVRIIESTDLSLDESTLTGETEPVH 216

Query: 600  K--YPASEETILQLFDDFQSTQISTFLSKSFLFNGTTLIRAKIPNGGSVALAMAVRTGFS 657
            K   P +  T    + D     I      S  + GT L+R     G      + V TG  
Sbjct: 217  KSCTPVNSAT----YSDVPGGIIPIGERTSIAYMGT-LVREGHGKG------IVVATGKH 265

Query: 658  TTKGSLIRSM-VFPKP-SGFKFYSDSFKYXXXXXXXXXXXXXXXCINFIKLGLDKRT--- 712
            T  G++   M    KP +  +   D+ +                 I F+   +  R+   
Sbjct: 266  TMFGAVFEMMNSIEKPKTPLQMAMDTLRRDLSYVRFVLSG-----IIFLLGVIQGRSWLE 320

Query: 713  MILRALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNIGGKIDVMCFDKTG 772
            M   ++ +    +P  LP  +T+  +  + R+  +         V   G ++V+C DKTG
Sbjct: 321  MFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRLPSVETLGSVNVICSDKTG 380

Query: 773  TLTEDGLDVLGVRVSC-AATRNKASFSDLISDTHDIFPKFSLKDCSN--PDDYKRRNFLI 829
            TLT + +     ++ C  +  NK +   L + +    P   L +  N   DD K    + 
Sbjct: 381  TLTANHMT--ASKIWCLGSMANKNNVLSLEAKSSGGLPG-KLPNLKNYLSDDVKATLRIG 437

Query: 830  SLLTCHSLRVVDGELLGDPLDFKMFQFTGWSYEEDFQNHQFHSLYEERHEGQNFPENNDI 889
            S+    S     G+ LG+P D  + +                         Q F    D+
Sbjct: 438  SICNNASFSHEHGKYLGNPTDIALLEVL-----------------------QKF----DL 470

Query: 890  IPAIVHPNDSDERNKFVQNDPNNILGIIRSFEFLSELRRMSVIV-KPNNENVYWAYTKGA 948
            +         DER    + D            F S+ + M+V V  P N   +  Y KGA
Sbjct: 471  V---------DERPTTTRVD---------ELTFNSKRKYMAVKVDSPANSGKHIIYVKGA 512

Query: 949  PEVIID--------ICNPATLPSDYDDILNFYTHS----GYRVIACAGKTLPKNTWLYSQ 996
             E I++              L   +  ++N    S    G R +A A      N  +   
Sbjct: 513  FERILERSASFIGGAGKVEKLSDSHKSLINDCAKSLASEGLRTLAFAQLECSTNKPMNDS 572

Query: 997  KVRREEVESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQ 1056
             ++      N+ F+G I  ++  +    P + +L    +  +M TGD   TA+++ ++  
Sbjct: 573  TIQ------NLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIG 626

Query: 1057 LITEDRVYVPTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFR 1116
            +                   PVI+                        P    +TG+   
Sbjct: 627  I-------------------PVIN------------------------PEISVLTGDRL- 642

Query: 1117 IIFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALK 1176
                  D  +++ +  ++   +IFAR +P+ K  +V  LQK    V   GDG ND  ALK
Sbjct: 643  ------DQMTDDQLAGVIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALK 696

Query: 1177 AADVGISLSEAEASVAAPFTSKIF---DITCVLDVIKEGRASL--VTSFACFQYMSLYSA 1231
             AD+G+++      VA   +  +    D + +L  I+EG+     + SF  FQ  +  +A
Sbjct: 697  LADIGVAMGHMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAA 756

Query: 1232 IQFISITILYSRGSNLGDFQFLYIDLLLIIPIAVTMSWSKPYHELAKKRP---SANLVSP 1288
            +  ++I   +   + L   Q L+I++L+  P A ++      HE+ +K P   S  +++P
Sbjct: 757  LSLVAIATAFKLQNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRSDKILTP 816

Query: 1289 KILVPLILDIVFLF 1302
            +++  L+++  F+ 
Sbjct: 817  QVMRRLLINAAFII 830

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
            Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 951

 Score =  110 bits (275), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 170/753 (22%), Positives = 304/753 (40%), Gaps = 123/753 (16%)

Query: 540  EVRVLREGFWSSIHSSELVPGDI--YEISDPNLNLLPCD-SILLSGDCIVNESMLTGESV 596
            E  ++R G  S++ ++ LVPGD+  + I D     +P D  I+   D  ++ES LTGE+ 
Sbjct: 160  ECHLIRGGRESNVLATNLVPGDLVRFRIGDR----IPADIRIIECNDLTIDESNLTGETD 215

Query: 597  PVSK-YPASEETILQLFDDFQSTQISTFLSKSFLFNGTTLIRAKIPNGGSVALAMAVRTG 655
            PV K Y A        ++D  ++ +      +  + GT +   K  NG  + +     T 
Sbjct: 216  PVHKSYKALSR---DSYNDQPNSIVPVAERTNIAYMGTLV---KEGNGRGIVVGTGRETS 269

Query: 656  FSTTKGSLIRSMVFPKPSGFKFYSDSFKYXXXXXXXXXXXXXXXCINFIKLGLDKRTMIL 715
            F      ++ S+  PK +  +   D  K                C+  I  G     M  
Sbjct: 270  FGNV-FEMMSSIEKPK-TPLQLTMD--KLGKDLSLASFVVIGIICVVGIIQGRSWLEMFQ 325

Query: 716  RALDIITIVVPPALPATLTIGTSFALNRL-KEKGIFCIAPTRVNIGGKIDVMCFDKTGTL 774
             ++ +    +P  LP  +T+  +  + R+ K K I    P+ V   G ++V+C DKTGTL
Sbjct: 326  ISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPS-VETLGSVNVICSDKTGTL 384

Query: 775  TEDGLDVLGVRVSC-AATRNKASFSDLISDTHDIFPKFSLKDCSNPDDYKRRNFLISLLT 833
            T + + V   ++ C  +  NK +   L  +       +        DD K      +L  
Sbjct: 385  TSNHMTV--SKIWCLGSMANKLNVLSLDKNKGGNLKNYL------TDDVKTTLLCGNLCN 436

Query: 834  CHSLRVVDGELLGDPLDFKMFQFTGWSYEEDFQNHQFHSLYEERHEGQNFPENNDIIPAI 893
              S      + LG+P D  + +       + F+     S Y +  E  +F     ++   
Sbjct: 437  NASYSQEHAKYLGNPTDVALLE-----QLQKFELADVRSEYTKVKE-LSFNSKRKMMATK 490

Query: 894  VHPNDSDERNKFVQNDPNNILGIIRSFEFLSELRRMSVIVKPNNENVYWAYTKGAPEVII 953
            +  N+  +   F++     IL   +S  +L+E  ++  +            T G  E II
Sbjct: 491  IQDNEK-KTTLFIKGAFERILD--KSSSYLTEKGKIEKL------------TAGHRETII 535

Query: 954  DICNPATLPSDYDDILNFYTHSGYRVIACAGKTLPKNTWLYSQKVRREEVESNMEFLGFI 1013
            D  N  TL S+           G RV+A A + +  +    S K+  +++ S++ F G I
Sbjct: 536  DCAN--TLASE-----------GLRVLAFAKRAMTDS----SSKLVEDDI-SDLVFTGLI 577

Query: 1014 IFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSDM 1073
               +  + +    + +     I  +M TGD+  TA+++ ++  +                
Sbjct: 578  GMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTAVNIARQIGI---------------- 621

Query: 1074 TVQPVIHWNEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQDNYSEEYVNEI 1133
               PVI                         P    ++G+    +  +Q     ++VN  
Sbjct: 622  ---PVID------------------------PKLSVLSGDKLNEMTDDQLANVIDHVN-- 652

Query: 1134 LLKGSIFARMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALKAADVGISLSEAEASVAA 1193
                 IFAR +P+ K  +V  L++    V   GDG ND  ALK AD+G+S+      VA 
Sbjct: 653  -----IFARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAK 707

Query: 1194 PFTSKIF---DITCVLDVIKEGRASL--VTSFACFQYMSLYSAIQFISITILYSRGSNLG 1248
              +  I    D + +L  I+EG+     + +F  FQ  +  +A+  ++++  +   + L 
Sbjct: 708  EASDMILTDDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPNPLN 767

Query: 1249 DFQFLYIDLLLIIPIAVTMSWSKPYHELAKKRP 1281
              Q L+I++L+  P A ++      HE+ KK P
Sbjct: 768  AMQILWINILMDGPPAQSLGVEPVDHEVMKKPP 800

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
            Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 1280

 Score =  109 bits (273), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 185/853 (21%), Positives = 319/853 (37%), Gaps = 213/853 (24%)

Query: 540  EVRVLREGFWSSIHSSELVPGDIYEISDPNLNLLPCDSILLSGDCIVNESMLTGESVPVS 599
            +V V+R G    I   +L+ GD+  IS    +++P D++L+SG C  +ES LTGES  + 
Sbjct: 240  DVVVIRNGDEHLISIHDLLVGDV--ISLQTGDVVPADAVLISGSCECDESALTGESDTIK 297

Query: 600  KY---PASEETILQLFD-----DFQSTQISTFLSKSFLFNGTTLIRAKIPNGGSVALAMA 651
            K    PA E+   Q+F+     D  S  +   +    L +G+ L+         +  A+ 
Sbjct: 298  KVALKPALEK-YKQIFEKDPTIDIGSHGVGEKVPDPLLISGSKLL-------SGIGNAVI 349

Query: 652  VRTGFSTTKGSLIRSMVFPKPSGFKFYSDSFKYXXXXXXXXXXXXXXXCINFIKLGLDKR 711
               G ++  G ++ ++        K  S+S                  C+  + L     
Sbjct: 350  TSVGENSVNGRIMMAL--------KTESESTPLQERLSNLADNISIYGCMAALVL----- 396

Query: 712  TMILRALDIITIV--------VPPA------------------------LPATLTIGTSF 739
              I+  +  +T +        +PPA                        LP  +T+  +F
Sbjct: 397  -FIILFIRFLTYLPNGKKYHDLPPAQKGSKFMNIFITAVTVIVVAVPEGLPLAVTLALAF 455

Query: 740  ALNRLKEKGIFCIAPTRVNIGGKIDVMCFDKTGTLTEDGLDV-------LG--------- 783
            A  R+ + G            G    +C DKTGTLTE+ + V       LG         
Sbjct: 456  ATTRMTKDGNLVRVLRACETMGSATAICSDKTGTLTENRMTVVKGFAGNLGFDDTTHAEN 515

Query: 784  --------VRVSCAATRNKASFSDLISDTHDIFPKFSLKDCSNPDD-------YKRRNFL 828
                    +R +C A+      +D++S+       F  K+  + D        +K R  L
Sbjct: 516  KEIKSAVVLRSNCDASL----LTDILSNISLNSTAFENKESQHKDKDVDENPYHKSRKSL 571

Query: 829  ISLLTCHSLRVVDGELLGDPLDFKMFQFTGWSYEEDFQNHQFHSL-YEERHEGQNFPENN 887
                   S      +L+ D +     QF G   E         SL  ++ H+ +  P + 
Sbjct: 572  FPW----SRNNRTSQLIADAMKENDEQFLGSKTETALLAFAQKSLGMKDVHKLRTKPSDL 627

Query: 888  DIIPAIVHPNDSDERNKFVQNDPNNILGIIRSFEFLSELRRMSVIVKPNNENVYWAYTKG 947
             I             +K VQ  P           F S  +  ++ V+  +   Y  Y KG
Sbjct: 628  GI-------------DKVVQVIP-----------FESSRKWGAIAVQLADNKGYRFYAKG 663

Query: 948  APEVIIDIC------NPATLPSDYD-------DILNFYTHSGYRVIACAGKTL----PKN 990
            A E+++ +C      + + +P + D        I +  +H+  R I+   +      PK 
Sbjct: 664  AAEILLKVCSNQRNSDNSIVPMNQDLYDESFKKIQDMASHA-LRTISLVHRDFKEWPPKE 722

Query: 991  ------------TWLYSQKVRREEVES-NMEFLGFIIFQNKLKDATSPTLSKLKTANIRT 1037
                          +   ++  + + S  M     +  Q+ L++    ++ + + A +  
Sbjct: 723  FADSTDPSIASPDLVMGHELDHKNLSSEGMTLDAMVGLQDPLREGVKESVEQCQRAGVTV 782

Query: 1038 VMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHWNEISNAEHILDTFTLQ 1097
             M TGDN+LTA ++ + C +++E+    P  A    T + +                   
Sbjct: 783  RMVTGDNILTARAISRNCNILSEEGYNDPECAMEGPTFRKL------------------- 823

Query: 1098 PIDDYSGPYTLAITGEVFRIIFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQK 1157
                   PY      ++ R+I                 K  + AR SP++K  LVE L+K
Sbjct: 824  -------PYK-----KMLRVI----------------PKLRVLARSSPEDKRILVETLKK 855

Query: 1158 MDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSKIF---DITCVLDVIKEGRA 1214
            M   V   GDG ND  ALK ADVG S+  +   VA   +  I    D T +++ IK GR 
Sbjct: 856  MGEVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFTAIVNAIKWGRC 915

Query: 1215 SLVT--SFACFQYMSLYSAI--QFISITILYSRGSNLGDFQFLYIDLLLIIPIAVTMSWS 1270
              V+   F  FQ     +A+   F+S        S L   Q L+++L++    A+ ++  
Sbjct: 916  VSVSIKKFIQFQLTVNITAVILTFVSAVASAEETSVLTAVQLLWVNLIMDTLAALALATD 975

Query: 1271 KPYHELAKKRPSA 1283
            KP   +  ++P  
Sbjct: 976  KPDEFILDRKPKG 988

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
            Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score =  108 bits (271), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 181/822 (22%), Positives = 315/822 (38%), Gaps = 152/822 (18%)

Query: 539  CEVRVLREGFWSSIHSSELVPGDI--YEISDPNLNLLPCD-SILLSGDCIVNESMLTGES 595
             E  + R G  S + +S LVPGD+  +++ D     +P D  I+ S D  V+ES LTGE+
Sbjct: 146  AECHLTRSGQLSHVLASNLVPGDLVRFKVGDR----IPADLRIVESIDLCVDESNLTGEN 201

Query: 596  VPVSKYPASEETILQLFDDFQSTQISTFLSKSFLFNGTTLIRAKIPNGGSVALAMAVRTG 655
             PV K   + +   + +     + I         F GT L+R     G      + + TG
Sbjct: 202  EPVHKSSGAVDP--KNYSHIPGSIIPVGDRNCIGFMGT-LVREGHGKG------IVIATG 252

Query: 656  FSTTKGSLIRSMVFPKPSGFKFYSDSFKYXXXXXXXXXXXXXXXCINFIKLGLDKRTMIL 715
              T  GS+   M           +   K                C+  I  G     M  
Sbjct: 253  KHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQDLSYMSFVLIGIICLIGIIQGRSWLEMFQ 312

Query: 716  RALDIITIVVPPALPATLTIGTSFALNRL-KEKGIFCIAPTRVNIGGKIDVMCFDKTGTL 774
             A+ +    +P  LP  +T+  +  + R+ K K I    P+ V   G ++V+C DKTGTL
Sbjct: 313  IAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPS-VETLGSVNVICSDKTGTL 371

Query: 775  TEDGLDVLGVRVSCAATRNKASFSDLISDTHDIFPKFSLKDCSNPDDYKRRNFLISLLTC 834
            T + + V   ++ C  +    +                  +C      K R   +     
Sbjct: 372  TANHMTV--SKIWCLGSMENKT------------------NCLALSKVKERPIKMEQDVA 411

Query: 835  HSLRVVDGELLGDPLDFKMFQFTGWSYEEDFQNHQFHSLYEERHEGQNFPENNDIIPAIV 894
             +LR+                        +  N+  +S    ++ G   P +  I+ ++ 
Sbjct: 412  TTLRI-----------------------GNICNNGTYSQEHLKYLGN--PTDIAILESLQ 446

Query: 895  HPNDSDERNKFVQNDPNNILGIIRSFEFLSELRRMSVIVKPNNENVYWAYTKGAPEVIID 954
            H         F  ND  N +  I    F S+ + M+V     N+ V   Y KGA E I++
Sbjct: 447  H---------FGINDCRNSVNKINEIPFNSKRKFMAVKTIDANDKVV-VYVKGAFEKIVE 496

Query: 955  -----ICNPATL----PSD---YDDILNFYTHSGYRVIACAGKTLPKNTWLYSQKVRREE 1002
                 I     +    P+D    +D        G R +A A   +   +  +  K   E+
Sbjct: 497  KSINYIGRDGKVHKLKPNDKAIINDAAVALASEGLRTLAFAELEV---SATHGDKEFNED 553

Query: 1003 VESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDR 1062
            +   + F G I   +  +      + +L   ++  +M TGD   TA+S+ ++  +     
Sbjct: 554  MVEGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIGI----- 608

Query: 1063 VYVPTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQ 1122
                          PVI+                        P    ++G+         
Sbjct: 609  --------------PVIN------------------------PEYSVLSGDKL------- 623

Query: 1123 DNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALKAADVGI 1182
            D  +++ +  ++   ++FAR +P+ K  +V  LQK    V   GDG ND  ALK AD+G+
Sbjct: 624  DQMTDDQLASVIDHVNVFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGV 683

Query: 1183 SLSEAEASVAAPFTSKIF---DITCVLDVIKEGRASL--VTSFACFQYMSLYSAIQFISI 1237
            S+ +    VA   +  +    D + +L  I+EG+     + +F  FQ  +  +A+  ++I
Sbjct: 684  SMGKMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAI 743

Query: 1238 TILYSRGSNLGDFQFLYIDLLLIIPIAVTMSWSKPYHELAKKRPSANLVSPKILVPLILD 1297
            +      + L   Q L+I++L+  P A ++      HE+ +K P     + KIL   +L 
Sbjct: 744  STSLKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKR--TDKILTDAVLK 801

Query: 1298 IVFL-FLFQFLPWIWIQGRPWYIKPIVGGDDAVQSSDNTVLF 1338
             V +   F  +  I++     ++K +   D  V S D T+ F
Sbjct: 802  RVLISACFIIVGTIYV-----FVKEM-AEDGQVTSRDTTMTF 837

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
            Ca2+-transporting P-type ATPase of Golgi membrane
            involved in Ca2+ and Mn2+ import into Golgi [2853 bp, 950
            aa]
          Length = 950

 Score =  107 bits (268), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 168/758 (22%), Positives = 302/758 (39%), Gaps = 124/758 (16%)

Query: 539  CEVRVLREGFWSSIHSSELVPGDI--YEISDPNLNLLPCD-SILLSGDCIVNESMLTGES 595
             E  ++R G  S + +S LVPGD+  + I D     +P D  I+ + D  ++ES LTGE+
Sbjct: 151  AECHLMRCGQESHVLASTLVPGDLVHFRIGDR----IPADIRIIEAIDLSIDESNLTGEN 206

Query: 596  VPVSKYPASEETILQLFDDFQSTQISTFLSKSFLFNGTTLIRAKIPNGGSVALAMAVRTG 655
             PV K   + E     F+D Q   I     +S +    TL++     G      + V TG
Sbjct: 207  EPVHKTSQTIEK--SSFND-QPNSIVPISERSCIAYMGTLVKEGHGKG------IVVGTG 257

Query: 656  FSTTKGSLIRSMV-FPKP-SGFKFYSDSFKYXXXXXXXXXXXXXXXCINFIKLGLDKRTM 713
             +T+ G++   M    KP +  +   D  K                C+  I  G     M
Sbjct: 258  TNTSFGAVFEMMNNIEKPKTPLQLTMD--KLGKDLSLVSFIVIGMICLVGIIQGRSWLEM 315

Query: 714  ILRALDIITIVVPPALPATLTIGTSFALNRL-KEKGIFCIAPTRVNIGGKIDVMCFDKTG 772
               ++ +    +P  LP  +T+  +  + R+ K K I    P+ V   G ++V+C DKTG
Sbjct: 316  FQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPS-VETLGSVNVICSDKTG 374

Query: 773  TLTEDGLDVLGVRVSCA-ATRNKASFSDLISDTHDIFPKFSLKDCSNPDDYKRRNFLISL 831
            TLT + + V   ++ C  +  NK +   L  +        +LK+    +D +    + +L
Sbjct: 375  TLTSNHMTV--SKLWCLDSMSNKLNVLSLDKNKKTKNSNGNLKNYLT-EDVRETLTIGNL 431

Query: 832  LTCHSLRVVDGELLGDPLDFKMFQFTGWSYEEDFQNHQFHSLYEERHEGQNFPENND--- 888
                S        LG+P D  +         E   N +   +     + Q  P N+    
Sbjct: 432  CNNASFSQEHAIFLGNPTDVALL--------EQLANFEMPDIRNTVQKVQELPFNSKRKL 483

Query: 889  IIPAIVHPNDSDERNKFVQNDPNNILGIIRSFEFLSELRRMSVIVKPNNENVYWAYTKGA 948
            +   I++P D ++   +V+           +FE + E             +  +  +KG 
Sbjct: 484  MATKILNPVD-NKCTVYVKG----------AFERILEY------------STSYLKSKGK 520

Query: 949  PEVIIDICNPATLPSDYDDILNFYTHSGYRVIACAGKTLPKNTWLYSQKVRREEVESNME 1008
                +     AT+    ++  N     G RV   A  TL  ++   +     E++  ++ 
Sbjct: 521  KTEKLTEAQKATI----NECANSMASEGLRVFGFAKLTLSDSSTPLT-----EDLIKDLT 571

Query: 1009 FLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTV 1068
            F G I   +  +      + +L    +  +M TGD+  TA+++ K+  +           
Sbjct: 572  FTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGI----------- 620

Query: 1069 AYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQDNYSEE 1128
                    PVI                         P    ++G+         D  S++
Sbjct: 621  --------PVID------------------------PKLSVLSGDKL-------DEMSDD 641

Query: 1129 YVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALKAADVGISLSEAE 1188
             +  ++   +IFAR +P+ K  +V  L+K    V   GDG ND  ALK +D+G+S+    
Sbjct: 642  QLANVIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIG 701

Query: 1189 ASVAAPFTSKIF---DITCVLDVIKEGRASL--VTSFACFQYMSLYSAIQFISITILYSR 1243
              VA   +  +    D + +L  I+EG+     + +F  FQ  +  +A+  ++++  +  
Sbjct: 702  TDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVALSTAFKL 761

Query: 1244 GSNLGDFQFLYIDLLLIIPIAVTMSWSKPYHELAKKRP 1281
             + L   Q L+I++L+  P A ++      HE+ KK P
Sbjct: 762  PNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPP 799

>Kwal_23.3160
          Length = 1100

 Score =  107 bits (268), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 177/842 (21%), Positives = 325/842 (38%), Gaps = 148/842 (17%)

Query: 449  GLSSGIQEDRVLAFDKNQINLKMKTT-SQILFDEVLHPFYIFQVLSIILWSLDEYYYYAG 507
            GL S     RV  + +N +    K     IL  ++ +   +   +S+++      +   G
Sbjct: 42   GLRSAEATARVSQYGENSLGDDSKIDFKSILLHQICNAMILVLFISMVITLAIRDWISGG 101

Query: 508  CXXXXXXXXXXXXXXETKKISRTLAEMSHFNC-EVRVLREGFWSSIHSSELVPGDIYEIS 566
                           +  K S+T+  +   +     V+R+G   +I S +LVPGD+  + 
Sbjct: 102  VIAFVVFINVAIGSYQEYKASKTMNSLKSLSTPSAHVIRDGNDETIPSKQLVPGDLCVVK 161

Query: 567  DPNLNLLPCDSILLSGDCI---VNESMLTGESVPVSK-----YPASEETIL--QLFDDFQ 616
              +   +P D  L+  +C+    +E++LTGES+P++K     YPA+E+T +  +L   F 
Sbjct: 162  AGDT--VPADLRLI--ECVNFETDEALLTGESLPIAKEASQVYPATEDTPVGDRLNLAFA 217

Query: 617  STQISTFLSKSFL---------------FNGTTLIRAKIPN-----GGSVALAMAVRTGF 656
            S+ +S   +   +                 G   + +K  N        + LA  + +  
Sbjct: 218  SSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKDENKTFWANAGITLAATIGSFL 277

Query: 657  STTKGSLIRSMVFPKPSGFKFYSDSFKYXXXXXXXXXXXXXXXCINFIKLGLDKRTMILR 716
             TT G+ +   +        F +  F                      K  ++K   I  
Sbjct: 278  GTTTGTPLHRKLSKLAVLLFFIAVVFAIVVMATQ--------------KFVVNKEVAIY- 322

Query: 717  ALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNIGGKIDVMCFDKTGTLTE 776
            A+ +   ++P +L   LTI  S     +  + +       +   G ++ +C DKTGTLT+
Sbjct: 323  AICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTLTQ 382

Query: 777  DGLDVLGVRVSCAATRNKASFSDLISDTH---DIFPKFSLKDCSNPDDYKRRNFL-ISLL 832
              + V    V    T   ++ S+    T    ++ P+FS      P  YK  +   + ++
Sbjct: 383  GKMIVKQAWVPSFGTITVSNSSNPFDPTDGGIELIPRFS------PHQYKHDSTEDVGII 436

Query: 833  TCHSLRVVDGELLGDPLDFKMFQFTGWSYEEDFQN--HQFHSLYEERHEGQNFPENNDII 890
            T    +  + +L   P       F  W       N  H +     E  +    P     I
Sbjct: 437  TSFKNKFYNDKL---PAGLNSKLFLNWLKTAALANIAHVYQDPETEEWKAHGDP-TEIAI 492

Query: 891  PAIVHPND------SDERNKFVQNDPNNILGI-----------IRSFEFLSELRRMSVI- 932
                H  D      + E     ++D +  LG            I  F F S ++RMS + 
Sbjct: 493  QVFAHKLDMPRNALTAEDKSDSESDEDAALGEKTSSVEPHYKHIAEFPFDSSIKRMSAVY 552

Query: 933  VKPNNENVYWAYTKGAPEVIIDIC-------------NPATLPSDYDDILNFYTHS--GY 977
            V  + +N +  +TKGA E ++D C              P T     +   N  T S  G 
Sbjct: 553  VSLDEDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPMTEEDKEEVFKNVETLSSEGL 612

Query: 978  RVIACAGKTLPKNTWL-YSQKVR--REEVESNMEFLGFIIFQNKLKDATSPTLSKLKTAN 1034
            RV+A A K+  ++  L  S+ +R  R+ VES++ F G +   +  +  T+  + +   A 
Sbjct: 613  RVLAFATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAG 672

Query: 1035 IRTVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHWNEISNAEHILDTF 1094
            I   M TGD   TA ++ +E  ++  +  + P                     + ++D  
Sbjct: 673  INVHMLTGDFPGTAKAIAQEVGILPRNLYHYP---------------------KEVVD-- 709

Query: 1095 TLQPIDDYSGPYTLAITGEVFRIIFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQ 1154
                        ++ +T   F       D  ++E ++ +LL   + AR +P  K  +++ 
Sbjct: 710  ------------SMVMTAAQF-------DQLTDEEIDNLLLLPLVIARCAPQTKVRMIDA 750

Query: 1155 LQKMDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSKIF---DITCVLDVIKE 1211
            L + +      GDG ND  +LK A+VGI++    + VA   +  +    +   +L+ ++E
Sbjct: 751  LHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEE 810

Query: 1212 GR 1213
            GR
Sbjct: 811  GR 812

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
            cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score =  107 bits (267), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 144/649 (22%), Positives = 250/649 (38%), Gaps = 146/649 (22%)

Query: 713  MILRALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNIGGKIDVMCFDKTG 772
            + + A+ +I + VP  LP  +T+  +FA  R+ + G            G    +C DKTG
Sbjct: 352  IFITAITVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKTG 411

Query: 773  TLTEDGLDVLGVRVSCAATRNKASFSDLISD---THDIFPK------------------- 810
            TLTE+ + V+        T  +A F D+ +D   ++ +F K                   
Sbjct: 412  TLTENIMTVV------RGTLGRAGFDDIGADPSKSNLVFKKKCSDLLRTVIYDNIVLNST 465

Query: 811  -FSLKDCSNP------DDYKRRNFLISLLTCHSLRVVDGE--LLGDPLDFKMFQFTGWSY 861
             F  KD  +P      DD + R  +  +      +  D E  LL    + +   + G   
Sbjct: 466  AFENKDYKDPNNYNSIDDSQPRRLIRRITQTLQKKKPDDEENLLAHAAEGRQEPYIGSKT 525

Query: 862  EEDFQNHQFHSLYEERHEGQNFPENNDIIPAIVHPNDSDERNKFVQNDPNNILGIIRSFE 921
            E    +    S   +    Q+F  + + +P +                      I++   
Sbjct: 526  ETALLSLARKSFGLKFGALQSFRGHPEKLPTVET--------------------IVQIIP 565

Query: 922  FLSELRRMSVIVK--PNNEN---VYWAYTKGAPEVII------DICNPATLPSDY---DD 967
            F S  +  +++VK   N EN    +  Y KGA E++       ++CN      D    DD
Sbjct: 566  FESSRKWSAIVVKLNSNKENEGKKFRLYVKGAAEIVAKACTLKNVCNEGISEIDQKSKDD 625

Query: 968  I---LNFYTHSGYRVIACAGKTLPKNTWLYSQKVRREEV------------ESNMEFL-- 1010
            I   +        R I+ A      N W   +    E              + ++E L  
Sbjct: 626  IEEQIFSLAKDALRAISLAHMDFDVNEWPPKELADPENSHEALAVKLIDPKKPHLEGLTL 685

Query: 1011 -GFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTVA 1069
               +  Q+ L++    ++++ + A +   M TGDN+LTA ++ + C +++          
Sbjct: 686  DAIVGIQDPLRENVKNSVAQCQKAGVTVRMVTGDNLLTAKAIARNCGILSS--------- 736

Query: 1070 YSDMTVQPVIHWNEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQDNYSEEY 1129
                                       + ++D +     A+ G  FR         S+  
Sbjct: 737  ---------------------------KSLNDSA----CAMEGPAFR-------KLSDSE 758

Query: 1130 VNEILLKGSIFARMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALKAADVGISLSEAEA 1189
               IL K  + AR SP++K  LV  L++M   V   GDG ND  ALK ADVG S+     
Sbjct: 759  RKRILPKLRVLARSSPEDKKILVRALKEMGEVVAVTGDGTNDAPALKLADVGFSMGITGT 818

Query: 1190 SVAAPFTSKIF---DITCVLDVIKEGR--ASLVTSFACFQYMSLYSAI--QFISITILYS 1242
             VA   +  I    D + +++ IK GR  A+ +  F  FQ +   +A+   F++  I   
Sbjct: 819  EVAREASDIILMTDDFSAIVNAIKWGRCVAASIKKFIQFQLIVNVTAVLLTFVTSVISSD 878

Query: 1243 RGSNLGDFQFLYIDLLLIIPIAVTMSWSKPYHELAKKRP---SANLVSP 1288
              S L   Q L+++L++    A+ ++  KP   +  ++P   S  L++P
Sbjct: 879  VKSVLTAVQLLWVNLIMDTLAALALATDKPDPNIMDRKPKGRSTPLITP 927

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 39/66 (59%), Gaps = 2/66 (3%)

Query: 540 EVRVLREGFWSSIHSSELVPGDIYEISDPNLNLLPCDSILLSGDCIVNESMLTGESVPVS 599
           +V V+R+   S I    L+ GD+ ++   ++  +P D +L+ G+C  +ES LTGES  + 
Sbjct: 158 QVVVVRDAAESLISIHNLLVGDLLKLQTGDV--VPADCVLVRGECETDESALTGESNTIK 215

Query: 600 KYPASE 605
           K P ++
Sbjct: 216 KLPLAD 221

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score =  107 bits (267), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 178/756 (23%), Positives = 310/756 (41%), Gaps = 131/756 (17%)

Query: 526  KISRTLAEMSHFNC-EVRVLREGFWSSIHSSELVPGDI--YEISDPNLNLLPCDSILL-S 581
            K ++T+  + + +     V+R G   +I+S ++VPGDI   ++ D     +P D  L+ +
Sbjct: 114  KATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDT----IPADLRLIET 169

Query: 582  GDCIVNESMLTGESVPVSK-----YPASEETIL--QLFDDFQSTQISTFLSKSFLFNGTT 634
             +   +ES+LTGES+PVSK     +   EET +  +L   F S+ +    +K  +    T
Sbjct: 170  KNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIK--T 227

Query: 635  LIRAKIPNGGSVALAMAVRTGFST---TKGSLIRSMVFPKPSGFKFYSDSF------KYX 685
             + ++I   G +A ++   +G  +   +K  L  + +  K     F   +       K  
Sbjct: 228  ALNSEI---GKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLS 284

Query: 686  XXXXXXXXXXXXXXCINFI--KLGLDKRTMILRALDIITIVVPPALPATLTIGTSFALNR 743
                           I     K  +DKR  I  A+ +   ++P +L   LTI  S     
Sbjct: 285  KLAVLLFWIAVLFAIIVMASQKFDVDKRVAIY-AICVALSMIPSSLVVVLTITMSVGAAV 343

Query: 744  LKEKGIFCIAPTRVNIGGKIDVMCFDKTGTLTEDGLDVLGVRVSCAATRNKASFSDLISD 803
            +  + +       +   G ++ +C DKTGTLT+  +    + +    T   ++  D  + 
Sbjct: 344  MVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNP 403

Query: 804  TH---DIFPKFSLKDCSNPDDYKRRNFLISLLTCHSLRVVDGELLGDPLDFKMFQFTGWS 860
                  + P+FS  + S+ +D       + +L     R+ + +L   P D  M  F  W 
Sbjct: 404  NEGNVSLIPRFSPYEYSHNEDGD-----VGILQNFKDRLYEKDL---PEDIDMDLFQKWL 455

Query: 861  YEEDFQNHQFHSLYEE------RHEG-------QNFPENNDI----IPAIVHPNDSDERN 903
                  N    +++++      +  G       Q F    D+    +      N S+E +
Sbjct: 456  ETATLAN--IATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNEND 513

Query: 904  KFVQNDPNNILGI-----IRSFEFLSELRRMSVIVKPNNENVYWAYTKGAPEVIIDICN- 957
            +   +  N   G      I  F F S ++RMS +   N+   Y  Y KGA E II  C+ 
Sbjct: 514  QSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSS 573

Query: 958  ----------PATLPSDYDDIL-NFYTHS--GYRVIACAGKTLPKNT----WLYSQKVRR 1000
                      P T   D + I  N Y+ S  G RV+  A K+  K+      L +    R
Sbjct: 574  WYGKDGVKITPLT-DCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQVNDDQLKNITSNR 632

Query: 1001 EEVESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITE 1060
               ES++ FLG I   +  ++ T+  + K   A I   M TGD V TA ++ +E  ++  
Sbjct: 633  ATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGIL-- 690

Query: 1061 DRVYVPTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRIIFS 1120
                 PT  Y         H+     ++ I+D+              + +TG  F     
Sbjct: 691  -----PTNLY---------HY-----SQEIVDS--------------MVMTGSQF----- 712

Query: 1121 NQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALKAADV 1180
              D  SEE V+++ +   + AR SP  K  ++E L +        GDG ND  +LK A+V
Sbjct: 713  --DGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANV 770

Query: 1181 GISLSEAEASVAAPFTSKIF---DITCVLDVIKEGR 1213
            GI++    + V+   +  +    +   +L+ ++EGR
Sbjct: 771  GIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGR 806

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score =  107 bits (266), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 178/756 (23%), Positives = 310/756 (41%), Gaps = 131/756 (17%)

Query: 526  KISRTLAEMSHFNC-EVRVLREGFWSSIHSSELVPGDI--YEISDPNLNLLPCDSILL-S 581
            K ++T+  + + +     V+R G   +I+S ++VPGDI   ++ D     +P D  L+ +
Sbjct: 114  KATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDT----IPADLRLIET 169

Query: 582  GDCIVNESMLTGESVPVSK-----YPASEETIL--QLFDDFQSTQISTFLSKSFLFNGTT 634
             +   +ES+LTGES+PVSK     +   EET +  +L   F S+ +    +K  +    T
Sbjct: 170  KNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIK--T 227

Query: 635  LIRAKIPNGGSVALAMAVRTGFST---TKGSLIRSMVFPKPSGFKFYSDSF------KYX 685
             + ++I   G +A ++   +G  +   +K  L  + +  K     F   +       K  
Sbjct: 228  ALNSEI---GKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLS 284

Query: 686  XXXXXXXXXXXXXXCINFI--KLGLDKRTMILRALDIITIVVPPALPATLTIGTSFALNR 743
                           I     K  +DKR  I  A+ +   ++P +L   LTI  S     
Sbjct: 285  KLAVLLFWIAVLFAIIVMASQKFDVDKRVAIY-AICVALSMIPSSLVVVLTITMSVGAAV 343

Query: 744  LKEKGIFCIAPTRVNIGGKIDVMCFDKTGTLTEDGLDVLGVRVSCAATRNKASFSDLISD 803
            +  + +       +   G ++ +C DKTGTLT+  +    + +    T   ++  D  + 
Sbjct: 344  MVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNP 403

Query: 804  TH---DIFPKFSLKDCSNPDDYKRRNFLISLLTCHSLRVVDGELLGDPLDFKMFQFTGWS 860
                  + P+FS  + S+ +D       + +L     R+ + +L   P D  M  F  W 
Sbjct: 404  NEGNVSLIPRFSPYEYSHNEDGD-----VGILQNFKDRLYEKDL---PEDIDMDLFQKWL 455

Query: 861  YEEDFQNHQFHSLYEE------RHEG-------QNFPENNDI----IPAIVHPNDSDERN 903
                  N    +++++      +  G       Q F    D+    +      N S+E +
Sbjct: 456  ETATLAN--IATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNEND 513

Query: 904  KFVQNDPNNILGI-----IRSFEFLSELRRMSVIVKPNNENVYWAYTKGAPEVIIDICN- 957
            +   +  N   G      I  F F S ++RMS +   N+   Y  Y KGA E II  C+ 
Sbjct: 514  QSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSS 573

Query: 958  ----------PATLPSDYDDIL-NFYTHS--GYRVIACAGKTLPKNT----WLYSQKVRR 1000
                      P T   D + I  N Y+ S  G RV+  A K+  K+      L +    R
Sbjct: 574  WYGKDGVKITPLT-DCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQVNDDQLKNITSNR 632

Query: 1001 EEVESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITE 1060
               ES++ FLG I   +  ++ T+  + K   A I   M TGD V TA ++ +E  ++  
Sbjct: 633  ATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGIL-- 690

Query: 1061 DRVYVPTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRIIFS 1120
                 PT  Y         H+     ++ I+D+              + +TG  F     
Sbjct: 691  -----PTNLY---------HY-----SQEIVDS--------------MVMTGSQF----- 712

Query: 1121 NQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALKAADV 1180
              D  SEE V+++ +   + AR SP  K  ++E L +        GDG ND  +LK A+V
Sbjct: 713  --DGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANV 770

Query: 1181 GISLSEAEASVAAPFTSKIF---DITCVLDVIKEGR 1213
            GI++    + V+   +  +    +   +L+ ++EGR
Sbjct: 771  GIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGR 806

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
            involved in Na+ and Li+ efflux, required for Na+
            tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score =  106 bits (265), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 178/756 (23%), Positives = 310/756 (41%), Gaps = 131/756 (17%)

Query: 526  KISRTLAEMSHFNC-EVRVLREGFWSSIHSSELVPGDI--YEISDPNLNLLPCDSILL-S 581
            K ++T+  + + +     V+R G   +I+S ++VPGDI   ++ D     +P D  L+ +
Sbjct: 114  KATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDT----IPADLRLIET 169

Query: 582  GDCIVNESMLTGESVPVSK-----YPASEETIL--QLFDDFQSTQISTFLSKSFLFNGTT 634
             +   +ES+LTGES+PVSK     +   EET +  +L   F S+ +    +K  +    T
Sbjct: 170  KNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIK--T 227

Query: 635  LIRAKIPNGGSVALAMAVRTGFST---TKGSLIRSMVFPKPSGFKFYSDSF------KYX 685
             + ++I   G +A ++   +G  +   +K  L  + +  K     F   +       K  
Sbjct: 228  ALNSEI---GKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLS 284

Query: 686  XXXXXXXXXXXXXXCINFI--KLGLDKRTMILRALDIITIVVPPALPATLTIGTSFALNR 743
                           I     K  +DKR  I  A+ +   ++P +L   LTI  S     
Sbjct: 285  KLAVLLFWIAVLFAIIVMASQKFDVDKRVAIY-AICVALSMIPSSLVVVLTITMSVGAAV 343

Query: 744  LKEKGIFCIAPTRVNIGGKIDVMCFDKTGTLTEDGLDVLGVRVSCAATRNKASFSDLISD 803
            +  + +       +   G ++ +C DKTGTLT+  +    + +    T   ++  D  + 
Sbjct: 344  MVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNP 403

Query: 804  TH---DIFPKFSLKDCSNPDDYKRRNFLISLLTCHSLRVVDGELLGDPLDFKMFQFTGWS 860
                  + P+FS  + S+ +D       + +L     R+ + +L   P D  M  F  W 
Sbjct: 404  NEGNVSLIPRFSPYEYSHNEDGD-----VGILQNFKDRLYEKDL---PEDIDMDLFQKWL 455

Query: 861  YEEDFQNHQFHSLYEE------RHEG-------QNFPENNDI----IPAIVHPNDSDERN 903
                  N    +++++      +  G       Q F    D+    +      N S+E +
Sbjct: 456  ETATLAN--IATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNEND 513

Query: 904  KFVQNDPNNILGI-----IRSFEFLSELRRMSVIVKPNNENVYWAYTKGAPEVIIDICN- 957
            +   +  N   G      I  F F S ++RMS +   N+   Y  Y KGA E II  C+ 
Sbjct: 514  QSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSS 573

Query: 958  ----------PATLPSDYDDIL-NFYTHS--GYRVIACAGKTLPKNT----WLYSQKVRR 1000
                      P T   D + I  N Y+ S  G RV+  A K+  K+      L +    R
Sbjct: 574  WYGKDGVKITPLT-DCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQVNDDQLKNITSNR 632

Query: 1001 EEVESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITE 1060
               ES++ FLG I   +  ++ T+  + K   A I   M TGD V TA ++ +E  ++  
Sbjct: 633  ATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGIL-- 690

Query: 1061 DRVYVPTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRIIFS 1120
                 PT  Y         H+     ++ I+D+              + +TG  F     
Sbjct: 691  -----PTNLY---------HY-----SQEIVDS--------------MVMTGSQF----- 712

Query: 1121 NQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALKAADV 1180
              D  SEE V+++ +   + AR SP  K  ++E L +        GDG ND  +LK A+V
Sbjct: 713  --DGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANV 770

Query: 1181 GISLSEAEASVAAPFTSKIF---DITCVLDVIKEGR 1213
            GI++    + V+   +  +    +   +L+ ++EGR
Sbjct: 771  GIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGR 806

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
            (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score =  100 bits (250), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 164/749 (21%), Positives = 296/749 (39%), Gaps = 159/749 (21%)

Query: 542  RVLREGFWSSIHSSELVPGDIYEISDPNLNLLPCDSILLSG-DCIVNESMLTGESVPVSK 600
            RV+R G    + S+++VPGDI ++   +   +P D  L+   +   +E++LTGE++PV+K
Sbjct: 135  RVIRNGEDVVMASAQVVPGDIVQVRVGDT--VPADLRLVEALNLETDEALLTGEALPVAK 192

Query: 601  YPASEETILQLFDDFQSTQISTFLSKSFLFNGTTLIRAKIPNGGSVALAMAVRTGFSTTK 660
             PA+      +F+  Q T +   L+    F  +T+ + +       A  + VRTG  +  
Sbjct: 193  DPAA------VFE--QDTPVGDRLN--LAFASSTVSKGR-------ATGIVVRTGLRSEI 235

Query: 661  GSLIRSMVFPK--------PSGF-------KFYSDSFKYXXXXXXXXXXXXXXXCINF-- 703
            G +  S+   +         SG        K    SF                  I F  
Sbjct: 236  GKIAESLQGKQSLISRDENKSGLQNTVLTVKASVGSFLGTNVGTPLHRKLAKLALILFAI 295

Query: 704  ------IKLGLDK----RTMILRALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIA 753
                  I +   K    R + + A+ +   ++P +L   LTI  S     +  + +    
Sbjct: 296  AVLFALIVMATQKFIVNREVAIYAICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRR 355

Query: 754  PTRVNIGGKIDVMCFDKTGTLTEDGLDVLGVRV----SCAATRNKASFSDLISDTHDIFP 809
               +   G ++ +C DKTGTLT+  + +  + V    +    R+   F   + D   + P
Sbjct: 356  LDSLEALGAVNDICSDKTGTLTQGKMILKQLWVPEFGTVVVNRSNVPFDPTVGDV-SLIP 414

Query: 810  KFS--------LKDCSNPDDYKRR---NFLISLLT-------CHSLRVVDGELLGDPLDF 851
            +FS         +D     ++K+R   N L   L         H+  + +   +    D 
Sbjct: 415  RFSPWEYQHDEEEDVGIIANFKQRWQSNSLPKGLNPRKFESWLHTATLANIATVFKDSDS 474

Query: 852  KMFQFTGWSYEEDFQ------NHQFHSLYEERHEGQNFPENNDIIPAIVHPNDSDERNKF 905
            K ++  G   E   Q      +H  H+L  E+ E                  DSD     
Sbjct: 475  KEWRAHGDPTEIAIQVFATRMDHPHHALTTEQDE-----------------EDSDSSQ-- 515

Query: 906  VQNDPNNILGIIRSFEFLSELRRMSVI-VKPNNENVYWAYTKGAPEVIIDIC-----NPA 959
             QND   I      F F S ++RMS + +   ++N    +TKGA E ++  C     +P 
Sbjct: 516  -QNDAARIYEHAAEFPFDSSIKRMSAVYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPG 574

Query: 960  T---LPSDYDDI------LNFYTHSGYRVIACAGKTLP-KNTWLYSQKVRREE--VESNM 1007
            T    P   DD+      ++  ++ G RV+A A KT+P +      +++ ++   VES++
Sbjct: 575  TGVTHPLTEDDLEIIQKNVDTLSNEGLRVLAFATKTIPAEEAESLGERLTKDRDFVESDL 634

Query: 1008 EFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPT 1067
             F G +   +  +  T+  + K   A I   M TGD   TA ++ +E  ++  +  + P 
Sbjct: 635  IFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPK 694

Query: 1068 VAYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQDNYSE 1127
                D+ V     ++ +++ E  LD   + P+                            
Sbjct: 695  -EVVDIMVMTATQFDSLTDEE--LDQLPVLPL---------------------------- 723

Query: 1128 EYVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALKAADVGISLSEA 1187
                       + AR +P  K  +++ L + +      GDG ND  +LK A+VGI++   
Sbjct: 724  -----------VIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGIN 772

Query: 1188 EASVAAPFTSKIF---DITCVLDVIKEGR 1213
             + VA   +  +    +   +L+ ++EGR
Sbjct: 773  GSDVAKDASDIVLSDDNFASILNAVEEGR 801

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
            involved in Na+ efflux, hypothetical start
          Length = 1082

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 175/840 (20%), Positives = 326/840 (38%), Gaps = 152/840 (18%)

Query: 443  LETTSKGLSSGIQEDRVLAFDKNQINLKMKTTSQILFDEVLHPFYIFQVLSIILWSLDEY 502
            L TT      G+  +  L  D ++IN+K      I   ++ +   +  ++S+++    + 
Sbjct: 39   LNTTQIAERLGLIGENTLG-DDSKINIK-----GIFISQICNAMIMVLIISMVISFAIKD 92

Query: 503  YYYAGCXXXXXXXXXXXXXXETKKISRTLAEMSHFNC-EVRVLREGFWSSIHSSELVPGD 561
            +   G               +    S+T+  +   +     V+R G   +I S ELVPGD
Sbjct: 93   WISGGVIAFVVFINVVIGAYQEYNASKTMNSLKSLSTPSAHVIRAGNDLTIESKELVPGD 152

Query: 562  IYEISDPNLNLLPCDSILLSG-DCIVNESMLTGESVPVSKYPASEETILQLFDDFQSTQI 620
            I  I     + +P D  L    +   +E++LTGES+PV+K         ++++  Q T +
Sbjct: 153  ICIIRVG--DTVPADLRLFEAINLETDEALLTGESLPVAKSHG------EVYE--QDTPV 202

Query: 621  STFLSKSFLFNGTTLIRAKIPNGGSVALAMAVRTGFSTTKGSLIRSMVFPKPSGFKFYSD 680
               L+ +F  +  T  RA           + ++T  +T  G + +S+        +  S 
Sbjct: 203  GDRLNLAFAASTVTKGRAT---------GIVIKTALNTEIGKIAKSLKSEASLISRDKSK 253

Query: 681  SFK-----------------------YXXXXXXXXXXXXXXXCINFIKLGLDK----RTM 713
            SF                        +                   + +G  K    + +
Sbjct: 254  SFGRNLWITLRESIGTFLGTSVGTPLHRKLSQLAILLFVVAVIFAIVVMGTQKFKVNKQV 313

Query: 714  ILRALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNIGGKIDVMCFDKTGT 773
             + A+ +   ++P +L   LTI  S     +  + +       +   G ++ +C DKTGT
Sbjct: 314  AIYAICVALSMIPSSLVVVLTITMSAGAKVMATRHVIIRKLDSLEALGAVNDICSDKTGT 373

Query: 774  LTEDGLDVLGVRVSCAATRN----KASFSDLISDTHDIFPKFSLKDCSNPDDYKRRNFL- 828
            LT+  +    V +    T N       F+  I +   + PKFS      P  YK  +   
Sbjct: 374  LTQGKMIAKQVWIPQFGTINVQNSNEPFNPTIGEIQ-LIPKFS------PYQYKHDDEED 426

Query: 829  ISLLTCHSLRVVDGELLGDPLDFKMFQFTGWSYEEDFQNHQFHSLYEERHEGQNFPENND 888
            + ++T    +    EL   PL+  +  FT W Y     N    +++ +  E Q++  + D
Sbjct: 427  VGMITDFKSKYYADEL--GPLNVSL--FTQWLYTATLAN--IATVFRD-PETQDWKAHGD 479

Query: 889  I-------------IPAIVHPNDSDERNKFVQNDPNNILGIIRSFEFLSELRRMSVIVKP 935
                          +P  V   + ++  K + ND       +  + F S ++RMS I K 
Sbjct: 480  PTEIAIQVFATRMDLPRRVLTGEDNDDEKNIHNDIT--FEHVAEYPFDSSVKRMSAIYKN 537

Query: 936  NNE---NVYWAYTKGAPEVIIDICNP-------ATLPSDYDDI------LNFYTHSGYRV 979
              E    +Y  +TKGA E ++  CN        +  P   +D+      ++  +  G RV
Sbjct: 538  VEEPKAPIYEVFTKGAFERVLQCCNSWYTTPDGSPQPLTEEDLETVQKNVDTLSSEGLRV 597

Query: 980  IACAGKTLPKNTWLYSQK---VRREEVESNMEFLGFIIFQNKLKDATSPTLSKLKTANIR 1036
            +A A KT  ++ +  ++      R+ VE+N+ FLG +   +  +  +   + K   A I 
Sbjct: 598  LAFAKKTFNESQFTINKDKLLKERDFVENNLTFLGLVGIYDPPRRESLAAVKKCHLAGIN 657

Query: 1037 TVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHWNEISNAEHILDTFTL 1096
              M TGD   TA S+ +E  ++  +  + P                E+ N       F +
Sbjct: 658  VHMLTGDFPGTAKSIAQEVGILPHNLYHYP---------------KEVVN-------FMV 695

Query: 1097 QPIDDYSGPYTLAITGEVFRIIFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQ 1156
                D+                    D  S++ ++E+ +   + AR +P  K  ++E L 
Sbjct: 696  MTATDF--------------------DALSDKEIDELPVLPLVIARCAPQTKVRMIEALH 735

Query: 1157 KMDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSKIF---DITCVLDVIKEGR 1213
            + +      GDG ND  +LK A+VGI++    + VA   +  +    +   +L+ ++EGR
Sbjct: 736  RRNRFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGR 795

>Scas_707.48*
          Length = 741

 Score = 98.2 bits (243), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 159/715 (22%), Positives = 275/715 (38%), Gaps = 159/715 (22%)

Query: 539  CEVRVLREGFWSSIHSSELVPGDI--YEISDPNLNLLPCD-SILLSGDCIVNESMLTGES 595
             E  ++R G  S + +S LVPGD+  ++I D     +P D  I+ + D  ++ES LTGE+
Sbjct: 151  AECHLIRCGQESHVLASGLVPGDLVHFKIGDR----IPADLRIIEAVDLSIDESNLTGEN 206

Query: 596  VPVSKYPASEETILQLFDDFQSTQISTFLSKSFLFNGTTLIRAKIPNGGSVALAMAVRTG 655
             PV K  +++E     F+D Q   I     ++ +    TL++     G      + V  G
Sbjct: 207  EPVHK--SAKEVNKDSFND-QPNSIIPISDRTCVAYMGTLVKEGHGKG------IVVGIG 257

Query: 656  FSTTKGSLIRSMVFPKPSGFKFYSDSFKYXXXXXXXXXXXXXXXCINFIKLGLDKRTMIL 715
             +T+ G++   +   +       +   K                C+  I  G     M  
Sbjct: 258  KNTSFGAIFEMLSNIEKPKTPLQNAMDKLGKDLSLFSFIVIGLICLVGILQGRSWLEMFQ 317

Query: 716  RALDIITIVVPPALPATLTIGTSFALNRL-KEKGIFCIAPTRVNIGGKIDVMCFDKTGTL 774
             ++ +    +P  LP  +T+  +  + R+ K K I    P+ V   G ++V+C DKTGTL
Sbjct: 318  ISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPS-VETLGSVNVICSDKTGTL 376

Query: 775  TED--------GLDVLGVRVSCAATRNKASFSDLISDTHDIFPKFSLKDCSNPDDYKRRN 826
            T +         LD +  + +  +     S S     T D+    ++ +  N   + + +
Sbjct: 377  TSNHMTASKIWCLDSMANKANVLSLEKSKSGSLKNYLTEDVKSTLTIGNICNNASFSQEH 436

Query: 827  FLISLLTCHSLRVVDGELLGDPLDFKMFQFTGWSYEEDFQNHQFHSLYEERHEGQNFPEN 886
                           G+ LG+P D  + +          Q  +F              + 
Sbjct: 437  ---------------GKYLGNPTDIALLE----------QLSKF--------------DL 457

Query: 887  NDIIPAIVHPNDSDERNKFVQNDPNNILGIIRSFEFLSELRRMSVIVKPNNENVYWAYTK 946
            +DI P            K VQ  P           F S+ + M+V +  N+E  Y    K
Sbjct: 458  SDIRPTF----------KKVQEIP-----------FNSKRKFMAVKI-VNSEGKYSLCVK 495

Query: 947  GAPEVIIDICN--------PATLPSDYDDIL----NFYTHSGYRVIACAGKTLPKNTWLY 994
            GA E ++  C+           L     D++    N     G R++A A  TLP +  L 
Sbjct: 496  GAFEKVLSQCSHYLNQKGKTEKLTQGQRDVIIETANSLASEGLRMLAFAKTTLPDSPTLL 555

Query: 995  SQKVRREEVESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKE 1054
            +     EE   ++ F G I   +  +    P + +L    +  +M TGD+  TA+++ ++
Sbjct: 556  T-----EESVGDLIFTGLIGMNDPPRPTVKPAIEQLLQGGVHIIMITGDSENTAVNIARQ 610

Query: 1055 CQLITEDRVYVPTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDYSGPYTLAITGEV 1114
                    + +P                       +LD            P    ++G+ 
Sbjct: 611  --------IGIP-----------------------VLD------------PKLSVLSGDK 627

Query: 1115 FRIIFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVGFCGDGANDCGA 1174
               +  +Q     ++VN       IFAR +P+ K  +V  L+K    V   GDG ND  A
Sbjct: 628  LNEMSDDQLANVIDHVN-------IFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPA 680

Query: 1175 LKAADVGISLSEAEASVAAPFTSKIF---DITCVLDVIKEGRASL--VTSFACFQ 1224
            LK AD+G+S+      VA   +  +    D + +L  I+EG+     + +F  FQ
Sbjct: 681  LKLADIGVSMGRMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQ 735

>Kwal_47.17547
          Length = 1240

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 106/438 (24%), Positives = 180/438 (41%), Gaps = 104/438 (23%)

Query: 901  ERNKFVQN-----DPNNILGI---IRSFEFLSELRRMSVIVKPNNENVYWAYTKGAPEVI 952
            ++N  +QN     D  + LGI   ++   F S  +   ++VK  N  ++  Y KGA E++
Sbjct: 563  QKNLGMQNLHHYRDEPDCLGIEKIVQIIPFESSRKWGGIVVKYKN-GLHRFYIKGAAELL 621

Query: 953  IDIC-------NPATLPS--DYDD----ILNFYTHSGYRVIACAGKTLPKN-TW------ 992
            +  C       +  TL S  D+D+    I N    +  R I+ A +  P    W      
Sbjct: 622  LRRCMQKRASDSKLTLISQKDFDEESQTITNLAAEA-LRAISLAHRDYPNCPNWPPSELQ 680

Query: 993  ------------LYSQKVRR--------EEVESNMEFLGFIIFQNKLKDATSPTLSKLKT 1032
                        L+  +V R        +E+ S M   G +  Q+ L+     ++ + + 
Sbjct: 681  DEVEPEAASPDLLFGDEVSRSDSVSEPAQELVSPMVLDGIVGIQDPLRKGVRKSVEQCQK 740

Query: 1033 ANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHWNEISNAEHILD 1092
            A +   M TGDN+LTA ++ K+C +++E++   P  +           + ++SN E +  
Sbjct: 741  AGVTVRMVTGDNILTATAIAKKCSILSEEQAENPESSMEGP------RFRKLSNKERV-- 792

Query: 1093 TFTLQPIDDYSGPYTLAITGEVFRIIFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELV 1152
                                                    IL    + AR SP++K  LV
Sbjct: 793  ---------------------------------------RILPNLRVLARSSPEDKRILV 813

Query: 1153 EQLQKMDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSKIF---DITCVLDVI 1209
            E L+KM   V   GDG ND  ALK ADVG S+  A   VA   +  I    D + +++ I
Sbjct: 814  ETLKKMGDVVAVTGDGTNDAPALKLADVGFSMGIAGTEVAREASDIILMTDDFSAIVNAI 873

Query: 1210 KEGR--ASLVTSFACFQYMSLYSAI--QFISITILYSRGSNLGDFQFLYIDLLLIIPIAV 1265
            K GR  ++ +  F  FQ     +A+   F+S        S L   Q L+++L++    A+
Sbjct: 874  KWGRCVSTSIKKFIQFQLTVNVTAVVLTFVSAVASSEEASVLTAVQLLWVNLIMDTLAAL 933

Query: 1266 TMSWSKPYHELAKKRPSA 1283
             ++  KP   + +++P  
Sbjct: 934  ALATDKPDENILERKPKG 951

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 64/265 (24%), Positives = 107/265 (40%), Gaps = 29/265 (10%)

Query: 540 EVRVLREGFWSSIHSSELVPGDIYEISDPNLNLLPCDSILLSGDCIVNESMLTGESVPVS 599
           EV VLR G    I   +++ GDI  +   ++  +P D IL+ G C  +ES LTGES  + 
Sbjct: 187 EVIVLRNGDEHLISIHDILVGDILSLQTGDV--VPADCILVKGSCECDESALTGESATIK 244

Query: 600 KYPASEETILQLFDDFQSTQISTFLSK--------SFLFNGTTLIRAKIPNGGSVALAMA 651
           K  A+ +   + +    +T  +  +            L +G+ L+      G +V  ++ 
Sbjct: 245 K--AAIDVCYEKYKQLSATDAAIDIGTPGAEKVPDPMLISGSKLLSGL---GRAVVTSVG 299

Query: 652 VRTGFSTTKGSL-IRSMVFPKPSGFKFYSDSFK-YXXXXXXXXXXXXXXXCINFIKLGLD 709
           V +    T  +L + +   P        ++S   Y                +  +K G +
Sbjct: 300 VNSMHGRTLMALKVEAETTPLQERLDSLANSISVYGSAAALLLFFILFMRFLANLKKGGE 359

Query: 710 ----------KRTMILRALDIITIV--VPPALPATLTIGTSFALNRLKEKGIFCIAPTRV 757
                      R M +  + I  IV  VP  LP  +T+  +FA  R+ + G         
Sbjct: 360 LHDLTPAQKGSRFMNIFIVGITVIVVAVPEGLPLAVTLALAFATTRMAKDGNLVRVLRAC 419

Query: 758 NIGGKIDVMCFDKTGTLTEDGLDVL 782
              G    +C DKTGTLTE+ + V+
Sbjct: 420 ETMGSATAVCSDKTGTLTENRMTVV 444

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
            complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score = 97.4 bits (241), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 178/867 (20%), Positives = 323/867 (37%), Gaps = 176/867 (20%)

Query: 538  NCEVRVLREGFWSSIHSSELVPGDIYEISDPNLNLLPCDSILLSGDCIVNESMLTGESVP 597
            + EV V+R G    I   +L+ GD+  +   ++  +P D IL+ G C  +ES +TGES  
Sbjct: 182  DTEVVVVRNGDKHVISVHDLLVGDLLSLQTGDV--VPVDCILVEGKCECDESGITGESDT 239

Query: 598  VSKYPASEETILQLFDDFQSTQISTFLSKSFLFNGTTLIRAKIPNGGSVAL-----AMAV 652
            + K   S    LQ++    +   S  +  S   NG +L+   +   GS  L     A+  
Sbjct: 240  IKK--VSLAMSLQVYRTVAADNPSADIGSSD--NGHSLVPDPMLISGSKLLSGIGHAVVT 295

Query: 653  RTGFSTTKGSLIRSM-----VFPKPSGFKFYSDSFK-YXXXXXXXXXXXXXXXCINFIKL 706
              G  +  G ++ ++       P        +D    Y                ++++  
Sbjct: 296  AVGPHSVHGKMMLALKSEPETTPLQERLNTLADDISIYGSVAAFLLFVVLFLRFLSYLPK 355

Query: 707  G-----LDKRTMILRALDIITIVV-------PPALPATLTIGTSFALNRLKEKGIFCIAP 754
            G     L       R +DI    V       P  LP  +T+  +FA  R+ + G      
Sbjct: 356  GRLYHDLPSARKGSRFMDIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVL 415

Query: 755  TRVNIGGKIDVMCFDKTGTLTEDGLDVLGVRVSCAATRNKASFSDLISDTHDIFPKFSLK 814
                  G    +C DKTGTLT++ +      V        + F D+  D+          
Sbjct: 416  RACETMGSATTVCSDKTGTLTQNKM------VVVKGFLGSSHFDDISEDS---------- 459

Query: 815  DCSNPDDYKRRNFLISLLTCHSLRVVDGELLGDPLDFKMFQFTGWSYEEDFQNHQFHSLY 874
            +C+  D  ++       ++ H+L  +   +  +   F+  Q       E+  +    SL+
Sbjct: 460  NCAQSDALRQD------MSQHTLNDILANIALNSTAFENKQVADPVITENPYHKPRRSLF 513

Query: 875  E-ERHEGQNFPENND----------------IIPAIVHPNDSDERNKFVQNDPNNI--LG 915
               R+    +P   D                 + ++   +   E  + +++DP++I    
Sbjct: 514  PWSRNNKPKYPAPKDSSVQSAEFFIGSKTEAALLSLAKGSLGLESLQALRDDPHHIGIAS 573

Query: 916  IIRSFEFLSELRRMSVIVKPNNENVYWAYTKGAPEVIIDICNPATLPSDYDDIL------ 969
            I++   F S  +   ++V+  + N Y  + KGA E I   C+   + S  DD++      
Sbjct: 574  IVQMIPFESSRKWAGLVVRLVDGN-YRFFIKGASETIFKSCH--YMRSSNDDVIKLSPQK 630

Query: 970  --------NFYTHSGYRVIACAGK-------------------------TLPKNTWLYSQ 996
                    N       R I+ A K                          L  + ++ + 
Sbjct: 631  HGEIFGLINNLASDALRTISLAHKDFTDISSWPPAELRDASDPSTASPDLLLGDEYVPTA 690

Query: 997  KVRREEVESNMEFL---GFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGK 1053
              R   + +N   L   G +   + L+     ++   + + +   M TGDN+ T  ++ +
Sbjct: 691  TDRPSIITNNNSGLILDGVVGIHDPLRPGVKESVKNCQQSGVTVRMITGDNITTGRAIAR 750

Query: 1054 ECQLITEDRVYVPTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDYSGPYTLAITGE 1113
             C +++E         Y+D                                 +  A+ G 
Sbjct: 751  ACGILSESE-------YAD---------------------------------HECAMEGP 770

Query: 1114 VFRIIFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVGFCGDGANDCG 1173
            VFR         S   + +   K  + AR SP++K   V+ L+KM+  V   GDG ND  
Sbjct: 771  VFR-------KLSRRQMMDAAPKLKVLARSSPEDKRIFVDILKKMNEVVAVTGDGTNDAP 823

Query: 1174 ALKAADVGISLSEAEASVAAPFTSKIF---DITCVLDVIKEGRA-SL-VTSFACFQYMSL 1228
            AL  ADVG S+  +   VA   +  I    D T +++ IK GR  SL +  F  FQ    
Sbjct: 824  ALTLADVGFSMGISGTGVAREASDIILMTDDFTSIVNAIKWGRCVSLSIKKFIQFQLTVN 883

Query: 1229 YSAIQFISITILYSRGSN--LGDFQFLYIDLLLIIPIAVTMSWSKPYHELAKKRPSAN-- 1284
             +A+    +T + S   N  L   Q L+++L++    A+ ++  KP   + ++ P+    
Sbjct: 884  ITAVTLTCVTAVTSTEENPVLTAVQLLWVNLIMDTLAALALATDKPDPHILERIPTGRDS 943

Query: 1285 -LVS----PKILVPLILDIVFLFLFQF 1306
             L++      IL   +L ++  F+  +
Sbjct: 944  PLIAVSTWKMILGQAVLQLIIAFVLHY 970

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
            Ca2+-transporting P-type ATPase, member of the cation
            transporting (E1-E2) P-type ATPase superfamily, functions
            to pump Ca2+ into the vacuole [3522 bp, 1173 aa]
          Length = 1173

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 106/439 (24%), Positives = 177/439 (40%), Gaps = 93/439 (21%)

Query: 912  NILGIIRSFEFLSELRRMSVIVK----PNNENVYWAYTKGAPEVIIDICNPATLPSDY-- 965
            NI  ++++  F S  +   ++VK     N +  Y  + KGA E++   C+      D   
Sbjct: 605  NIEKVVQTIPFESSRKWAGLVVKYKEGKNKKPFYRFFIKGAAEIVSKNCSYKRNSDDTLE 664

Query: 966  ----------DDILNFYTHSGYRVIACAGKTLPK-NTWLYSQKVRREEVESNMEFL---- 1010
                      DD +        R I+ A K   + ++W   Q   R++   N+  L    
Sbjct: 665  EINEDNKKETDDEIKNLASDALRAISVAHKDFCECDSWPPEQ--LRDKDSPNIAALDLLF 722

Query: 1011 ---------GFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITED 1061
                     G +  Q+ L+     ++ + + A +   M TGDN+LTA ++ + C +++ D
Sbjct: 723  NSQKGLILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIARNCAILSTD 782

Query: 1062 RVYVPTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRIIFSN 1121
               + + AYS                                     A+ G  FR +  N
Sbjct: 783  ---ISSEAYS-------------------------------------AMEGTEFRKLTKN 802

Query: 1122 QDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALKAADVG 1181
            +          IL    + AR SP++K  LVE L+ M   V   GDG ND  ALK ADVG
Sbjct: 803  ERI-------RILPNLRVLARSSPEDKRLLVETLKGMGDVVAVTGDGTNDAPALKLADVG 855

Query: 1182 ISLSEAEASVAAPFTSKIF---DITCVLDVIKEGRASLVT--SFACFQYMSLYSAI--QF 1234
             S+  +   VA   +  I    D + +++ IK GR   V+   F  FQ +   +A+   F
Sbjct: 856  FSMGISGTEVAREASDIILMTDDFSAIVNAIKWGRCVSVSIKKFIQFQLIVNITAVILTF 915

Query: 1235 ISITILYSRGSNLGDFQFLYIDLLLIIPIAVTMSWSKPYHELAKKRP---SANLVS---- 1287
            +S        S L   Q L+I+L++    A+ ++  KP   +  ++P   S +L+S    
Sbjct: 916  VSSVASSDETSVLTAVQLLWINLIMDTLAALALATDKPDPNIMDRKPRGRSTSLISVSTW 975

Query: 1288 PKILVPLILDIVFLFLFQF 1306
              IL    L ++  F+  F
Sbjct: 976  KMILSQATLQLIVTFILHF 994

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 36/70 (51%)

Query: 713 MILRALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNIGGKIDVMCFDKTG 772
           + + ++ +I + VP  LP  +T+  +FA  R+ + G            G    +C DKTG
Sbjct: 389 IFITSITVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKTG 448

Query: 773 TLTEDGLDVL 782
           TLTE+ + V+
Sbjct: 449 TLTENVMTVV 458

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 39/67 (58%), Gaps = 6/67 (8%)

Query: 551 SIHSSELVPGDIYEISDPNLNLLPCDSILLSGDCIVNESMLTGESVPVSKYPASEETILQ 610
           SIH   ++ GD+  IS    +++P D +++SG C  +ES +TGES  + K+P   +  L+
Sbjct: 206 SIH--HVLVGDV--ISLQTGDVVPADCVMISGKCEADESSITGESNTIQKFPV--DNSLR 259

Query: 611 LFDDFQS 617
            F  F S
Sbjct: 260 DFKKFNS 266

>CAGL0K12034g complement(1161299..1164562) highly similar to sp|P13587
            Saccharomyces cerevisiae YDR040c ENA1 or sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 or sp|Q12691
            Saccharomyces cerevisiae YDR038c ENA5, hypothetical start
          Length = 1087

 Score = 93.6 bits (231), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 95/413 (23%), Positives = 184/413 (44%), Gaps = 74/413 (17%)

Query: 920  FEFLSELRRMSVIVKPNNENVYWAYTKGAPEVIIDIC--------NPATLPSDYD----- 966
            F F S ++RMS + +  +   Y  YTKGA E +++ C        N AT+ +D D     
Sbjct: 530  FPFDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNTATVMTDADVDTIK 589

Query: 967  DILNFYTHSGYRVIACAGKTLPKNTWLYSQKVR-----REEVESNMEFLGFIIFQNKLKD 1021
            + ++  +  G RV+A A K+ PK+  +  +K++     R+  E+ + FLG I   +  ++
Sbjct: 590  ENIDSMSSEGLRVLAFANKSYPKSD-VNEEKLQKILKERDYAETGLTFLGLIGIYDPPRE 648

Query: 1022 ATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHW 1081
             T+  + K   A I   M TGD   TA ++ +E  ++       PT  Y         H+
Sbjct: 649  ETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGIL-------PTNLY---------HY 692

Query: 1082 NEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQDNYSEEYVNEILLKGSIFA 1141
                 ++ ++D               + +TG+ F       DN SE+ ++ + +   + A
Sbjct: 693  -----SKEVVD--------------IMVMTGKQF-------DNLSEDEIDNLPVLPLVIA 726

Query: 1142 RMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSKIF- 1200
            R SP  K  ++E L + +      GDG ND  +LK A+VGI++    + VA   +  +  
Sbjct: 727  RCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVLS 786

Query: 1201 --DITCVLDVIKEGR--ASLVTSFACFQYMSLYSAIQFISITILYSRGSNLGDFQFLYID 1256
              +   +L+ ++EGR  +  +  F         +   ++ + + +        F    ++
Sbjct: 787  DDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLIVGLAFQDKEGKSVFPLAPVE 846

Query: 1257 LLLIIPI-----AVTMSWSKPYHELAKKRPS---ANLVSPKILVPLILDIVFL 1301
            +L II +     A+ +   K  H+L  + P+   A + + +I+V + +  V++
Sbjct: 847  VLWIIVVTSCFPAMGLGLEKAAHDLMDRPPNDSKAGIFTWEIIVDMFVYGVWM 899

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 71/361 (19%), Positives = 146/361 (40%), Gaps = 49/361 (13%)

Query: 446 TSKGLSSGIQEDRVLAFDKNQINLKMKTT-SQILFDEVLHPFYIFQVLSIILWSLDEYYY 504
           +SKG+S    + R+    +N +    K     +L  ++ +   +  ++S+I+      + 
Sbjct: 29  SSKGISPEEFQARLAQCGENSLGDDAKIDYKAMLIHQICNAMILVLIISMIISFAIRDWI 88

Query: 505 YAGCXXXXXXXXXXXXXXETKKISRTLAEMSHFNC-EVRVLREGFWSSIHSSELVPGDIY 563
             G               +  K S+T+  +   +     V+R G    + S+++VPGD+ 
Sbjct: 89  TGGVICFVIGINVIIGLIQEYKASKTMNALRALSSPNAHVIRNGNSEVVDSTDVVPGDLV 148

Query: 564 EISDPNLNLLPCDSILLSGDCI-VNESMLTGESVPVSKYPASEETILQLFDDFQSTQIST 622
            +   +   +P D  L+S      +E++LTGES+PVSK  A+E     +FDD   T +  
Sbjct: 149 VVKVGDT--IPADLRLVSQQNFETDEALLTGESLPVSK-DANE-----IFDD--ETPVGD 198

Query: 623 FLSKSFLFNGTTLIRAKIPNGGSVALAMAVRTGFSTTKGSLIRSM-----VFPKPSGFKF 677
            +  +  F+ +T+++ +       A  +A++TG +T  G + +S+     +  +     +
Sbjct: 199 RI--NLAFSSSTVVKGR-------AQGIAIKTGLNTEIGKIAKSLRGGNELISRDPAKTW 249

Query: 678 YSDSF---------------------KYXXXXXXXXXXXXXXXCINFIKLGLD-KRTMIL 715
           Y +++                     K                 +       D  R + +
Sbjct: 250 YQNAWISTKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKFDVDRGVAI 309

Query: 716 RALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNIGGKIDVMCFDKTGTLT 775
            A+ +   ++P +L   LTI  S     +  + +       +   G ++ +C DKTGTLT
Sbjct: 310 YAVCVALSMIPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLT 369

Query: 776 E 776
           +
Sbjct: 370 Q 370

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 118/530 (22%), Positives = 215/530 (40%), Gaps = 102/530 (19%)

Query: 714  ILRALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNI----GGKIDVMCFD 769
            I+R L + + ++P +L   L +G S    +++          R +      G+I+ +  D
Sbjct: 440  IMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHDATIPDTIVRTSTIPEDLGRIEYLLSD 499

Query: 770  KTGTLTEDGLDVLGVRVSCAATRNKASFSDLISD---------THDIFPKFSL-KDCSNP 819
            KTGTLT++ + +  + +   +        D+++D         T    P+ +  KD  N 
Sbjct: 500  KTGTLTQNDMQLKKLHLGTVSYTMDT--MDIVTDYVQELVSSSTTTPMPQSTAKKDLPN- 556

Query: 820  DDYKRRNFLISLLTCHSLRVV--DGEL---LGDPLDFKMFQFTGWSYEEDFQNHQFHSLY 874
               + R+ +++L  CH++     DGEL      P +  + +FT       F+  +     
Sbjct: 557  ---RVRDLVVTLAICHNVTPTFEDGELTYQAASPDEIAIVKFTESVGLSLFKRDRHSVSL 613

Query: 875  EERHEGQNFPENNDIIPAIVHPNDSDERNKFVQNDPNNILGIIRSFEFLSELRRMSVIVK 934
              +H   NF  +                             I++ F F S+ +RM +IV 
Sbjct: 614  FHQHSATNFEYD-----------------------------ILQVFPFNSDTKRMGIIVY 644

Query: 935  PNNENVYWAYTKGAPEVIIDICNPATLPSDY-DDILNFYTHSGYRVIACAGKTLPKNTWL 993
               +  +W   KGA  V+  I       +D+ D+ +      G R +    K L   ++ 
Sbjct: 645  DKVKGEHWFMQKGADTVMARIVQ----SNDWLDEEVGNMAREGLRTLVIGRKKLSPKSYE 700

Query: 994  YSQK------------------VRREEVESNMEFLGFIIFQNKLKDATSPTLSKLKTANI 1035
              +K                  V ++ +E N+E LG    ++KL++    ++  L+ A +
Sbjct: 701  QFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGV 760

Query: 1036 RTVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHWNEISNAEHILDTFT 1095
            +  M TGD V TA  V    +LI+  + YV TV              ++S  E  L+   
Sbjct: 761  KIWMLTGDKVETARCVSISAKLISRGQ-YVHTVT-------------KLSRPEGALNALE 806

Query: 1096 LQPIDDYSGPYTLAITGEVFRIIFSNQDNYSEEYVNEIL-LKGSIFARMSPDEKHELVEQ 1154
               I+  S    L I GE   +  +    Y +E+ + ++ L   I  R +P +K ++   
Sbjct: 807  YLKINKSS---CLLIDGESLGMFLT---YYKQEFFDIVVDLPAVIACRCTPQQKADVALL 860

Query: 1155 LQKMDYTVGFC-GDGANDCGALKAADVGISLSEAE---ASVAAPFTSKIF 1200
            ++++      C GDG ND   ++ ADVG+ +   E   AS+AA F+   F
Sbjct: 861  IREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQF 910

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-like
            ATPases family in the superfamily of P-type ATPases,
            overproduction confers neomycin resistance [3456 bp, 1151
            aa]
          Length = 1151

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 138/603 (22%), Positives = 240/603 (39%), Gaps = 121/603 (20%)

Query: 714  ILRALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNI----GGKIDVMCFD 769
            ILR L + + ++P +L   L +  S   ++++          R +      G+I+ +  D
Sbjct: 444  ILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSD 503

Query: 770  KTGTLTEDGLDV----LGVRVSCAATRNKAS--FSDLISDTHDIF--PKFSLKDCSNPDD 821
            KTGTLT++ + +    LG     + T +  S     L+S  +D     K +L        
Sbjct: 504  KTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVQSLVSSKNDSLNNSKVALSTTRKDMS 563

Query: 822  YKRRNFLISLLTCHSLRVV--DGEL---LGDPLDFKMFQFT---GWS-YEEDFQNHQFHS 872
            ++ R+ +++L  CH++     D EL      P +  + +FT   G S ++ D   H    
Sbjct: 564  FRVRDMILTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKRD--RHSISL 621

Query: 873  LYEERHEGQNFPENNDIIPAIVHPNDSDERNKFVQNDPNNILGIIRSFEFLSELRRMSVI 932
            L+E   +  N+                                I++ F F S+ +RM +I
Sbjct: 622  LHEHSGKTLNYE-------------------------------ILQVFPFNSDSKRMGII 650

Query: 933  VKPNNENVYWAYTKGAPEVIIDICNPATLPSDY-DDILNFYTHSGYRVIACAGKTLPKNT 991
            V+    + YW   KGA  V+  I       +D+ ++        G R +    K L K  
Sbjct: 651  VRDEQLDEYWFMQKGADTVMSKIVE----SNDWLEEETGNMAREGLRTLVIGRKKLNKKI 706

Query: 992  WLYSQK---------VRREE---------VESNMEFLGFIIFQNKLKDATSPTLSKLKTA 1033
            +   QK         + R++         +E ++E LG    ++KL+     ++  L+ A
Sbjct: 707  YEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNA 766

Query: 1034 NIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHWNEISNAEHILDT 1093
             I+  M TGD V TA  V    +LI+  + YV T+              +++  E   + 
Sbjct: 767  GIKIWMLTGDKVETARCVSISAKLISRGQ-YVHTIT-------------KVTRPEGAFNQ 812

Query: 1094 FTLQPIDDYSGPYTLAITGEVFRIIFSNQDNYSEEYVNEIL-LKGSIFARMSPDEKHELV 1152
                 I+  +    L I GE   +      +Y +E+ + ++ L   I  R +P +K ++ 
Sbjct: 813  LEYLKINRNA---CLLIDGESLGMFLK---HYEQEFFDVVVHLPTVIACRCTPQQKADVA 866

Query: 1153 EQLQKMDYTVGFC-GDGANDCGALKAADVGISLSEAE---ASVAAPFTSKIFDITCVLD- 1207
              ++KM      C GDG ND   ++ ADVG+ +   E   AS+AA F+   F   C L  
Sbjct: 867  LVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQF---CHLTE 923

Query: 1208 -VIKEGRASLVTSFACFQYMSLYSAIQFISITILYSRGSNLGDFQFLYIDLLLIIPIAVT 1266
             ++  GR S   S    Q++                RG  +   Q +Y    L  PIA+ 
Sbjct: 924  LLLWHGRNSYKRSAKLAQFV--------------MHRGLIIAICQAVYSICSLFEPIALY 969

Query: 1267 MSW 1269
              W
Sbjct: 970  QGW 972

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
            cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
            efflux, start by similarity
          Length = 1082

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 120/542 (22%), Positives = 217/542 (40%), Gaps = 96/542 (17%)

Query: 711  RTMILRALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNIGGKIDVMCFDK 770
            + + + A+ +   ++P +L   LTI  S     +  + +       +   G ++ +C DK
Sbjct: 311  KQVAIYAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDICSDK 370

Query: 771  TGTLTEDGLDVLGVRV----SCAATRNKASFSDLISDTHDIFPKFSLKDCSNPDDYKRRN 826
            TGTLT+  +    V +    +     +   F+  I + H + PKFS      P  YK  +
Sbjct: 371  TGTLTQGKMIAKQVWIPQFGTITVQESNEPFNPTIGEIH-LIPKFS------PYQYKHDD 423

Query: 827  FL-ISLLTCHSLRVVDGELLGDPLDFKMFQFTGWSYEEDFQN----HQFHSLYEERHEG- 880
               + ++     + + GEL   PL+  +F    W Y     N     Q     + +  G 
Sbjct: 424  EEDVGIIPDFKSKYLAGEL--GPLNVSLFD--QWLYTATLANIATVFQDSETQDWKAHGD 479

Query: 881  ------QNFPENNDIIPAIVHPNDSDERNKFVQNDPNNILGIIRSFEFLSELRRMSVIVK 934
                  Q F    D+   ++   D D+         N+    +  F F S ++RMS I K
Sbjct: 480  PTEIAIQVFATRMDLPRHVLTGEDKDDEK---DARANSSFEHVAEFPFDSSVKRMSAIYK 536

Query: 935  PNNEN----VYWAYTKGAPEVIIDICN-----PATLPS-----DYDDI---LNFYTHSGY 977
             N E+    +Y  +TKGA E ++  C+     P   PS     D + I   ++  +  G 
Sbjct: 537  -NTEDPATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGL 595

Query: 978  RVIACAGKTLPKNTWLYSQKV---RREEVESNMEFLGFIIFQNKLKDATSPTLSKLKTAN 1034
            RV+A A K+  ++ +  ++      R+ VE  + FLG I   +  +  +   + K   A 
Sbjct: 596  RVLAFAKKSFNESEFNANKDKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAG 655

Query: 1035 IRTVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHWNEISNAEHILDTF 1094
            I   M TGD   TA S+ +E  ++  +  + P                E+ N       F
Sbjct: 656  INVHMLTGDFPGTAKSIAQEVGILPHNLYHYP---------------KEVVN-------F 693

Query: 1095 TLQPIDDYSGPYTLAITGEVFRIIFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQ 1154
             +    D+                    D  S++ ++++ +   + AR +P  K  ++E 
Sbjct: 694  MVMAATDF--------------------DALSDQEIDDLRVLPLVIARCAPQTKVRMIEA 733

Query: 1155 LQKMDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSKIF---DITCVLDVIKE 1211
            L +        GDG ND  +LK A+VGI++    + VA   +  +    +   +L+ ++E
Sbjct: 734  LHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEE 793

Query: 1212 GR 1213
            GR
Sbjct: 794  GR 795

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 48/207 (23%), Positives = 91/207 (43%), Gaps = 26/207 (12%)

Query: 463 DKNQINLKMKTTSQILFDEVLHPFYIFQVLSIILWSLDEYYYYAGCXXXXXXXXXXXXXX 522
           D  +IN+K      IL  ++ +   +  ++S+++    + +   G               
Sbjct: 58  DDTKINIK-----GILISQICNAMIMVLIISMVITLAIKDWISGGVLAFVVGINVVIGAY 112

Query: 523 ETKKISRTLAEMSHFNC-EVRVLREGFWSSIHSSELVPGDIYEISDPNLNLLPCDSILL- 580
           +    S+T+  +   +     V+R+G   +I S ELVPGDI  I     + +P D  LL 
Sbjct: 113 QEYNASKTMNSLKSLSTPSAHVIRDGNDITIQSKELVPGDICIIKVG--DTVPADLRLLE 170

Query: 581 SGDCIVNESMLTGESVPVSKYPASEETILQLFDDFQSTQISTFLSKSFLFNGTTLIRAKI 640
           S +   +E++LTGES+PV+K   S   + +     + T +   L+ +F  +  T  RA  
Sbjct: 171 SINLETDEALLTGESLPVAK---SHSEVYE-----KDTPVGDRLNLAFAASTVTKGRAT- 221

Query: 641 PNGGSVALAMAVRTGFSTTKGSLIRSM 667
                    + ++T  +T  G + +S+
Sbjct: 222 --------GIVIKTALNTEIGKIAKSL 240

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..548354)
            [3501 bp, 1166 aa]
          Length = 1166

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 136/607 (22%), Positives = 240/607 (39%), Gaps = 131/607 (21%)

Query: 714  ILRALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNIG------GKIDVMC 767
            I+R L + + ++P +L   L +G S    +++      I  T V         G+I+ + 
Sbjct: 461  IMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDK--SIPDTIVRTSTIPEDLGRIEYLL 518

Query: 768  FDKTGTLTEDGLDVLGVRVSCAATRNKASFSDLISD------------THDIFPKFSLKD 815
             DKTGTLT++ + +  + +   +   +    D+++D               +    S K+
Sbjct: 519  SDKTGTLTQNDMQLRKIHLGTVSYTMETM--DMVTDYIQTLTSPANMGAAGVAVTGSRKE 576

Query: 816  CSNPDDYKRRNFLISLLTCHSL--RVVDGELL---GDPLDFKMFQFTGWSYEEDFQNHQF 870
             S     + R+ +++L TCH++     D EL      P +  + +FT        +    
Sbjct: 577  VSQ----RVRDLVVTLATCHNVTPNFEDNELAYQAASPDEIAIVKFT--------ERVGL 624

Query: 871  HSLYEERHEGQNFPENNDIIPAIVHPNDSDERNKFVQNDPNNILGIIRSFEFLSELRRMS 930
                 +RH    F E + +                     N    I+  F F S+ +RM 
Sbjct: 625  SLFKRDRHSLTLFHEYSGV---------------------NLQYDILHVFPFTSDTKRMG 663

Query: 931  VIVKPNNENVYWAYTKGAPEVIIDICNPATLPSDY-DDILNFYTHSGYRVIACAGKTLPK 989
            +IV+   +N  W   KGA  V+  I       +D+ ++ ++     G R +  A K L  
Sbjct: 664  IIVRDRTKNEIWFLQKGADTVMSKIVQS----NDWLEEEVSNMAREGLRTLVIARKKL-- 717

Query: 990  NTWLYSQ--------------------KVRREEVESNMEFLGFIIFQNKLKDATSPTLSK 1029
            +T LY Q                    +V +  +E N+E LG    ++KL+     ++  
Sbjct: 718  STRLYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIEL 777

Query: 1030 LKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHWNEISNAEH 1089
            L+ A ++  M TGD V TA  V    +LI+  + YV T+              +++  + 
Sbjct: 778  LRNAGVKIWMLTGDKVETARCVCVSAKLISRGQ-YVHTI-------------TKLTRRDG 823

Query: 1090 ILDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQDNYSEEYVNEIL-LKGSIFARMSPDEK 1148
             L        +  S    L I G+   I  S   +Y  E+   ++ L   I  R +P +K
Sbjct: 824  ALSRLEYLKANRNS---CLLIDGDSLAIYMS---HYRAEFFEIVICLPVVIACRCTPQQK 877

Query: 1149 HELVEQLQKMDYTVGFC-GDGANDCGALKAADVGISLSEAE---ASVAAPFTSKIFDITC 1204
             ++   +++M      C GDG ND   ++ ADVG+ +   E   AS+AA ++   F   C
Sbjct: 878  ADVALLIREMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQF---C 934

Query: 1205 VLD--VIKEGRASLVTSFACFQYMSLYSAIQFISITILYSRGSNLGDFQFLYIDLLLIIP 1262
             L   ++  GR S   S    Q++ ++  +       +YS  SNL              P
Sbjct: 935  HLTKLLLWHGRNSYKRSAKLSQFV-IHRGLLISVCQAVYSISSNLK-------------P 980

Query: 1263 IAVTMSW 1269
            IA+   W
Sbjct: 981  IALYQGW 987

>CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharomyces
            cerevisiae YGL167c PMR1, hypothetical start
          Length = 946

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 100/421 (23%), Positives = 180/421 (42%), Gaps = 83/421 (19%)

Query: 919  SFEFLSEL----RRMSVIVKPNNEN-VYWAYTKGAPEVIID----ICNPATLPSDYDD-- 967
            S E + EL    +R  + +K + E+  +  Y KGA E I+D      + A    ++D+  
Sbjct: 467  SHEKMEELSFNSKRKYMAIKSSKESGEHVLYIKGAFERILDKSSYYLDKAGEVREFDEHS 526

Query: 968  --ILNFYTHS----GYRVIACAGKTLPKNTWLYSQKVRREEVESNMEFLGFIIFQNKLKD 1021
              ++    HS    G R IACA K  P +    S  V  E+  + + F G     +  + 
Sbjct: 527  KVMVLEAAHSCASDGLRTIACAFK--PTD----SDNVISEDDINGLTFTGLFGLADPPRP 580

Query: 1022 ATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHW 1081
                ++ KL    +  +M TGD+V TA+S+ ++  L  +DR        S MT   V   
Sbjct: 581  NVKASIEKLHRGGVHIIMITGDSVNTAVSIAEKIGLSVQDR------ESSVMTGDKVSEL 634

Query: 1082 NEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQDNYSEEYVNEILLKGSIFA 1141
             E                                            + +++++ K +IFA
Sbjct: 635  TE--------------------------------------------DELSKVIDKVNIFA 650

Query: 1142 RMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSKIF- 1200
            R +P+ K  +V+ L+K    V   GDG ND  ALK AD+GI++  +   VA   +  I  
Sbjct: 651  RATPENKLNIVKALRKRGDIVAMTGDGVNDAPALKLADIGIAMGISGTDVAKEVSDMILT 710

Query: 1201 --DITCVLDVIKEGRASL--VTSFACFQYMSLYSAIQFISITILYSRGSNLGDFQFLYID 1256
              D + +L  I+EG+     + +F  FQ     + +  I+IT +    + L   Q L+I+
Sbjct: 711  DDDFSSILTAIEEGKGIFNNIRNFLTFQLSISVATLSLIAITTIAKLPAPLNPMQILWIN 770

Query: 1257 LLLIIPIAVTMSWSKPYHELAKKRPSA---NLVSPKILVPLILDIVFLFLFQFLPWIWIQ 1313
            +++  P A ++       ++  K P +    +++  IL+ L+   + + +  F  +I+++
Sbjct: 771  IIMDGPPAQSLGVEPVDSDVMDKPPRSREERILNMNILLRLLYLAICILVGTF--YIFLK 828

Query: 1314 G 1314
            G
Sbjct: 829  G 829

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 59/248 (23%), Positives = 107/248 (43%), Gaps = 31/248 (12%)

Query: 543 VLREGFWSSIHSSELVPGDI--YEISDPNLNLLPCD-SILLSGDCIVNESMLTGESVPVS 599
           ++R G  S+  +SELVPGD+  ++I D     +P D  I+ + D  ++ES LTGE+ P+ 
Sbjct: 165 LIRYGRESNTLASELVPGDLVRFKIGDR----IPADVRIIEAVDLSIDESNLTGETEPLH 220

Query: 600 KYPASEETILQLFDDFQSTQISTFLSKSFLFNGTTLIRAKIPNGGSVALAMAVRTGFSTT 659
           K     +TI     D ++  +S    +S +    TL++     G      + + TG +T+
Sbjct: 221 K---DAQTIDPEEYDNRNVPVS---ERSCIAYMGTLVKEGHGKG------IVIGTGTNTS 268

Query: 660 KGS---LIRSMVFPKP---SGFKFYSDSFKYXXXXXXXXXXXXXXXCINFIKLGLDKRTM 713
            G+   ++ S+  PK               Y                 N + +      M
Sbjct: 269 YGAIFEMVNSIEKPKTPLQETMDRLGTELSYISFFIIAIISIVGIIRGNSLLM------M 322

Query: 714 ILRALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNIGGKIDVMCFDKTGT 773
              ++ +    +P  LP  +T+  +  + R+ ++         V   G ++V+C DKTGT
Sbjct: 323 FQVSVSLAVAAIPEGLPIIVTVTLALGVLRMTKQNAIVRRLPSVETLGSVNVICTDKTGT 382

Query: 774 LTEDGLDV 781
           LT + + V
Sbjct: 383 LTTNHMTV 390

>Kwal_23.5789
          Length = 1133

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 113/519 (21%), Positives = 209/519 (40%), Gaps = 89/519 (17%)

Query: 714  ILRALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNI----GGKIDVMCFD 769
            I+R L + + ++P +L   L +G S   ++++          R +      G+I+ +  D
Sbjct: 430  IMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIPEDLGRIEYLLSD 489

Query: 770  KTGTLTEDGLDVLGVRVSCAA-TRNKASF-SDLISDTHDIFPKFSLKDCSNPDDYKR-RN 826
            KTGTLT++ +++  + +   + T +     +D +    D     ++   S  D   R R+
Sbjct: 490  KTGTLTQNDMELKKLHLGTVSYTMDTMDIVTDYVRAMSDNLNSSAVPSASKKDLPGRVRD 549

Query: 827  FLISLLTCHSLRVV--DGEL---LGDPLDFKMFQFTGWSYEEDFQNHQFHSLYEERHEGQ 881
             +++L  CH +     DGEL      P +  + +FT       F+  +          G 
Sbjct: 550  LVLTLALCHQVTPTFEDGELTYQAASPDEIAIVKFTESVGLTLFRRDRHSITLLHDQSGT 609

Query: 882  NFPENNDIIPAIVHPNDSDERNKFVQNDPNNILGIIRSFEFLSELRRMSVIVKPNNENVY 941
            NF  +                             I+  F F S+ +RM +++    ++ Y
Sbjct: 610  NFEYD-----------------------------ILHVFPFNSDNKRMGIVIFDKQKDEY 640

Query: 942  WAYTKGAPEVIIDICNPATLPSDY-DDILNFYTHSGYRVIACAGKTLPK----------- 989
            W   KGA  V+  I       +D+ ++        G R +    K L K           
Sbjct: 641  WFLQKGADVVMSKIVQ----KNDWLEEETGNLAREGLRTLVIGRKRLSKKLLQTFTKDYE 696

Query: 990  -------NTWLYSQKVRREEVESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTG 1042
                   N  +    V  + +E ++E LG    ++KL++    ++  L+ A I+  M TG
Sbjct: 697  DASLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTG 756

Query: 1043 DNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDY 1102
            D V TA  V    +L++  + YV TV              +++  E  L    L  I+  
Sbjct: 757  DKVETARCVSISAKLVSRGQ-YVHTV-------------TKVNKPEGALTHLELLKINTN 802

Query: 1103 SGPYTLAITGEVFRIIFSNQDNYSEEYVNEIL-LKGSIFARMSPDEKHELVEQLQKMDYT 1161
            S    L I GE   +     + Y +++   ++ L   I  R +P +K ++   ++++   
Sbjct: 803  S---CLLIDGESLGLYL---EYYRQQFFEIVVNLPAVIACRCTPQQKADVATFIREVTGK 856

Query: 1162 VGFC-GDGANDCGALKAADVGISLSEAE---ASVAAPFT 1196
               C GDG ND   +++ADVG+ +   E   AS+AA F+
Sbjct: 857  RVCCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFS 895

>Kwal_26.7070
          Length = 1315

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 119/482 (24%), Positives = 193/482 (40%), Gaps = 102/482 (21%)

Query: 761  GKIDVMCFDKTGTLTEDGLDVLGVRVS--CAATRNKASFSDLISDTHDI-FPKF-----S 812
            G+I+ +  DKTGTLT + ++     ++  C         +    D  +I F KF     +
Sbjct: 551  GQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIPEDKAATTEDGIEIGFRKFDSMKET 610

Query: 813  LKDCSNPDDYKRRNFLISLLTCHSLRVVDGELLGDPLDFKMFQFTGWSYEEDFQNHQFHS 872
            L D  +PD +   +FL  L TCH++                FQ      E+    +Q  S
Sbjct: 611  LNDTQDPDSHIINDFLTLLATCHTV-------------IPEFQ------EDGSIKYQAAS 651

Query: 873  LYEERHEGQNFPENNDIIPAIVHPNDSDERNKFVQNDPNNILGIIRSF------------ 920
                       P+   ++             KF+   PN++  +I               
Sbjct: 652  -----------PDEGALVEGAASLG-----YKFIIRKPNSVSVLIEDLGQEQEYQLLNIC 695

Query: 921  EFLSELRRMSVIVK-PNNENVYWAYTKGAPEVIIDICNPATLPSDYDDI--LNFYTHSGY 977
            EF S  +RMS I + PN E     + KGA  VI++       P     +  L  Y   G 
Sbjct: 696  EFNSTRKRMSAIFRLPNGE--IKLFCKGADTVILERLKAGENPYIEATLRHLEDYAAEGL 753

Query: 978  RVIACAGKTLPKNTW-----LY----------SQKV--RREEVESNMEFLGFIIFQNKLK 1020
            R +  A +T+ ++ +     +Y          +QK+    E +E ++  LG    ++KL+
Sbjct: 754  RTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQ 813

Query: 1021 DATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIH 1080
            D    T+  L+ A I+  + TGD   TA+++G  C+L++ED             +  +I 
Sbjct: 814  DGVPETIHTLQDAGIKVWVLTGDRQETAVNIGMSCRLLSED-------------MNLLII 860

Query: 1081 WNEISNAEHILDTFTLQPIDDYS------GPYTLAITGEVFRIIFSNQDNYSEEYVNEI- 1133
              E   A     T  L+ I D+           L I G+             E+Y+  I 
Sbjct: 861  NEEDKEATRKNLTEKLKAISDHQISQQDMNSLALVIDGKSLGFALEAD---LEDYLLAIG 917

Query: 1134 -LLKGSIFARMSPDEKHELVEQLQ-KMDYTVGFCGDGANDCGALKAADVGISLSEAEASV 1191
             L K  I  R+SP +K  +V+ ++ K D  +   GDGAND   ++AA VG+ +S  E   
Sbjct: 918  KLCKAVICCRVSPLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQ 977

Query: 1192 AA 1193
            AA
Sbjct: 978  AA 979

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
            Saccharomyces cerevisiae YAL026c DRS2 P-type
            amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 124/506 (24%), Positives = 217/506 (42%), Gaps = 72/506 (14%)

Query: 761  GKIDVMCFDKTGTLTEDGLDVLGVRVS--CAATRNKASFSDLISDTHDI-FPKF-SLKD- 815
            G+I+ +  DKTGTLT + ++   V ++  C            + D  +I F  F SLKD 
Sbjct: 556  GQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVEDGIEIGFHSFESLKDK 615

Query: 816  CSNPDDYKRR---NFLISLLTCHSLRVVDGELLGDPLDFKMFQFTGWSYEEDFQNHQFHS 872
             ++P+D +      FL  L TCH+   V  E   D       ++   S +E         
Sbjct: 616  MTDPEDDEAGIVIEFLTLLATCHT---VIPETQSD----GTIKYQAASPDEGALVQGAAD 668

Query: 873  LYEERHEGQNFPENNDIIPAIVHPNDSDERNKFVQNDPNNILGIIRSFEFLSELRRMSVI 932
            L      G  F         I  PN       F +     +L I    EF S  +RMS I
Sbjct: 669  L------GFRFD--------IRRPNSVSISTPFSEQLEYQLLNIC---EFNSTRKRMSAI 711

Query: 933  VKPNNENVYWAYTKGAPEVIIDICNPATLPSDYDDI--LNFYTHSGYRVIACAGKTLPKN 990
             +  + ++   + KGA  VI++  +    P     +  L  Y   G R +  A +T+P+ 
Sbjct: 712  FRMPDGSIK-LFCKGADTVILERLDSEFNPYVQSTLRHLEDYAAEGLRTLCIASRTIPEK 770

Query: 991  TW-----LY-----SQKVRREE-------VESNMEFLGFIIFQNKLKDATSPTLSKLKTA 1033
             +     +Y     + K R EE       +E ++ FLG    ++KL++    T+  L+ A
Sbjct: 771  EYEEWSKIYEAASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEA 830

Query: 1034 NIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHWNEISNAEHILDT 1093
             ++  + TGD   TAI++G  C+L++ED         + + V      +  +N +  L+ 
Sbjct: 831  GLKVWVLTGDRQETAINIGMSCRLLSED--------MNLLIVNEETKEDTRTNLQSKLNA 882

Query: 1094 FTLQPIDDYS-GPYTLAITGEVFRIIFSNQDNYSEEYVN-EILLKGSIFARMSPDEKHEL 1151
                 I         L I G+   + ++ +++  ++++    L K  I  R+SP +K  +
Sbjct: 883  IESHQISQQDMNSLALVIDGK--SLGYALEEDLEDQFLTIGKLCKAVICCRVSPLQKALV 940

Query: 1152 VEQLQKMDYTVGFC-GDGANDCGALKAADVGISLSEAE---ASVAAPFTSKIFDITCVLD 1207
            V+ +++   ++    GDGAND   ++AA VG+ +S  E   A+ +A F    F     L 
Sbjct: 941  VKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIGQFRFLRKLL 1000

Query: 1208 VIKEG----RASLVTSFACFQYMSLY 1229
            ++       R SL   ++ ++ M+LY
Sbjct: 1001 IVHGSWSYQRISLAILYSFYKNMALY 1026

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
            complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score = 80.5 bits (197), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 94/358 (26%), Positives = 159/358 (44%), Gaps = 64/358 (17%)

Query: 883  FPENNDIIPAIVHPND-------SDERNKFVQNDPNNILGIIRS-------------FEF 922
            F EN  I      P++       +D   KF+   PN++  I+R               EF
Sbjct: 636  FQENGSIKYQAASPDEGALVQGAADLGYKFIIRKPNSVT-ILREDITEEVVYELLNICEF 694

Query: 923  LSELRRMSVIVK-PNNENVYWAYTKGAPEVIIDICNPATLPSDYDDI--LNFYTHSGYRV 979
             S  +RMS I + P+N        KGA  VI++     + P     +  L  Y   G R 
Sbjct: 695  NSTRKRMSAIFRFPDNS--IRLLCKGADTVILERLAATSNPYVAATLRHLEDYAAEGLRT 752

Query: 980  IACAGKTLPKNTW-----LYSQKV-----RREE-------VESNMEFLGFIIFQNKLKDA 1022
            +  A +T+P++ +     LY         R EE       +E  +  LG    ++KL+D 
Sbjct: 753  LCIASRTIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDG 812

Query: 1023 TSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHWN 1082
               T+  L+ A I+  + TGD   TAI++G  C+L++E           DM +  V    
Sbjct: 813  VPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLSE-----------DMNLLIVNEDT 861

Query: 1083 EISNAEHILDTFTLQPIDDY----SGPYTLAITGEVFRIIFSNQDNYSEEYVNEI--LLK 1136
            + S   +++D   L+ I+D+        TLA+  +   + F+ + +  EE++  I  + +
Sbjct: 862  KESTRNNLID--KLRAINDHQISQQDMNTLALVIDGKSLGFALEPDL-EEFLLAIGKMCR 918

Query: 1137 GSIFARMSPDEKHELVEQLQKMDYTVGFC-GDGANDCGALKAADVGISLSEAEASVAA 1193
              I  R+SP +K  +V+ +++   ++    GDGAND   ++AA VG+ +S  E   AA
Sbjct: 919  AVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAA 976

>KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, start by similarity
          Length = 1148

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 126/558 (22%), Positives = 228/558 (40%), Gaps = 109/558 (19%)

Query: 714  ILRALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNI----GGKIDVMCFD 769
            I+R L + + ++P +L   L +G S    +++          R +      G+I+ +  D
Sbjct: 447  IMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIPEDLGRIEYLLSD 506

Query: 770  KTGTLTEDGLDVLGVRVSCAATRNKASFSDLISD--------THDIFPKFSLKDCSNPDD 821
            KTGTLT++ + +  + +   +  N+    D+++D        T +  P  + K+ S+   
Sbjct: 507  KTGTLTQNDMQLKKIHLGTVSYTNETM--DIVTDFIQSMNSRTSNSTPTTTRKNISD--- 561

Query: 822  YKRRNFLISLLTCHSLRVV--DGELL---GDPLDFKMFQFTGWSYEEDFQNHQFH-SLYE 875
             +  + + +L  CH++     DGEL      P +  + +FT       F+  +   SL+ 
Sbjct: 562  -RVIDLVTTLAICHNVTPTFEDGELTYQAASPDEIAIVKFTESVGLSLFRRDRHSISLFH 620

Query: 876  ERHEGQNFPENNDIIPAIVHPNDSDERNKFVQNDPNNILGIIRSFEFLSELRRMSVIVKP 935
            + H G     +  I+                             F F S+ +RM VI+  
Sbjct: 621  D-HSGMKLEYDIKIL-----------------------------FPFNSDSKRMGVIIFD 650

Query: 936  NNENVYWAYTKGAPEVIIDICNPATLPSDY--DDILNFYTHSGYRVIACAGKTLPKNTW- 992
              +  YW   KGA  V+  I     + +D+  ++  N  T  G R +    K L  N + 
Sbjct: 651  KLKQEYWFLQKGADTVMSSI----VVRNDWLEEETSNMATE-GLRTLVIGRKKLSTNLFE 705

Query: 993  -----------------LYSQKVRREEVESNMEFLGFIIFQNKLKDATSPTLSKLKTANI 1035
                             ++ Q V R+ +E+++E LG    ++KL+     ++  L+ A I
Sbjct: 706  QFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGI 765

Query: 1036 RTVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHWNEISNAEHILDTFT 1095
            +  M TGD V TA  V    +LI+  + YV TV              +++  E  L    
Sbjct: 766  KIWMLTGDKVETARCVSISAKLISRGQ-YVHTVT-------------KVNKPEGALHHLE 811

Query: 1096 LQPIDDYSGPYTLAITGEVFRIIFSNQDNYSEEYVNEIL-LKGSIFARMSPDEKHELVEQ 1154
               ++  S    L I GE   +       + +E+ + ++ L   +  R +P +K ++   
Sbjct: 812  YLQVNQNS---CLLIDGESLGLYL---QYFPDEFFDIVVNLPTVVACRCTPQQKADVAVF 865

Query: 1155 L-QKMDYTVGFCGDGANDCGALKAADVGISLSEAE---ASVAAPFTSKIFDITCVLD--V 1208
            + Q     V   GDG ND   ++ ADVG+ +   E   AS+AA F+   F   C L   +
Sbjct: 866  IRQATGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQF---CHLTKLL 922

Query: 1209 IKEGRASLVTSFACFQYM 1226
            +  GR S  +S    Q++
Sbjct: 923  LWHGRNSYKSSAKLSQFV 940

>Scas_704.38
          Length = 1161

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 114/532 (21%), Positives = 218/532 (40%), Gaps = 110/532 (20%)

Query: 714  ILRALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNI----GGKIDVMCFD 769
            ++R L + + ++P +L   L +  S   ++++          R +      G+I+ +  D
Sbjct: 454  VMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDDTIPETIVRTSTIPEDLGRIEYLLSD 513

Query: 770  KTGTLTEDGLDVLGVRVSCAATRNKASFSDLISDTHDIF--------------PKFSLKD 815
            KTGTLT++ + +  + +   +  ++    D++SD  D                P  S KD
Sbjct: 514  KTGTLTQNDMQLKKIHLGTVSYTSETL--DIVSDYVDALVNSSNSANPSGKSVPSTSRKD 571

Query: 816  CSNPDDYKRRNFLISLLTCHSLRVV--DGELL---GDPLDFKMFQFTGWSYEEDFQNHQF 870
             S     + R+ +++L  CH++     D EL      P +  + +FT        ++   
Sbjct: 572  LSA----RVRDMVVTLAICHNVTPTFEDDELTYQAASPDEIAIVKFT--------ESVGL 619

Query: 871  HSLYEERHEGQNFPENNDIIPAIVHPNDSDERNKFVQNDPNNILG--IIRSFEFLSELRR 928
                 +RH             +++H +              +IL   I++ F F S+ +R
Sbjct: 620  SLFKRDRHS-----------ISLLHGHSG------------SILTYEILQVFPFNSDSKR 656

Query: 929  MSVIVKPNNENVYWAYTKGAPEVIIDIC-NPATLPSDYDDILNFYTHSGYRVIACAGKTL 987
            M +IV    ++ YW   KGA  V+  I  N   L  +  ++       G R +    K L
Sbjct: 657  MGIIVHDEQKDEYWFMQKGADTVMARIVENNDWLEEETGNM----AREGLRTLVVGRKKL 712

Query: 988  PKNTWLYSQK---------VRREE---------VESNMEFLGFIIFQNKLKDATSPTLSK 1029
             +N +   +K         V R++         +E ++E LG    ++KL++    ++  
Sbjct: 713  SRNIYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIEL 772

Query: 1030 LKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHWNEISNAEH 1089
            L+ A I+  M TGD V TA  V    +LI+  + YV  +              +++  E 
Sbjct: 773  LRNAGIKIWMLTGDKVETARCVSISAKLISRGQ-YVHIIT-------------KLTKPEG 818

Query: 1090 ILDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQDNYSEEYVNEILLKGSIFA-RMSPDEK 1148
             L+      ++  +    L I GE   +       Y  E+ + ++   ++ A R +P +K
Sbjct: 819  ALNQLEYLKVNKGA---CLLIDGESLGMFLR---YYKREFFDVVICLPTVVACRCTPQQK 872

Query: 1149 HELVEQLQKMDYTVGFC-GDGANDCGALKAADVGISLSEAE---ASVAAPFT 1196
             ++   +++       C GDG ND   ++ ADVG+ +   E   AS+AA F+
Sbjct: 873  ADVALVIREFTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFS 924

>Scas_297.1
          Length = 800

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 72/279 (25%), Positives = 116/279 (41%), Gaps = 61/279 (21%)

Query: 1042 GDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPIDD 1101
            GDN+LTA ++ + C +++E+   +P  A                                
Sbjct: 1    GDNILTARAIARNCNILSEETYLIPECA-------------------------------- 28

Query: 1102 YSGPYTLAITGEVFRIIFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDYT 1161
                    I G  FR +       +++   ++L    + AR SP++K  LVE L+ M   
Sbjct: 29   --------IEGPKFRTL-------TKQERIKMLPNLRVMARSSPEDKRLLVETLKGMGDV 73

Query: 1162 VGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSKIF---DITCVLDVIKEGRASLVT 1218
            V   GDG ND  ALK ADVG S+  +   VA   +  I    D   ++D IK GR   ++
Sbjct: 74   VAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFAAIVDAIKWGRCVSIS 133

Query: 1219 --SFACFQYMSLYSAI--QFISITILYSRGSNLGDFQFLYIDLLLIIPIAVTMSWSKPYH 1274
               F  FQ +   +A+   F+S        S L   Q L+I+L++    A+ ++  KP  
Sbjct: 134  IKKFIQFQLIVNITAVILAFVSSIASEDETSVLTAVQLLWINLIMDTLAALALATDKPDP 193

Query: 1275 ELAKKRP---SANLVSPK----ILVPLILDIVFLFLFQF 1306
             +  ++P   S  L+ P     IL    L ++  F+  F
Sbjct: 194  NIMDRKPRGRSTPLIFPSTWKMILSQSCLQLIVTFILHF 232

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 40/65 (61%), Gaps = 6/65 (9%)

Query: 538 NCEVRVLR--EGFWSSIHSSELVPGDIYEISDPNLNLLPCDSILLSGDCIVNESMLTGES 595
           N ++ V+R  +   +SIH+  L+ GDI  I+    +++P D +L+ G C V+ES +TGES
Sbjct: 597 NRKIIVIRNSQELLTSIHN--LLVGDI--ITLQTGDVIPADGVLVEGQCEVDESSITGES 652

Query: 596 VPVSK 600
             + K
Sbjct: 653 DTIKK 657

>CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharomyces
            cerevisiae YAL026c DRS2, start by similarity
          Length = 1328

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 84/328 (25%), Positives = 148/328 (45%), Gaps = 54/328 (16%)

Query: 904  KFVQNDPNNILGII-----RSF------EFLSELRRMSVIVKPNNENVYWAYTKGAPEVI 952
            KF+   PN++  +I     R +      EF S  +RMS I +  ++++     KGA  VI
Sbjct: 650  KFLIRKPNSVTILINEEEEREYQLLNICEFNSTRKRMSAIFRFPDDSIK-LLCKGADSVI 708

Query: 953  IDICNPATLPSDYDDI----LNFYTHSGYRVIACAGKTLPK---NTW---------LYSQ 996
            ++  +     + Y D     L  Y   G R +  A K +P+   N W             
Sbjct: 709  LERLSET--GNFYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDH 766

Query: 997  KVRR-----EEVESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISV 1051
            +  +     EE+ES +  +G    ++KL++    T+  L+ A I+  + TGD   TAI++
Sbjct: 767  RAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINI 826

Query: 1052 GKECQLITED-RVYVPTVAYSDMTV----QPVIHWNEISNAEHILDTFTLQPIDDYSGPY 1106
            G  C+L++ED  + + +    + T     + +   +E S +EH ++T  L  ID +S  +
Sbjct: 827  GMSCRLLSEDMNLLIISEETKEATRRNMEEKLAALHEHSLSEHDMNTLAL-VIDGHSLSF 885

Query: 1107 TLAITGEVFRIIFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVGFC- 1165
             L    E + +                + K  I  R+SP +K  +V+ +++   ++    
Sbjct: 886  ALEADLEDYFLAIGK------------MCKAVICCRVSPLQKALVVKMVKRKTNSLLLAI 933

Query: 1166 GDGANDCGALKAADVGISLSEAEASVAA 1193
            GDGAND   ++AA VG+ +S  E   AA
Sbjct: 934  GDGANDVSMIQAAHVGVGISGMEGMQAA 961

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 41/84 (48%), Gaps = 7/84 (8%)

Query: 761 GKIDVMCFDKTGTLTEDGLDVLGVRVS--CAATR----NKASFSDLISDTHDIFPKFSLK 814
           G+I+ +  DKTGTLT + ++     ++  C A        A+F D I   +  F     +
Sbjct: 535 GQIEYIFSDKTGTLTRNIMEFKSCSIAGRCYAEHIPEDKAATFEDGIEVGYRSFDDLKKQ 594

Query: 815 DCSNPDDYKRRN-FLISLLTCHSL 837
             +N DD K  + FL  L TCH++
Sbjct: 595 LTTNSDDCKIIDEFLTLLATCHTV 618

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
            Saccharomyces cerevisiae YER166w or sp|Q12675
            Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 80/323 (24%), Positives = 136/323 (42%), Gaps = 49/323 (15%)

Query: 916  IIRSFEFLSELRRMSVIVK-----PNNENVYWAYTKGAPEVIIDIC------NPATLPSD 964
            I+   EF S  +RMS I+K     PN+E       KGA  VI          N  TL   
Sbjct: 832  ILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTKAGENDETLLEK 891

Query: 965  YDDILNFYTHSGYRVIACAGKTLPKNTW------------LYSQKVRREE--------VE 1004
                L  Y   G R +  A + L   TW              +    REE        +E
Sbjct: 892  TALHLEQYATEGLRTLCLAQREL---TWSEYTEWNARYDIAAASLTNREEQLEIVSDSIE 948

Query: 1005 SNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVY 1064
             ++  LG    +++L+D    +++ L  A I+  + TGD V TAI++G  C L+  D   
Sbjct: 949  RDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNNDMEL 1008

Query: 1065 VPTVAYSDMTVQPVIHWNEISN---AEHILDTFTLQPID--------DYS---GPYTLAI 1110
            +      +  ++     +E+ N   ++++ + F L   +        D+S   G + + I
Sbjct: 1009 LVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFPKGDFAVVI 1068

Query: 1111 TGEVFRIIFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQK-MDYTVGFCGDGA 1169
             G+  +I  +  D   +  +     K  +  R+SP +K  +V+ ++  +D      GDG+
Sbjct: 1069 DGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGS 1128

Query: 1170 NDCGALKAADVGISLSEAEASVA 1192
            ND   +++ADVGI ++  E   A
Sbjct: 1129 NDVAMIQSADVGIGIAGEEGRQA 1151

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of the
            Drs2p-like family of the P-type ATPase superfamily of
            membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 63/249 (25%), Positives = 108/249 (43%), Gaps = 24/249 (9%)

Query: 1002 EVESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITED 1061
            E+E  +  LG    ++KL+D  S  + K++ A I+  M TGD   TAI++G  C LI + 
Sbjct: 1075 EIEDGLNLLGVTAIEDKLQDGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCMLIKD- 1133

Query: 1062 RVYVPTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRIIFSN 1121
                    YS + +      N IS    +      Q +D  +  + + +       +F  
Sbjct: 1134 --------YSTVVILTTTDENIISKMNAV-----SQEVDSGNIAHCVVVIDGATMAMFEG 1180

Query: 1122 QDNYSEEYVNEILLKGS--IFARMSPDEKHELVEQLQKMD--YTVGFCGDGANDCGALKA 1177
               Y   +V E+  K    I  R SP +K  +V  ++  D        GDGAND   +++
Sbjct: 1181 NPTYMSVFV-ELCTKTDSVICCRASPSQKALMVSNIRNTDPNLVTLAIGDGANDIAMIQS 1239

Query: 1178 ADVGISLSEAE---ASVAAPFTSKIFDITCVLDVIKEGRASLVTSFACFQYMSLYSAIQF 1234
            AD+G+ ++  E   AS  + ++   F     L +   GR + + + + F   + Y  I F
Sbjct: 1240 ADIGVGIAGKEGLQASRVSDYSIGQFRFLLKL-LFVHGRYNYIRT-SKFMLCTFYKEITF 1297

Query: 1235 ISITILYSR 1243
                ++Y R
Sbjct: 1298 YFTQLIYQR 1306

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, hypothetical start
          Length = 1144

 Score = 73.6 bits (179), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 121/531 (22%), Positives = 211/531 (39%), Gaps = 109/531 (20%)

Query: 714  ILRALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNI----GGKIDVMCFD 769
            I+R L + + ++P +L   L +  S   ++++          R +      G+I+ +  D
Sbjct: 438  IMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSD 497

Query: 770  KTGTLTEDGLDVLGVRVSCAATRNKASFSDLISDTHDIFPKFSLKDCSN--PDDYKRRN- 826
            KTGTLT++ + +  V +   +   + +  D++SD      +      +N  P    R++ 
Sbjct: 498  KTGTLTQNDMQLKKVHLGNVSYTTETA--DIVSDYIQGMIESKNDSVTNLGPRSTTRKDA 555

Query: 827  ------FLISLLTCHSLRVV--DGELL---GDPLDFKMFQFT---GWS-YEEDFQNHQFH 871
                   + +L  CH++     D EL      P +  + +FT   G S ++ D   H   
Sbjct: 556  ATHVIDLITTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKRD--RHSMS 613

Query: 872  SLYEERHEGQNFPENNDIIPAIVHPNDSDERNKFVQNDPNNILGIIRSFEFLSELRRMSV 931
             L+E  H G     N D++                             F F S+ +RM +
Sbjct: 614  LLHE--HSGTIL--NYDVLTM---------------------------FPFNSDTKRMGI 642

Query: 932  IVKPNNENVYWAYTKGAPEVIIDI-CNPATLPSDYDDILNFYTHSGYRVIACAGKTLPKN 990
            IV    ++ YW   KGA  V+  I  N   L  +  ++       G R +    K L K 
Sbjct: 643  IVYDKQKDQYWFLQKGADTVMNRIVANNDWLEEETGNM----AREGLRTLVIGRKKLTKK 698

Query: 991  TWLYSQ-KVRREEV-------------------ESNMEFLGFIIFQNKLKDATSPTLSKL 1030
              +Y Q K   EEV                   E ++E LG    ++KL+     ++  L
Sbjct: 699  --IYEQFKKEYEEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELL 756

Query: 1031 KTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHWNEISNAEHI 1090
            + A I+  M TGD V TA  V    +LI+  + YV  V              ++S  E  
Sbjct: 757  RNAGIKIWMLTGDKVETARCVSISAKLISRGQ-YVHVVT-------------KLSKPEGA 802

Query: 1091 LDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQDNYSEEYVNEIL-LKGSIFARMSPDEKH 1149
             +      ++  +    L I GE   +       Y +E+ + ++ L   I  R +P +K 
Sbjct: 803  FNQLEYLKVNKNA---CLLIDGESLGMFLK---YYRQEFFDVVVHLPTVIACRCTPQQKA 856

Query: 1150 ELVEQLQKMDYTVGFC-GDGANDCGALKAADVGISLSEAE---ASVAAPFT 1196
            ++   ++++      C GDG ND   ++ ADVG+ +   E   AS+AA F+
Sbjct: 857  DVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFS 907

>Scas_499.3
          Length = 346

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 84/171 (49%), Gaps = 8/171 (4%)

Query: 449 GLSSGIQEDRVLAFDKNQINLKMKTTSQILFDEVLHPFYIFQVLSIILWSLDEYYYYAGC 508
           G S  + + R L + +N  ++ + T  ++  +  + P ++FQ+  + LW LDE++YY+  
Sbjct: 165 GNSGDLTQLRRL-YGENAFDIPVPTFMELFKEHAVAPLFVFQLFCVALWLLDEFWYYSLF 223

Query: 509 XXXXXXXXXXXXXXETKKISRTLAEMSHFNCEVRVLREGFWSSIHSSELVPGDIYEISDP 568
                         +  +  +    M      + VLR   W ++ ++EL+  D+  ++  
Sbjct: 224 NLMMIVSMEGAAVFQRLQSLKEFRTMGIKPFAINVLRNEHWVTLQTNELLTMDVVSLTTT 283

Query: 569 N-LNLLPCDSILLSGDCIVNESMLTGESVPVSK-----YPASEETILQLFD 613
              + +PCD IL+ G CIVNE+M +GES P+ K      P  ++ +L+  D
Sbjct: 284 TEESAIPCDMILIDGACIVNEAM-SGESTPLLKESIQLRPGEDDLLLESID 333

>YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to familial intrahepatic cholestasis 1 (human
            ATP8B1), which is an aminophospholipid ATPase transporter
            associated with familial intrahepatic cholestasis [4839
            bp, 1612 aa]
          Length = 1612

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 78/324 (24%), Positives = 135/324 (41%), Gaps = 53/324 (16%)

Query: 916  IIRSFEFLSELRRMSVIVK-----PNNENVYWAYTKGAPEVIID----ICNPATLPSDYD 966
            ++   EF S  +RMS I+K     P +E       KGA  VI        N ATL     
Sbjct: 881  VLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDRTQNDATLLEKTA 940

Query: 967  DILNFYTHSGYRVIACAGKTL---PKNTWLYSQKV-------RREE-------VESNMEF 1009
              L  Y   G R +  A + L       W+ +  V       R EE       +E  +  
Sbjct: 941  LHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDKVTDVIERELIL 1000

Query: 1010 LGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTVA 1069
            LG    +++L+D    +++ L  A I+  + TGD V TAI++G  C ++  D   +   A
Sbjct: 1001 LGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVLNNDMELLVVKA 1060

Query: 1070 ----YSDMTVQPVIHWNEISNAEHILDTFTLQPIDDY-----------SGPYTLAITGEV 1114
                  +    P+   N +   +++ + F +   ++             G + + I G+ 
Sbjct: 1061 SGEDVEEFGSDPIQVVNNLV-TKYLREKFGMSGSEEELKEAKREHGLPQGNFAVIIDGDA 1119

Query: 1115 FRIIFSNQDNYSEEYVNEILL-----KGSIFARMSPDEKHELVEQLQK-MDYTVGFCGDG 1168
             ++  +      EE   + LL     K  +  R+SP +K  +V+ ++K +D      GDG
Sbjct: 1120 LKVALN-----GEEMRRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKKTLDVMTLAIGDG 1174

Query: 1169 ANDCGALKAADVGISLSEAEASVA 1192
            +ND   +++ADVG+ ++  E   A
Sbjct: 1175 SNDVAMIQSADVGVGIAGEEGRQA 1198

>Scas_576.8
          Length = 1591

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 77/320 (24%), Positives = 131/320 (40%), Gaps = 43/320 (13%)

Query: 916  IIRSFEFLSELRRMSVIVK-----PNNENVYWAYTKGAPEVII------DICNPATLPSD 964
            I+ + EF S  +RMS IVK     P++E       KGA  +I       +  N   L   
Sbjct: 852  ILNTLEFNSTRKRMSCIVKIPGANPDDEPRALLICKGADSIIYSRLGTKNGANSENLLEK 911

Query: 965  YDDILNFYTHSGYRVIACAGKTLPKNTWLYSQK---------VRREE--------VESNM 1007
                L  Y   G R +  A + L    +L   K           REE        +E  +
Sbjct: 912  TALHLEQYATEGLRTLCIAQRELSWPEYLEWNKRYDIAAASVTNREEQLEAVSDEIEREL 971

Query: 1008 EFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPT 1067
              LG    +++L+D    ++S L  A I+  + TGD V TAI++G  C L+  D   +  
Sbjct: 972  TLLGGTAIEDRLQDGVPESISILAQAGIKLWVLTGDKVETAINIGFSCNLLNNDMELLVV 1031

Query: 1068 VAYSDMTVQPVIHWNEISNA---EHILDTFTL-----------QPIDDYSGPYTLAITGE 1113
                D   +      EI+ +   +++ + F L           +  D   G + + I GE
Sbjct: 1032 KTNGDDVQEFGNDPAEIAESLITKYLREKFGLTGSEMELADAKKNHDFPRGDFAVVIDGE 1091

Query: 1114 VFRIIFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQ-LQKMDYTVGFCGDGANDC 1172
              ++  + +    +  +     K  +  R+SP +K  +V+  +  +D      GDG+ND 
Sbjct: 1092 ALKLALNGESIRRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVMTSLDVMTLAIGDGSNDV 1151

Query: 1173 GALKAADVGISLSEAEASVA 1192
              +++ADVG+ ++  E   A
Sbjct: 1152 AMIQSADVGVGIAGEEGRQA 1171

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
            cerevisiae YER166w, start by similarity
          Length = 1576

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 74/317 (23%), Positives = 137/317 (43%), Gaps = 40/317 (12%)

Query: 916  IIRSFEFLSELRRMSVIVK-----PNNENVYWAYTKGAPEVI---IDICNPATLPSDYDD 967
            ++   EF S  +RMS I+K     PN E       KGA  +I   +   N   L      
Sbjct: 881  LLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSIIYSRLSKNNDEKLLEKTAL 940

Query: 968  ILNFYTHSGYRVIACAGKTLP-KNTWLYSQK--------VRREE--------VESNMEFL 1010
             L  Y   G R +  A + L  K    +++K        V RE+        +E  +  L
Sbjct: 941  HLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDREDEMEKVADVIERELTLL 1000

Query: 1011 GFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLI-TEDRVYVPTVA 1069
            G    +++L+D    +++ L  A I+  + TGD V TAI++G  C L+  E  + V   +
Sbjct: 1001 GGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVIKAS 1060

Query: 1070 YSDMTVQPVIHWNEISN--AEHILDTFTL----QPIDDY-------SGPYTLAITGEVFR 1116
              D+ +        + N   +++ + F +    + +++        +G + + I G+  +
Sbjct: 1061 GDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYEELEEAKKVHEPPTGNFGVIIDGDALK 1120

Query: 1117 IIFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQK-MDYTVGFCGDGANDCGAL 1175
            +   N D   E  +     K  +  R+SP +K  +V+ ++  +D      GDG+ND   +
Sbjct: 1121 LALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMI 1180

Query: 1176 KAADVGISLSEAEASVA 1192
            ++AD+G+ ++  E   A
Sbjct: 1181 QSADIGVGIAGEEGRQA 1197

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 66/256 (25%), Positives = 117/256 (45%), Gaps = 38/256 (14%)

Query: 1002 EVESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITED 1061
            ++E  +  LG    ++KL++  S  + K++ A I+  M TGD   TAI++G  C+LI  D
Sbjct: 1015 QIEDELYLLGATAIEDKLQEGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCKLI-HD 1073

Query: 1062 RVYVPTVAYSDMTVQPVIHWNEIS------NAEH---ILDTFTLQPIDDYSGPYTLAITG 1112
               V  +  SD  +  +   N IS      N  H   ++D  TL   +D   P  ++   
Sbjct: 1074 YSTVVILTTSDENI--ISKMNAISQEVDSGNVAHCVIVIDGATLAMFED--NPTLMS--- 1126

Query: 1113 EVFRIIFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVG--FCGDGAN 1170
             VF  + +  D+              +  R SP +K  +V  ++  D ++     GDGAN
Sbjct: 1127 -VFTELCTKTDSV-------------VCCRASPAQKALMVSNIRNTDKSIVTLAIGDGAN 1172

Query: 1171 DCGALKAADVGISLSEAE---ASVAAPFTSKIFDITCVLDVIKEGRASLVTSFACFQYMS 1227
            D   +++AD+G+ ++  E   AS +A ++   F     L ++  GR + + + A F   +
Sbjct: 1173 DIAMIQSADIGVGIAGKEGLQASRSADYSIGQFRFILKL-LLVHGRYNYIRT-AKFILCT 1230

Query: 1228 LYSAIQFISITILYSR 1243
             Y  + F    ++Y R
Sbjct: 1231 FYKELTFYLTQLIYQR 1246

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 121/513 (23%), Positives = 205/513 (39%), Gaps = 99/513 (19%)

Query: 761  GKIDVMCFDKTGTLTEDGLD-----VLGVRVSCAATRNKASFSDLISDTHDIFPKFSLKD 815
            G+I+ +  DKTGTLT++ ++     + GV    A T   A          DI  + + + 
Sbjct: 666  GQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRK--RQGVDIEEEGARER 723

Query: 816  CSNPDDYKRRNFLI------SLLTCHSLRVVDGELLGDPLDFKMFQFTGWSYEEDFQNHQ 869
                +D K+   L+      S L  H++  V  EL+ D          G + +E  +  +
Sbjct: 724  AEIEEDKKQMVELLLKLGKNSQLDPHTVTFVSKELVQD--------LGGANSQEQKEAVE 775

Query: 870  F--------HSLYEERHEGQNFPENNDIIP-----AIVHPNDSDERNKFVQNDPNNIL-- 914
                     HS+  E  E +N PE  DI       A +     D    FV    N ++  
Sbjct: 776  HFMLSLALCHSVVVE--ENKNNPEKLDIKAQSPDEAALVETARDMGFSFVGRTKNGVIIE 833

Query: 915  --GIIRSF------EFLSELRRMSVIVK-----PNNENVYWAYTKGAPEVIIDICN---- 957
              G+ + F      EF S  +RMS IVK      N++       KGA  VI    +    
Sbjct: 834  IQGVQKEFRILNVLEFNSTRKRMSCIVKIPAADENSKPKALLLCKGADSVIYSRLDRSRN 893

Query: 958  -PATLPSDYDDILNFYTHSGYRVIACAGKTLPKNTWLYSQKVR---------REE----- 1002
             P  L      +  F T  G R +  A + +  + +L   + R         REE     
Sbjct: 894  DPKLLERTALHLEQFATE-GLRTLCVAQREIDWDEYLNWNERRELAAASLDNREEALERV 952

Query: 1003 ---VESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLIT 1059
               +E  +  LG    +++L+D    ++S L  A I+  + TGD V TAI++G  C L+ 
Sbjct: 953  ADAIERQLVLLGGTAIEDRLQDGVPDSISILADAGIKLWVLTGDKVETAINIGFSCNLLG 1012

Query: 1060 EDRVYVPTVAY-----------SDMTVQPV-----IHWNEISNAEHILDTFTLQPIDDYS 1103
             D   +   +            SD+ +  +      H+N   + E +          D++
Sbjct: 1013 SDMELLVIKSSGEDVEHLGEKDSDVVLALIDKYLETHFNMKGSPEEL-----AAARKDHT 1067

Query: 1104 GP---YTLAITGEVFRIIFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQK-MD 1159
             P   + + I G+  ++    +D   +  +     K  +  R+SP +K  +V+ +++ +D
Sbjct: 1068 PPQSAFGVVIDGDALKLALHGEDIRRKFLLLCKNCKAVLCCRVSPSQKAAVVKLVKESLD 1127

Query: 1160 YTVGFCGDGANDCGALKAADVGISLSEAEASVA 1192
                  GDG+ND   ++AADVGI ++  E   A
Sbjct: 1128 VVTLAIGDGSNDVAMIQAADVGIGIAGEEGRQA 1160

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
            Ca-ATPase (P-type) required for ribosome assembly and
            involved in late Golgi function, member of the cation
            transporting (E1-E2) P-type ATPase superfamily [4068 bp,
            1355 aa]
          Length = 1355

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 95/388 (24%), Positives = 166/388 (42%), Gaps = 65/388 (16%)

Query: 921  EFLSELRRMSVIVKPNNENVYWAYTKGAPEVIIDICN-------PATLPSDYDDILNFYT 973
            EF S  +RMS I +  + ++   + KGA  VI++  +        AT+       L  Y 
Sbjct: 697  EFNSTRKRMSAIFRFPDGSIK-LFCKGADTVILERLDDEANQYVEATMRH-----LEDYA 750

Query: 974  HSGYRVIACAGKTLPKNTW-----LYSQKV-----RREE-------VESNMEFLGFIIFQ 1016
              G R +  A + + +  +     +Y++       R E+       +E N+  +G    +
Sbjct: 751  SEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIGATAIE 810

Query: 1017 NKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITED-RVYVPTVAYSDMTV 1075
            +KL+D    T+  L+ A I+  + TGD   TAI++G  C+L++ED  + +      D T 
Sbjct: 811  DKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNLLIINEETRDDTE 870

Query: 1076 QPVIHWNEISNA--EHILDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQDNYSEEYVNEI 1133
            + ++   E  NA  EH L T  ++ +        L I G+        +    E+Y+  +
Sbjct: 871  RNLL---EKINALNEHQLSTHDMKSL-------ALVIDGKSLGFALEPE---LEDYLLTV 917

Query: 1134 --LLKGSIFARMSPDEKHELVEQLQKMDYTVGFC-GDGANDCGALKAADVGISLSEAEAS 1190
              L K  I  R+SP +K  +V+ +++   ++      GAND   ++AA VG+ +S  E  
Sbjct: 918  AKLCKAVICCRVSPLQKALVVKMVKRKSSSLLLAIASGANDVSMIQAAHVGVGISGMEGM 977

Query: 1191 VAAPFTSKIFDITCVLDVIKEGRASLVTSFACFQYMSLYSAIQFISITILYSRGSNLGDF 1250
             AA    +  DI         G+   +           Y   Q IS+ ILYS   N   +
Sbjct: 978  QAA----RSADIAL-------GQFKFLKKLLLVHGSWSY---QRISVAILYSFYKNTALY 1023

Query: 1251 --QFLYIDLLLIIPIAVTMSWSKPYHEL 1276
              QF Y+        ++  SW+  ++ L
Sbjct: 1024 MTQFWYVFANAFSGQSIMESWTMSFYNL 1051

>Scas_89.1
          Length = 271

 Score = 65.1 bits (157), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 98/208 (47%), Gaps = 25/208 (12%)

Query: 998  VRREEVESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQL 1057
            V ++ +E N+E LG    ++KL++    ++  L+ A ++  M TGD V TA  V    +L
Sbjct: 26   VIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKL 85

Query: 1058 ITEDRVYVPTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRI 1117
            I+  + YV TV              ++S  E  L+      I+  S    L I GE   +
Sbjct: 86   ISRGQ-YVHTV-------------TKLSRPEGALNALEYLKINKSS---CLLIDGESLGM 128

Query: 1118 IFSNQDNYSEEYVNEIL-LKGSIFARMSPDEKHELVEQLQKMDYTVGFC-GDGANDCGAL 1175
              +    Y +E+ + ++ L   I  R +P +K ++   ++++      C GDG ND   +
Sbjct: 129  FLT---YYKQEFFDIVVDLPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGNDVSMI 185

Query: 1176 KAADVGISLSEAE---ASVAAPFTSKIF 1200
            + ADVG+ +   E   AS+AA F+   F
Sbjct: 186  QCADVGVGIVGKEGKQASLAADFSVTQF 213

>Scas_636.16
          Length = 1554

 Score = 67.8 bits (164), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 80/324 (24%), Positives = 134/324 (41%), Gaps = 51/324 (15%)

Query: 916  IIRSFEFLSELRRMSVIVK-----PNNENVYWAYTKGAPEVIIDIC------NPATLPSD 964
            I+   EF S  +RMS IVK       +E       KGA  VI          N  TL   
Sbjct: 815  ILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPGYNDETLLEK 874

Query: 965  YDDILNFYTHSGYRVIACAGKTL----------PKNTWLYSQKVRREE-------VESNM 1007
                L  Y   G R +    + +            N    S   R EE       +E ++
Sbjct: 875  TALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHVADLIERDL 934

Query: 1008 EFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPT 1067
              LG    +++L+D    +++ L  A I+  + TGD V TAI++G  C L+  D   +  
Sbjct: 935  VLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDMELLVI 994

Query: 1068 VAYSDMTVQPVIHWNEISNA---EHILDTFTLQPID--------DYS---GPYTLAITGE 1113
                +   +      EI NA   +++++ F +   +        D+S   G + + I GE
Sbjct: 995  KTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEELAAAKKDHSPPQGEFAIIIDGE 1054

Query: 1114 VFRIIFSNQDNYSEEYVNEILL----KGSIFARMSPDEKHELVEQLQK-MDYTVGFCGDG 1168
              +I  +  D    ++   +LL    K  +  R+SP +K  +V+ ++  +D      GDG
Sbjct: 1055 ALKIALTG-DTMKRKF---LLLCKNCKAVLCCRVSPAQKAAVVKLVKDTLDVMTLAIGDG 1110

Query: 1169 ANDCGALKAADVGISLSEAEASVA 1192
            +ND   +++ADVG+ ++  E   A
Sbjct: 1111 SNDVAMIQSADVGVGIAGEEGRQA 1134

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 78/329 (23%), Positives = 135/329 (41%), Gaps = 61/329 (18%)

Query: 916  IIRSFEFLSELRRMSVIVK-----PNNENVYWAYTKGAPEVIIDICNPATLPSDYDDILN 970
            I+   EF S  +RMS IVK     P +E       KGA  +I    +  +  S+ + IL 
Sbjct: 836  ILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQS-GSNSEAILE 894

Query: 971  F-------YTHSGYRVIACAGKTLPKNTWLYSQK------------VRREE--------V 1003
                    Y   G R +  A + L   +W   +K              RE+        +
Sbjct: 895  KTALHLEQYATEGLRTLCIAQREL---SWSEYEKWNEKYDIAAASLANREDELEVVADSI 951

Query: 1004 ESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRV 1063
            E  +  LG    +++L+D     +  L  A I+  + TGD V TAI++G  C L+  +  
Sbjct: 952  ERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLNNEME 1011

Query: 1064 YVPTVAYSDMTVQPVIHWNEISNA---EHILDTFTLQPIDDY-----------SGPYTLA 1109
             +      D   +     +EI +A   +++ + F L   ++             G Y + 
Sbjct: 1012 LLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKDHEFPKGNYAIV 1071

Query: 1110 ITGEVFRIIFSNQDNYSEEYVNEILL-----KGSIFARMSPDEKHELVEQLQ-KMDYTVG 1163
            I G+  ++       Y E+   + LL     +  +  R+SP +K  +V+ ++  +D    
Sbjct: 1072 IDGDALKLAL-----YGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLVKDSLDVMTL 1126

Query: 1164 FCGDGANDCGALKAADVGISLSEAEASVA 1192
              GDG+ND   +++ADVGI ++  E   A
Sbjct: 1127 AIGDGSNDVAMIQSADVGIGIAGEEGRQA 1155

>CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharomyces
            cerevisiae YDR093w, hypothetical start
          Length = 1578

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 75/322 (23%), Positives = 132/322 (40%), Gaps = 48/322 (14%)

Query: 916  IIRSFEFLSELRRMSVIVK-----PNNENVYWAYTKGAPEVIIDIC-----NPATLPSDY 965
            I+   EF S  +RMS IVK      N +       KGA  VI         N  +L    
Sbjct: 843  ILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLDKTGLNEESLLEKT 902

Query: 966  DDILNFYTHSGYRVIACAGKTLPKNTWLYSQK---------VRREE--------VESNME 1008
               L  Y   G R +  A + L    +    K         V REE        +E ++ 
Sbjct: 903  ALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKVSDEIERHLI 962

Query: 1009 FLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITED------R 1062
             LG    +++L+D    +++ L  A I+  + TGD V TAI++G  C L+  D      +
Sbjct: 963  LLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELLVIK 1022

Query: 1063 VYVPTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDY-----------SGPYTLAIT 1111
               P V     T + ++   +   ++++ D F +   ++             G + + I 
Sbjct: 1023 TTGPDVEDLGATPKDIV---DTLISQYLHDKFGMAGSEEELKKAKAEHDIPRGEFAVIID 1079

Query: 1112 GEVFRIIFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQK-MDYTVGFCGDGAN 1170
            GE  +   S +D   +  +     K  +  R+SP +K  +V+ ++  +D      GDG+N
Sbjct: 1080 GEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSN 1139

Query: 1171 DCGALKAADVGISLSEAEASVA 1192
            D   +++A++G+ ++  E   A
Sbjct: 1140 DVAMIQSANIGVGIAGEEGRQA 1161

>Kwal_23.3556
          Length = 1597

 Score = 64.7 bits (156), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 63/254 (24%), Positives = 113/254 (44%), Gaps = 32/254 (12%)

Query: 1001 EEVESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITE 1060
            E VE+++  LG    ++KL++  +  + K++ A I+  M TGD   TAI++G  C LI +
Sbjct: 1013 ELVETSLHLLGATAIEDKLQEGVADAIDKIRRAGIKMWMLTGDKRETAINIGYSCNLIHD 1072

Query: 1061 DRVYVPTVAYSD------MTVQPVIHWNEISNAEHILDTFTLQPIDDYSGPYTLAITGEV 1114
                V   A  +        V   I    I++   ++D  TL   +  S P  ++    V
Sbjct: 1073 YSTVVILSAKDENISSKLTAVSQEIERGNIAHCVVVIDGSTLTTFE--SNPTLMS----V 1126

Query: 1115 FRIIFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVG--FCGDGANDC 1172
            F  + +  D+              I  R SP +K  +V  ++  D  +     GDGAND 
Sbjct: 1127 FVELCTKTDSV-------------ICCRASPSQKALMVTHIRNTDKKLVTLAIGDGANDI 1173

Query: 1173 GALKAADVGISLSEAE---ASVAAPFTSKIFDITCVLDVIKEGRASLVTSFACFQYMSLY 1229
              +++AD+G+ ++  E   AS ++ ++   F     L ++  GR + V +   F   + Y
Sbjct: 1174 AMIQSADIGVGIAGKEGLQASRSSDYSIAQFRFLLKL-LLVHGRYNYVRTTK-FVLCTFY 1231

Query: 1230 SAIQFISITILYSR 1243
              + F    ++Y R
Sbjct: 1232 KELLFYLTQMIYQR 1245

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 36/70 (51%), Gaps = 7/70 (10%)

Query: 886 NNDIIPAIVHPNDSDERNKFVQNDPNNILGIIRSFEFLSELRRMSVIVK-PNNENVYWAY 944
           N+D++    +PN  D      + +      I+ + EF S  +RMSV+V+ P+ EN     
Sbjct: 719 NSDVLTIKTYPNGFDAEPHLDKYE------ILNNIEFSSHRKRMSVLVRLPHEENRILLI 772

Query: 945 TKGAPEVIID 954
            KGA  VI++
Sbjct: 773 CKGADNVILE 782

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score = 64.3 bits (155), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 91/199 (45%), Gaps = 23/199 (11%)

Query: 1001 EEVESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITE 1060
            E +E ++  LG I  ++KL++     + KL+ A I+  M TGD   TAI++G  C+LI  
Sbjct: 994  EIIERDLTLLGTIGIEDKLQEGVPDAIDKLRRAGIKMWMLTGDKRETAINIGYSCRLI-H 1052

Query: 1061 DRVYVPTVAYSD----MTVQPVIHWNEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFR 1116
            D   V  +A +D      +  +    E  N  H +       +  + G  TL     +F 
Sbjct: 1053 DYSTVIILAPNDENMASKITTITQEIEAGNVAHCVVVIDGATLTIFEGNLTLMT---LFI 1109

Query: 1117 IIFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVG--FCGDGANDCGA 1174
             + +  D+              I  R SP +K  +V +++K D  +     GDGAND   
Sbjct: 1110 ELCTKTDSV-------------ICCRSSPSQKALMVTKIRKTDKKLVTLAIGDGANDIAM 1156

Query: 1175 LKAADVGISLSEAEASVAA 1193
            +++AD+G+ ++  E   A+
Sbjct: 1157 IQSADIGVDITGKEGLQAS 1175

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score = 63.9 bits (154), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 63/248 (25%), Positives = 109/248 (43%), Gaps = 24/248 (9%)

Query: 1003 VESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDR 1062
            +E+++E LG    ++KL++     + K++ A I+  M TGD   TAI++G  C+LI +  
Sbjct: 995  IETDLELLGATAIEDKLQEGVPEAIQKIRRAGIKMWMLTGDKRETAINIGYACKLIYDYS 1054

Query: 1063 VYVPTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQ 1122
              V      D  +  +    E       LDT  +           L I G     +F N 
Sbjct: 1055 TVVILKKNDDNLISKMTALGE------ELDTGKI-------AHCVLVIDGASL-AVFENN 1100

Query: 1123 DNYSEEYVNEILLKGS--IFARMSPDEKHELVE--QLQKMDYTVGFCGDGANDCGALKAA 1178
                  ++ E+  K    I  R SP +K  +V   +L+  D      GDGAND   +++A
Sbjct: 1101 PTMMSVFI-ELCTKTDSVICCRASPSQKALIVTNIRLKNKDLVTLAIGDGANDIAMIQSA 1159

Query: 1179 DVGISLSEAE---ASVAAPFTSKIFDITCVLDVIKEGRASLVTSFACFQYMSLYSAIQFI 1235
            D+G+ ++  E   AS ++ ++   F     L +   GR + V + + F   + Y  + F 
Sbjct: 1160 DIGVGITGKEGLQASRSSDYSIAQFRYLLKL-LFVHGRYNYVRT-SKFVLCTFYKEVLFY 1217

Query: 1236 SITILYSR 1243
               ++Y R
Sbjct: 1218 LTQMIYQR 1225

>Scas_669.3
          Length = 1638

 Score = 60.8 bits (146), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 113/250 (45%), Gaps = 24/250 (9%)

Query: 1001 EEVESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITE 1060
            EE+E +++ LG    ++KL++  S  + K++ A I+  M TGD   TAI++G  C+LI  
Sbjct: 1048 EEIEQDLQLLGATAIEDKLQEGVSEAIEKIRRAGIKIWMLTGDKRETAINIGYSCKLIY- 1106

Query: 1061 DRVYVPTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRIIFS 1120
            D   V  +A  D  +  +   N IS           Q +D  +  + + I       +F 
Sbjct: 1107 DYSTVVILAKGDENI--ISKMNAIS-----------QEVDSGNVAHCVIIIDGSTLAMFE 1153

Query: 1121 NQDNYSEEYVNEILLKGS--IFARMSPDEKHELVEQLQKMDYTVG--FCGDGANDCGALK 1176
                    ++ E+  K    I  R SP +K  +V  ++  +  +     GDGAND   ++
Sbjct: 1154 GNPTLMSVFI-ELCTKTDSVICCRASPSQKSLMVTNIRNSNKNLVTLAIGDGANDIAMIQ 1212

Query: 1177 AADVGISLSEAE---ASVAAPFTSKIFDITCVLDVIKEGRASLVTSFACFQYMSLYSAIQ 1233
            +AD+GI +   E   AS  A ++   F     L ++  GR + + + A F   + +  I 
Sbjct: 1213 SADIGIGIGGKEGLQASRTADYSIAQFRFILKL-LLVHGRYNYIRT-AKFILCTFFKEIT 1270

Query: 1234 FISITILYSR 1243
            F    +++ R
Sbjct: 1271 FYLTQLIFQR 1280

>Scas_688.1
          Length = 913

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 65/293 (22%), Positives = 106/293 (36%), Gaps = 79/293 (26%)

Query: 930  SVIVKPNNENVYWAYTKGAPEVIIDICN-----PATLPSDYDDILNFYTHSGYRVIACAG 984
            +V+  P  E +     KGAP  ++         P  +  +Y++ +      G+R +  A 
Sbjct: 455  AVVESPEGERII--CVKGAPLFVLKTVEEDHPIPEDIHENYENKVAELASRGFRALGVA- 511

Query: 985  KTLPKNTWLYSQKVRREEVESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDN 1044
                           R+  E + E LG +   +  +D T  T+++ +   +R  M TGD 
Sbjct: 512  ---------------RKRGEGHWEILGVMPCMDPPRDDTGETVAEARRLGLRVKMLTGD- 555

Query: 1045 VLTAISVGKEC--QLITEDRVYVPTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDY 1102
               A+ + KE   QL     VY                     NAE              
Sbjct: 556  ---AVGIAKETCRQLGLGTNVY---------------------NAE-------------- 577

Query: 1103 SGPYTLAITGEVFRIIFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDYTV 1162
                         R+  S   +     + + +     FA + P +K+ +VE LQ   Y V
Sbjct: 578  -------------RLGLSGGGDMPGSELADFVENADGFAEVFPQDKYRVVEILQTRGYLV 624

Query: 1163 GFCGDGANDCGALKAADVGISLSEA--EASVAAPFTSKIFDITCVLDVIKEGR 1213
               GDG ND  +LK AD GI++  A   A  AA        ++ ++D +K  R
Sbjct: 625  AMTGDGVNDAPSLKKADTGIAVEGATDAARSAADIVFLAPGLSAIIDALKTSR 677

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 39/61 (63%), Gaps = 4/61 (6%)

Query: 543 VLREGFWSSIHSSELVPGDIYEISDPNLNLLPCDSILLSGDCIV--NESMLTGESVPVSK 600
           V+R+G    + ++E+VPGDI ++ D    ++P D  +++ DC V  ++S +TGES+   K
Sbjct: 177 VIRDGQLVEVPANEVVPGDILQLEDG--VIIPADGRIVTEDCFVQIDQSAITGESLAADK 234

Query: 601 Y 601
           +
Sbjct: 235 H 235

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 37/74 (50%), Gaps = 1/74 (1%)

Query: 709 DKRTMILRALDIITIV-VPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNIGGKIDVMC 767
           D    ILR    ITIV VP  LPA +T   +     L +K       + +     ++++C
Sbjct: 312 DGIVRILRYTLGITIVGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILC 371

Query: 768 FDKTGTLTEDGLDV 781
            DKTGTLT++ L +
Sbjct: 372 SDKTGTLTKNKLSL 385

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (PMA2)
            - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 65/295 (22%), Positives = 110/295 (37%), Gaps = 76/295 (25%)

Query: 927  RRMSVIVK-PNNENVYWAYTKGAPEVIIDICN-----PATLPSDYDDILNFYTHSGYRVI 980
            ++++ IV+ P  E +     KGAP  ++         P  +  +Y++ +      GYR +
Sbjct: 437  KKVTAIVESPEGERI--VCVKGAPLFVLKTVEENHLIPEDVKENYENKVAELASRGYRAL 494

Query: 981  ACAGKTLPKNTWLYSQKVRREEVESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMC 1040
              A                R+  E + E LG +   +  +D T+ T+++ +   +R  M 
Sbjct: 495  GVA----------------RKRGEGHWEILGVMPCMDPPRDDTAQTVNEARHLGLRVKML 538

Query: 1041 TGDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPID 1100
            TGD    A+ + KE                   T + +     I NAE +          
Sbjct: 539  TGD----AVGIAKE-------------------TCRQLGLGTNIYNAERLGLGGGGD--- 572

Query: 1101 DYSGPYTLAITGEVFRIIFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDY 1160
                     + G        N D ++E +               P  K+ +VE LQ+  Y
Sbjct: 573  ---------MPGSELADFVENADGFAEVF---------------PQHKYNVVEILQQRGY 608

Query: 1161 TVGFCGDGANDCGALKAADVGISLSEA--EASVAAPFTSKIFDITCVLDVIKEGR 1213
             V   GDG ND  +LK AD GI++  A   A  AA        ++ ++D +K  R
Sbjct: 609  LVAMTGDGVNDAPSLKKADTGIAVEGATDAARSAADIVFLAPGLSAIIDALKTSR 663

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 38/60 (63%), Gaps = 4/60 (6%)

Query: 543 VLREGFWSSIHSSELVPGDIYEISDPNLNLLPCDSILLSGDCIV--NESMLTGESVPVSK 600
           V+R+G    I ++E+VPGDI ++ D    ++P D  +++  C V  ++S +TGES+ V K
Sbjct: 163 VIRDGSLVEIPANEVVPGDILQLEDG--VIIPADGRIVTEGCFVQIDQSAITGESLAVDK 220

 Score = 37.7 bits (86), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 37/74 (50%)

Query: 708 LDKRTMILRALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNIGGKIDVMC 767
           +D  T++   L I  + VP  LPA +T   +     L +K       + +     ++++C
Sbjct: 298 IDIVTILRYTLAITVVGVPVGLPAVVTTTMAVGAAYLAKKKAIVQKLSAIESLAGVEILC 357

Query: 768 FDKTGTLTEDGLDV 781
            DKTGTLT++ L +
Sbjct: 358 SDKTGTLTKNKLSL 371

>YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transporting
            P-type ATPase of the plasma membrane required for
            nutrient uptake and pH homeostasis, activity is rate
            limiting for growth at low pH [2757 bp, 918 aa]
          Length = 918

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 64/291 (21%), Positives = 105/291 (36%), Gaps = 75/291 (25%)

Query: 930  SVIVKPNNENVYWAYTKGAPEVIIDICN-----PATLPSDYDDILNFYTHSGYRVIACAG 984
            +V+  P  E +     KGAP  ++         P  +  +Y++ +      G+R +  A 
Sbjct: 460  AVVESPEGERI--VCVKGAPLFVLKTVEEDHPIPEDVHENYENKVAELASRGFRALGVA- 516

Query: 985  KTLPKNTWLYSQKVRREEVESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDN 1044
                           R+  E + E LG +   +  +D T+ T+S+ +   +R  M TGD 
Sbjct: 517  ---------------RKRGEGHWEILGVMPCMDPPRDDTAQTVSEARHLGLRVKMLTGD- 560

Query: 1045 VLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDYSG 1104
               A+ + KE                   T + +     I NAE +              
Sbjct: 561  ---AVGIAKE-------------------TCRQLGLGTNIYNAERLGLGGGGD------- 591

Query: 1105 PYTLAITGEVFRIIFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVGF 1164
                 + G        N D ++E +               P  K+ +VE LQ   Y V  
Sbjct: 592  -----MPGSELADFVENADGFAEVF---------------PQHKYRVVEILQNRGYLVAM 631

Query: 1165 CGDGANDCGALKAADVGISLSEA--EASVAAPFTSKIFDITCVLDVIKEGR 1213
             GDG ND  +LK AD GI++  A   A  AA        ++ ++D +K  R
Sbjct: 632  TGDGVNDAPSLKKADTGIAVEGATDAARSAADIVFLAPGLSAIIDALKTSR 682

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 40/61 (65%), Gaps = 4/61 (6%)

Query: 543 VLREGFWSSIHSSELVPGDIYEISDPNLNLLPCDSILLSGDCI--VNESMLTGESVPVSK 600
           V+R+G    I ++E+VPGDI ++ D    ++P D  +++ DC   +++S +TGES+ V K
Sbjct: 182 VIRDGQLVEIPANEVVPGDILQLEDG--TVIPTDGRIVTEDCFLQIDQSAITGESLAVDK 239

Query: 601 Y 601
           +
Sbjct: 240 H 240

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 1/69 (1%)

Query: 714 ILR-ALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNIGGKIDVMCFDKTG 772
           ILR  L I  I VP  LPA +T   +     L +K       + +     ++++C DKTG
Sbjct: 322 ILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTG 381

Query: 773 TLTEDGLDV 781
           TLT++ L +
Sbjct: 382 TLTKNKLSL 390

>Scas_710.41
          Length = 904

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 70/289 (24%), Positives = 112/289 (38%), Gaps = 55/289 (19%)

Query: 525 KKISRTLAEMSHFNCEVRVLREGFWSSIHSSELVPGDIYEISDPNLNLLPCDSILLSGDC 584
           +++ +TLA  +      RV+R+G    I ++E+VPGDI E+ +    ++P D  L++ + 
Sbjct: 157 EELKKTLANTA------RVIRDGTLQEIPANEIVPGDILELDEG--TIIPADGRLVTENR 208

Query: 585 I--VNESMLTGESVPVSKYPASEETILQLFDDFQSTQISTFLSKSFLFNGTTLIRAKIPN 642
              V++S +TGES+ V K                             +   T   + +  
Sbjct: 209 FLQVDQSAITGESLAVDKN----------------------------YGDVTFSSSTVKT 240

Query: 643 GGSVALAMAVRTGFSTTKGSLIRSMVFPKPSGFKFYSDSFKYXXXXXXXXXXXXXXXCIN 702
           G SV +  A  TG +T  G    ++V     G   ++D                      
Sbjct: 241 GTSVMVVTA--TGDNTFVGR-AAALVGEASGGQGHFTDILNDIGTILLVLVIITLLLVWT 297

Query: 703 FIKLGLDKRTMILR-ALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNIGG 761
                 D   MILR  L I  I VP  LPA +T   +     L +K       + +    
Sbjct: 298 ACFYRTDGIVMILRFTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLA 357

Query: 762 KIDVMCFDKTGTLTEDGL-------------DVLGVRVSCAATRNKASF 797
            ++++C DKTGTLT++ L             D L +    AATR K   
Sbjct: 358 GVEILCSDKTGTLTKNKLSLHEPYTVEGVSADDLMLTACLAATRKKKGL 406

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 40/76 (52%), Gaps = 2/76 (2%)

Query: 1140 FARMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALKAADVGISLSEA--EASVAAPFTS 1197
            FA + P  K+++VE LQ   Y V   GDG ND  +LK AD GI++  A   A  AA    
Sbjct: 594  FAEVFPQHKYKVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAVEGATDAARSAADIVF 653

Query: 1198 KIFDITCVLDVIKEGR 1213
                ++ ++D +K  R
Sbjct: 654  LAPGLSAIIDGLKTSR 669

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
            Kluyveromyces lactis Plasma membrane ATPase (Proton
            pump), start by similarity
          Length = 899

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 64/295 (21%), Positives = 110/295 (37%), Gaps = 76/295 (25%)

Query: 927  RRMSVIVK-PNNENVYWAYTKGAPEVIIDICN-----PATLPSDYDDILNFYTHSGYRVI 980
            ++++ IV+ P  E +     KGAP  ++         P  +  +Y++ +      G+R +
Sbjct: 437  KKVTAIVESPEGERII--CVKGAPLFVLKTVEEEHPIPEDVRENYENKVAELASRGFRAL 494

Query: 981  ACAGKTLPKNTWLYSQKVRREEVESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMC 1040
              A                R+  E + E LG +   +  +D T+ T+++ +   +R  M 
Sbjct: 495  GVA----------------RKRGEGHWEILGVMPCMDPPRDDTAQTVNEARHLGLRVKML 538

Query: 1041 TGDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPID 1100
            TGD    A+ + KE                   T + +     I NAE +          
Sbjct: 539  TGD----AVGIAKE-------------------TCRQLGLGTNIYNAERLGLGGGGD--- 572

Query: 1101 DYSGPYTLAITGEVFRIIFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDY 1160
                     + G        N D ++E +               P  K+ +VE LQ+  Y
Sbjct: 573  ---------MPGSELADFVENADGFAEVF---------------PQHKYNVVEILQQRGY 608

Query: 1161 TVGFCGDGANDCGALKAADVGISLSEA--EASVAAPFTSKIFDITCVLDVIKEGR 1213
             V   GDG ND  +LK AD GI++  A   A  AA        ++ ++D +K  R
Sbjct: 609  LVAMTGDGVNDAPSLKKADTGIAVEGATDAARSAADIVFLAPGLSAIIDALKTSR 663

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 39/60 (65%), Gaps = 4/60 (6%)

Query: 543 VLREGFWSSIHSSELVPGDIYEISDPNLNLLPCDSILLSGDCI--VNESMLTGESVPVSK 600
           V+R+G    + S+E+VPGDI ++ D    ++P D  L++ DC   +++S +TGES+ V K
Sbjct: 163 VIRDGNLVEVPSNEVVPGDILQLEDG--VVIPADGRLVTEDCFIQIDQSAITGESLAVDK 220

 Score = 38.1 bits (87), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 38/74 (51%), Gaps = 1/74 (1%)

Query: 709 DKRTMILRALDIITIV-VPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNIGGKIDVMC 767
           +K   ILR    ITIV VP  LPA +T   +     L +K       + +     ++++C
Sbjct: 298 NKIVRILRYTLAITIVGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILC 357

Query: 768 FDKTGTLTEDGLDV 781
            DKTGTLT++ L +
Sbjct: 358 SDKTGTLTKNKLSL 371

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P-type
            ATPase of the plasma membrane, expression not detected
            under normal growth conditions [2844 bp, 947 aa]
          Length = 947

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 63/291 (21%), Positives = 105/291 (36%), Gaps = 75/291 (25%)

Query: 930  SVIVKPNNENVYWAYTKGAPEVIIDICN-----PATLPSDYDDILNFYTHSGYRVIACAG 984
            +V+  P  E +     KGAP  ++         P  +  +Y++ +      G+R +  A 
Sbjct: 489  AVVESPEGERI--VCVKGAPLFVLKTVEEDHPIPEDVHENYENKVAELASRGFRALGVA- 545

Query: 985  KTLPKNTWLYSQKVRREEVESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDN 1044
                           R+  E + E LG +   +  +D T+ T+++ +   +R  M TGD 
Sbjct: 546  ---------------RKRGEGHWEILGVMPCMDPPRDDTAQTINEARNLGLRIKMLTGD- 589

Query: 1045 VLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDYSG 1104
               A+ + KE                   T + +     I NAE +              
Sbjct: 590  ---AVGIAKE-------------------TCRQLGLGTNIYNAERLGLGGGGD------- 620

Query: 1105 PYTLAITGEVFRIIFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVGF 1164
                 + G        N D ++E +               P  K+ +VE LQ   Y V  
Sbjct: 621  -----MPGSELADFVENADGFAEVF---------------PQHKYRVVEILQNRGYLVAM 660

Query: 1165 CGDGANDCGALKAADVGISLSEA--EASVAAPFTSKIFDITCVLDVIKEGR 1213
             GDG ND  +LK AD GI++  A   A  AA        ++ ++D +K  R
Sbjct: 661  TGDGVNDAPSLKKADTGIAVEGATDAARSAADIVFLAPGLSAIIDALKTSR 711

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 59/246 (23%), Positives = 103/246 (41%), Gaps = 44/246 (17%)

Query: 543 VLREGFWSSIHSSELVPGDIYEISDPNLNLLPCDSILLSGDCI--VNESMLTGESVPVSK 600
           V+R+G    I ++E+VPG+I ++    +   P D  +++ DC   +++S +TGES+   K
Sbjct: 211 VIRDGQLIEIPANEVVPGEILQLESGTIA--PADGRIVTEDCFLQIDQSAITGESLAAEK 268

Query: 601 YPASEETILQLFDDFQSTQIST---FLSKSFLFNGTTLIRAKIPNGGSVALAMAVRTGFS 657
           +   E         F S+ + T   F+  +   + T + RA       V  A  V   F+
Sbjct: 269 HYGDEV--------FSSSTVKTGEAFMVVTATGDNTFVGRA----AALVGQASGVEGHFT 316

Query: 658 TT-KGSLIRSMVFPKPSGFKFYSDSFKYXXXXXXXXXXXXXXXCINFIKLGLDKRTMILR 716
               G  I  +V    +    ++  F                    +  +G+     ILR
Sbjct: 317 EVLNGIGIILLVLVIATLLLVWTACF--------------------YRTVGI---VSILR 353

Query: 717 -ALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNIGGKIDVMCFDKTGTLT 775
             L I  I VP  LPA +T   +     L +K       + +     ++++C DKTGTLT
Sbjct: 354 YTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLT 413

Query: 776 EDGLDV 781
           ++ L +
Sbjct: 414 KNKLSL 419

>Kwal_47.17522
          Length = 899

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 63/291 (21%), Positives = 105/291 (36%), Gaps = 75/291 (25%)

Query: 930  SVIVKPNNENVYWAYTKGAPEVIIDICN-----PATLPSDYDDILNFYTHSGYRVIACAG 984
            +V+  P  E +     KGAP  ++         P  +  +Y++ +      G+R +  A 
Sbjct: 441  AVVESPEGERII--CVKGAPLFVLKTVEEDHPIPEDVHENYENKVAELASRGFRALGVA- 497

Query: 985  KTLPKNTWLYSQKVRREEVESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDN 1044
                           R+  E + E LG +   +  +D T+ T+ + +   +R  M TGD 
Sbjct: 498  ---------------RKRGEGHWEILGVMPCMDPPRDDTAQTVHEARRLGLRVKMLTGD- 541

Query: 1045 VLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDYSG 1104
               A+ + KE                   T + +     I NAE +              
Sbjct: 542  ---AVGIAKE-------------------TCRQLGLGTNIYNAERLGLGGGGD------- 572

Query: 1105 PYTLAITGEVFRIIFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVGF 1164
                 + G        N D ++E +               P  K+ +VE LQ+  Y V  
Sbjct: 573  -----MPGSELADFVENADGFAEVF---------------PQHKYSVVEILQQRGYLVAM 612

Query: 1165 CGDGANDCGALKAADVGISLSEA--EASVAAPFTSKIFDITCVLDVIKEGR 1213
             GDG ND  +LK AD GI++  A   A  AA        ++ ++D +K  R
Sbjct: 613  TGDGVNDAPSLKKADTGIAVEGATDAARSAADIVFLAPGLSAIIDALKTSR 663

 Score = 38.9 bits (89), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 40/62 (64%), Gaps = 6/62 (9%)

Query: 543 VLREGFWSSIHSSELVPGDIYEISDPNLNLLPC-DSILLSGDCI--VNESMLTGESVPVS 599
           V+R+G    I ++E+VPGDI ++ D    ++ C D  L++ +C   +++S +TGES+ V 
Sbjct: 163 VVRDGNLVEIPANEVVPGDIMQLED---GVVICADGRLVTEECFLQIDQSAITGESLAVD 219

Query: 600 KY 601
           K+
Sbjct: 220 KH 221

 Score = 38.5 bits (88), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 37/74 (50%), Gaps = 1/74 (1%)

Query: 709 DKRTMILR-ALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNIGGKIDVMC 767
           D+   ILR  L I  I VP  LPA +T   +     L +K       + +     ++++C
Sbjct: 298 DRIVRILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILC 357

Query: 768 FDKTGTLTEDGLDV 781
            DKTGTLT++ L +
Sbjct: 358 SDKTGTLTKNKLSL 371

>Scas_569.0d
          Length = 468

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 49/97 (50%), Gaps = 3/97 (3%)

Query: 1120 SNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALKAAD 1179
            S  D  + E ++ + +   + AR SP  K  ++E L + D      GDG ND  +LK A+
Sbjct: 85   SQFDELTPEQIDNLPVLPLVIARCSPQTKVRMIEALHRRDKFCAMTGDGVNDSPSLKMAN 144

Query: 1180 VGISLSEAEASVAAPFTSKIF---DITCVLDVIKEGR 1213
            VGI++    + VA   +  +    +   +L+ I+EGR
Sbjct: 145  VGIAMGINGSDVAKDASDIVLSDDNFASILNAIEEGR 181

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
            Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
            Saccharomyces cerevisiae YPL036w PMA2, hypothetical start
          Length = 902

 Score = 50.8 bits (120), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 62/292 (21%), Positives = 107/292 (36%), Gaps = 77/292 (26%)

Query: 930  SVIVKPNNENVYWAYTKGAPEVIIDICN-----PATLPSDYDDILNFYTHSGYRVIACAG 984
            +V+  P  E +     KGAP  ++         P  +  +Y++ +      G+R +  A 
Sbjct: 444  AVVESPEGERI--VCVKGAPLFVLKTVEEDHPIPEDVHENYENKVAELASRGFRALGVA- 500

Query: 985  KTLPKNTWLYSQKVRREEVESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDN 1044
                           R+  E + E LG +   +  +D T+ T+++ +   +R  M TGD 
Sbjct: 501  ---------------RKRGEGHWEILGVMPCMDPPRDDTAETVNEARRLGLRVKMLTGD- 544

Query: 1045 VLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDYSG 1104
               A+ + KE                   T + +     I NAE +              
Sbjct: 545  ---AVGIAKE-------------------TCRQLGLGTNIYNAERLGLGGGGD------- 575

Query: 1105 PYTLAITGEVFRIIFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVGF 1164
                 + G        N D ++E +               P  K+++VE LQ   Y V  
Sbjct: 576  -----MPGSELADFVENADGFAEVF---------------PQHKYKVVEILQNRGYLVAM 615

Query: 1165 CGDGANDCGALKAADVGISLSEAEASVAAPFTSKIF---DITCVLDVIKEGR 1213
             GDG ND  +LK AD GI++ E  +  A      +F    ++ ++D +K  R
Sbjct: 616  TGDGVNDAPSLKKADTGIAV-EGASDAARSAADIVFLAPGLSAIIDALKTSR 666

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 47/77 (61%), Gaps = 10/77 (12%)

Query: 526 KISRTLAEMSHFNCEVRVLREGFWSSIHSSELVPGDIYEISDPNLNLLPCDSILLSGDCI 585
           ++ +TLA ++       V+R+G    + ++E+VPGDI ++ D    ++P D  L++ +C 
Sbjct: 155 ELKKTLANVA------VVIRDGQLVEVPANEVVPGDILQLEDG--TIIPADGRLVTENCF 206

Query: 586 --VNESMLTGESVPVSK 600
             V++S +TGES+ V K
Sbjct: 207 LQVDQSAITGESLAVDK 223

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 36/74 (48%), Gaps = 1/74 (1%)

Query: 709 DKRTMILR-ALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNIGGKIDVMC 767
           D    ILR  L I  I VP  LPA +T   +     L +K       + +     ++++C
Sbjct: 301 DNIVKILRFTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILC 360

Query: 768 FDKTGTLTEDGLDV 781
            DKTGTLT++ L +
Sbjct: 361 SDKTGTLTKNKLSL 374

>KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces
            cerevisiae YDR270w CCC2 probable copper-transporting
            ATPase, start by similarity
          Length = 975

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query: 1139 IFARMSPDEKHELVEQLQKMDYT-VGFCGDGANDCGALKAADVGISLSEA 1187
            +F+ ++P++K ++V QLQ      V F GDG ND  AL  AD+GIS+S  
Sbjct: 794  VFSEVTPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISISSG 843

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 43/83 (51%), Gaps = 3/83 (3%)

Query: 523 ETKKISRTLAEMSHFNCEVRVLREGFWSSIHSSELVPGDIYEISDPNLNLLPCDSILLSG 582
           ET      L  ++  +C + VL +G    I    L P DI E+  P + + P D +++  
Sbjct: 393 ETSTAMSKLISLTPSSCSI-VLPDGSTREISVELLQPNDIVEVV-PGMKI-PADGVVIRN 449

Query: 583 DCIVNESMLTGESVPVSKYPASE 605
           +  V+ES++TGES+ V K   S+
Sbjct: 450 ETEVDESLITGESMLVEKIVGSQ 472

>ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH] (511968..514400)
            [2433 bp, 810 aa]
          Length = 810

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/49 (48%), Positives = 33/49 (67%), Gaps = 2/49 (4%)

Query: 1138 SIFARMSPDEKHELVEQL-QKMDYTVGFCGDGANDCGALKAADVGISLS 1185
            ++F+   P+ K +++ QL QK DY V F GDG ND  AL  +D+GISLS
Sbjct: 631  NVFSERLPEGKCDVLRQLRQKYDY-VAFIGDGINDSVALAESDLGISLS 678

 Score = 37.7 bits (86), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%)

Query: 573 LPCDSILLSGDCIVNESMLTGESVPVSKYPASE 605
           LP D  +L G+  V+ES++TGES  V KYP S 
Sbjct: 284 LPADGTVLEGEAEVDESLMTGESTLVPKYPGSR 316

>CAGL0M08602g complement(856349..859387) similar to sp|P38995
            Saccharomyces cerevisiae YDR270w CCC2, start by
            similarity
          Length = 1012

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 32/50 (64%)

Query: 1138 SIFARMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALKAADVGISLSEA 1187
            ++++ ++PD K + VE L++    + F GDG ND  AL  +D+GI++S  
Sbjct: 807  NVYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIAISSG 856

>Kwal_55.21575
          Length = 989

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 33/49 (67%), Gaps = 1/49 (2%)

Query: 1138 SIFARMSPDEKHELVEQLQKMDY-TVGFCGDGANDCGALKAADVGISLS 1185
            ++++ ++P +K++LV+ LQ      V F GDG ND  AL  +D+G+S+S
Sbjct: 791  NVYSELTPADKNQLVQDLQDGGRKNVAFIGDGINDSPALVTSDLGVSIS 839

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 27/42 (64%), Gaps = 2/42 (4%)

Query: 560 GDIYEISDPNLNLLPCDSILLSGDCIVNESMLTGESVPVSKY 601
           GD  EI  P   + P D +++ G+  V+ES++TGES+ V +Y
Sbjct: 430 GDTVEIK-PGAKI-PTDGVIIEGESEVDESLITGESLMVPRY 469

>Scas_505.4
          Length = 1025

 Score = 38.9 bits (89), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 66/149 (44%), Gaps = 23/149 (15%)

Query: 1134 LLKGSIFARMSPDEKHELVEQLQKMDYTVGFC-GDGANDCGALKAADVGISLSEAEASVA 1192
            + K  +  R+SP +K  +V+ +++   ++    GDGAND   ++AA VG+ +S  E   A
Sbjct: 585  ICKAVVCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQA 644

Query: 1193 APFTSKIFDITCVLDVIKEGRASLVTSFACFQYMSLYS---AIQFISITILYSRGSNLGD 1249
            A    +  DI              V  F   + + L     + Q IS+ ILYS   N   
Sbjct: 645  A----RSADIA-------------VGQFRFLKKLLLVHGSWSYQRISVAILYSFYKNTAL 687

Query: 1250 F--QFLYIDLLLIIPIAVTMSWSKPYHEL 1276
            +  QF ++        ++  SW+  Y+ +
Sbjct: 688  YMTQFWFVFANAFSGQSIMESWTMSYYNV 716

>Scas_615.9
          Length = 942

 Score = 38.5 bits (88), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 1138 SIFARMSPDEKHELVEQLQKMDYT-VGFCGDGANDCGALKAADVGISLS 1185
            ++++ ++P  K E+VE LQ      V F GDG ND   L  +D+G++LS
Sbjct: 746  NVYSGVTPSGKCEIVESLQADSVGGVAFVGDGINDSPVLVTSDIGVALS 794

 Score = 35.4 bits (80), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 33/54 (61%), Gaps = 2/54 (3%)

Query: 552 IHSSELVPGDIYEISDPNLNLLPCDSILLSGDCIVNESMLTGESVPVSKYPASE 605
           I ++ L   DI EI  P + + P D I++ G+  ++ES++TGES+ V K   S+
Sbjct: 374 IETNLLQRNDIIEIK-PGMKI-PADGIIIQGESEIDESLMTGESILVHKQKGSQ 425

>KLLA0D04092g complement(344666..348124) some similarities with
            sp|P38995 Saccharomyces cerevisiae YDR270w CCC2 probable
            copper-transporting ATPase P16.2.f2.1, hypothetical start
          Length = 1152

 Score = 37.7 bits (86), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 37/77 (48%), Gaps = 7/77 (9%)

Query: 1118 IFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDY-------TVGFCGDGAN 1170
            + S  +  +   V + L   ++ A + P+EK   V+ +Q  +         V   GDG N
Sbjct: 951  MISGDNEVTARAVAQELDIDNVIAEVLPEEKAAKVKWIQHNNIGANGHHKVVAMVGDGIN 1010

Query: 1171 DCGALKAADVGISLSEA 1187
            D  AL AADVGI+L+  
Sbjct: 1011 DAPALAAADVGIALASG 1027

 Score = 37.4 bits (85), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 52/116 (44%), Gaps = 11/116 (9%)

Query: 526 KISRTLAEMSHFNCEVRVLREGFWSSIHSSELVPGDIYEISD-----PNLNLLPCDSILL 580
           K +  ++ +S F  E   L +         E V     E+ D     P  +  P DSI+L
Sbjct: 535 KTASAISNLSSFKQETATLMQKVGDQYQEVETVQIQYLELGDYIKISPGQSP-PLDSIIL 593

Query: 581 SGDCIVNESMLTGESVPVSKYPASEETILQLFDDFQSTQISTFLSKSFLFNGTTLI 636
            G+   +ES LTGES+P+ +         Q+F    +   S+ ++K   F+G +L+
Sbjct: 594 EGETEFDESALTGESIPMVRLRGD-----QIFAGTVNVGSSSVIAKVSSFDGESLL 644

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 30/64 (46%), Gaps = 9/64 (14%)

Query: 717 ALDIITIVVPP----ALPATLTIGTSFALNRLKEKGIFCIAP-TRVNIGGKIDVMCFDKT 771
           A+ +  I  P     A P  L +G+  A     + GI C         G KI ++CFDKT
Sbjct: 716 AISVFVIACPCGIGLAAPTALFVGSGMA----AKFGILCRGGGAAFQEGCKIAIVCFDKT 771

Query: 772 GTLT 775
           GTLT
Sbjct: 772 GTLT 775

>AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) [3702
            bp, 1233 aa]
          Length = 1233

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 1139 IFARMSPDEKHELVEQLQK---MDYTVGFCGDGANDCGALKAADVGISLSEA 1187
            + A + P+ K E ++ +++       +   GDG ND  A+ AADVGISL+  
Sbjct: 1061 VIADVLPEGKAEKIQWIRETSGQGVAIAMVGDGMNDAPAIAAADVGISLASG 1112

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 47/226 (20%), Positives = 80/226 (35%), Gaps = 63/226 (27%)

Query: 576 DSILLSGDCIVNESMLTGESVPVSKYPASE--ETILQLFDDFQSTQISTFLSKSFLFNGT 633
           D++++ G+   +ES LTGES P++ +P  +     + +       ++ST    S L +  
Sbjct: 681 DALIVQGETEFDESSLTGESRPITHFPGDQIFAGTVNVGQCAVIAKVSTAPGNSLLDHVI 740

Query: 634 TLIRAKIPNGGSVALAMAVRTGFSTT------------------KGSLIRSMVFPKPSGF 675
           + +R     G  +     V TG+                      G L +  +     G+
Sbjct: 741 SAVRDGQLRGAPIERIADVLTGYFVPFIVLLAILTWAIWLILGFAGVLSQEKLDGSVGGW 800

Query: 676 KFYSDSFKYXXXXXXXXXXXXXXXCINFIKLGLDKRTMILRALDIITIVVPP----ALPA 731
            F+S  F                                  A+ +  I  P     A P 
Sbjct: 801 PFWSLEF----------------------------------AIAVFVIACPCGIGLAAPT 826

Query: 732 TLTIGTSFALNRLKEKGIFCIAPTRV-NIGGKIDVMCFDKTGTLTE 776
            L +G + A     + GI     +    +G K+  +CFDKTGTLT+
Sbjct: 827 ALFVGANIA----AKYGILARGGSAAFQMGSKVTTVCFDKTGTLTK 868

>YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transporting
            P-type ATPase, member of the heavy-metal transporting
            P-type ATPases in the superfamily of P-type ATPases [3015
            bp, 1004 aa]
          Length = 1004

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 33/50 (66%), Gaps = 2/50 (4%)

Query: 1138 SIFARMSPDEKHELVEQLQ--KMDYTVGFCGDGANDCGALKAADVGISLS 1185
            ++++ +SP  K +LV+++Q  + +  V   GDG ND  AL  +D+GI++S
Sbjct: 807  NVYSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALSDLGIAIS 856

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 26/40 (65%), Gaps = 2/40 (5%)

Query: 561 DIYEISDPNLNLLPCDSILLSGDCIVNESMLTGESVPVSK 600
           DI EI  P + + P D I+  G+  ++ES++TGES+ V K
Sbjct: 435 DIVEIK-PGMKI-PADGIITRGESEIDESLMTGESILVPK 472

>YBR295W (PCA1) [472] chr2 (792805..796455) P-type
           copper-transporting ATPase, involved in resistance to
           cadmium [3651 bp, 1216 aa]
          Length = 1216

 Score = 34.3 bits (77), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 51/237 (21%), Positives = 97/237 (40%), Gaps = 51/237 (21%)

Query: 560 GDIYEISDPNLNLLPCDSILLSGDCIVNESMLTGESVPVSKYPASEETILQLFDDFQSTQ 619
           GDI+++  P+ + +P D  ++SG   V+E+++TGES+PV K                   
Sbjct: 717 GDIFKVL-PD-SRIPTDGTVISGSSEVDEALITGESMPVPKKCQ---------------- 758

Query: 620 ISTFLSKSFLFNGTTLIR-AKIPNGGSVALAMAVRTGFSTTKGSLIRSMVFPKPSGFKFY 678
            S  ++ S    GT  ++ +K+P   ++           +T  +++      KP   K  
Sbjct: 759 -SIVVAGSVNGTGTLFVKLSKLPGNNTI-----------STIATMVDEAKLTKP---KIQ 803

Query: 679 SDSFKYXXXXXXXXXXXXXXXCINFIKLGL--DKRT-------MILRALDIITIVVPP-- 727
           + + K                   +I +G+  +K++        I+ A+ ++ +  P   
Sbjct: 804 NIADKIASYFVPTIIGITVVTFCVWIAVGIRVEKQSRSDAVIQAIIYAITVLIVSCPCVI 863

Query: 728 --ALPATLTIGTSFALNRLKEKGIFCIAPTRVNIGGKIDVMCFDKTGTLTEDGLDVL 782
             A+P    I +  A  R    G+   +   + +      + FDKTGTLTE  L V+
Sbjct: 864 GLAVPIVFVIASGVAAKR----GVIFKSAESIEVAHNTSHVVFDKTGTLTEGKLTVV 916

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 10/60 (16%)

Query: 1138 SIFARMSPDEKHELVEQL----------QKMDYTVGFCGDGANDCGALKAADVGISLSEA 1187
            +I +  +P EK E ++ +          Q     V FCGDG ND   L  A +G+ ++E 
Sbjct: 1068 NIRSHATPAEKSEYIKDIVEGRNCDSSSQSKRPVVVFCGDGTNDAIGLTQATIGVHINEG 1127

>Kwal_26.9455
          Length = 525

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 54/128 (42%), Gaps = 17/128 (13%)

Query: 770 KTGTLTEDGLDVLGVRVSCAATRNKASFSDLISDTHDIFP----------KFSLKDCSNP 819
           K GTL +  +  LG+              ++  +   +FP          K   K    P
Sbjct: 25  KAGTLLDKAISALGLSPDAVLDSLPKGLQNVWGEMGLLFPHETSQMEFVTKPKTKVNRRP 84

Query: 820 DDYKRRNFLISLLTCHSLRV---VDGELLGDPLDFKMFQFTGWSYEEDFQNHQFHSLYEE 876
           D  +  +F++     H LRV    D ++LG  +D  + Q+TG+   E+   H F+  +E 
Sbjct: 85  D--QEWDFVVQQDASHKLRVNKVKDPQVLG--VDPGVKQYTGYLDVEEEDKHFFYWFFES 140

Query: 877 RHEGQNFP 884
           R++ +N P
Sbjct: 141 RNDPKNDP 148

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.136    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 45,670,270
Number of extensions: 2036431
Number of successful extensions: 5786
Number of sequences better than 10.0: 96
Number of HSP's gapped: 5801
Number of HSP's successfully gapped: 197
Length of query: 1430
Length of database: 16,596,109
Length adjustment: 114
Effective length of query: 1316
Effective length of database: 12,649,657
Effective search space: 16646948612
Effective search space used: 16646948612
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)