Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M11286g33833317920.0
YMR228W (MTF1)3413398981e-120
Sklu_2383.23383378881e-119
Scas_594.53433408591e-114
Kwal_26.91803413418451e-112
KLLA0B08283g3353345914e-74
AFR564W3343255751e-71
Scas_27.126573681.4
KLLA0C08888g177570672.5
Sklu_2433.950273662.6
Scas_674.21004101663.1
KLLA0D03927g202166643.5
Scas_648.5140889654.4
CAGL0L02189g55641644.5
AGL337C58177644.7
CAGL0M11374g98492645.5
Scas_691.771461637.2
CAGL0K11088g97269629.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M11286g
         (333 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M11286g 1108814..1109830 similar to sp|P14908 Saccharomyces...   694   0.0  
YMR228W (MTF1) [4184] chr13 (724625..725650) Mitochondrial RNA p...   350   e-120
Sklu_2383.2 YMR228W, Contig c2383 8318-9334 reverse complement        346   e-119
Scas_594.5                                                            335   e-114
Kwal_26.9180                                                          330   e-112
KLLA0B08283g complement(736483..737490) gi|3024184|sp|P87250|MTF...   232   4e-74
AFR564W [3756] [Homologous to ScYMR228W (MTF1) - SH] complement(...   226   1e-71
Scas_27.1                                                              31   1.4  
KLLA0C08888g 776287..781614 similar to sp|O13423 Candida albican...    30   2.5  
Sklu_2433.9 YFR044C, Contig c2433 13344-14852                          30   2.6  
Scas_674.2                                                             30   3.1  
KLLA0D03927g 331864..332472 no similarity, hypothetical start          29   3.5  
Scas_648.5                                                             30   4.4  
CAGL0L02189g complement(256073..257743) similar to sp|Q02206 Sac...    29   4.5  
AGL337C [3975] [Homologous to ScYMR313C - SH] (79693..81438) [17...    29   4.7  
CAGL0M11374g complement(1117223..1120177) weakly similar to sp|P...    29   5.5  
Scas_691.7                                                             29   7.2  
CAGL0K11088g complement(1078328..1081246) highly similar to sp|P...    28   9.4  

>CAGL0M11286g 1108814..1109830 similar to sp|P14908 Saccharomyces
           cerevisiae YMR228w MTF1 RNA polymerase specific factor,
           start by similarity
          Length = 338

 Score =  694 bits (1792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/333 (100%), Positives = 333/333 (100%)

Query: 1   MKVAVPTISQLHIKSYYGFRYLLDPDWHQKVFEKLGLSSNPNMKVLDLYPGPGIHSAVLY 60
           MKVAVPTISQLHIKSYYGFRYLLDPDWHQKVFEKLGLSSNPNMKVLDLYPGPGIHSAVLY
Sbjct: 1   MKVAVPTISQLHIKSYYGFRYLLDPDWHQKVFEKLGLSSNPNMKVLDLYPGPGIHSAVLY 60

Query: 61  NKVQPQQYTMMECRRDFLSNLRNIYTDGPMELVKKDPYKWESYTELIDQEKLFVPKKADY 120
           NKVQPQQYTMMECRRDFLSNLRNIYTDGPMELVKKDPYKWESYTELIDQEKLFVPKKADY
Sbjct: 61  NKVQPQQYTMMECRRDFLSNLRNIYTDGPMELVKKDPYKWESYTELIDQEKLFVPKKADY 120

Query: 121 NVVNKDFYIMANLTEKKHEGLLMQWMNCVGNRNWLFRFGRSPMLIWMPTPTASKLLADSG 180
           NVVNKDFYIMANLTEKKHEGLLMQWMNCVGNRNWLFRFGRSPMLIWMPTPTASKLLADSG
Sbjct: 121 NVVNKDFYIMANLTEKKHEGLLMQWMNCVGNRNWLFRFGRSPMLIWMPTPTASKLLADSG 180

Query: 181 DHSRHKCSLVREAFTDTKLVALSQEEDMKSFNSVCLDKSNPLVIPDGTDYGGKDFPIALV 240
           DHSRHKCSLVREAFTDTKLVALSQEEDMKSFNSVCLDKSNPLVIPDGTDYGGKDFPIALV
Sbjct: 181 DHSRHKCSLVREAFTDTKLVALSQEEDMKSFNSVCLDKSNPLVIPDGTDYGGKDFPIALV 240

Query: 241 EFTPKKHDIDLDNWEFVTKHLMVLYKTPLIDAIDCLGHGARDYFSANIDKDHIHLLKKCP 300
           EFTPKKHDIDLDNWEFVTKHLMVLYKTPLIDAIDCLGHGARDYFSANIDKDHIHLLKKCP
Sbjct: 241 EFTPKKHDIDLDNWEFVTKHLMVLYKTPLIDAIDCLGHGARDYFSANIDKDHIHLLKKCP 300

Query: 301 QDFTNNDFVYLTNLFHLWPFKPDVYMDFLDIYQ 333
           QDFTNNDFVYLTNLFHLWPFKPDVYMDFLDIYQ
Sbjct: 301 QDFTNNDFVYLTNLFHLWPFKPDVYMDFLDIYQ 333

>YMR228W (MTF1) [4184] chr13 (724625..725650) Mitochondrial RNA
           polymerase specificity factor, distantly related to
           bacterial sigma factors [1026 bp, 341 aa]
          Length = 341

 Score =  350 bits (898), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 166/339 (48%), Positives = 237/339 (69%), Gaps = 9/339 (2%)

Query: 1   MKVAVPTISQLH-IKSYYGFRYLLDPDWHQKVFEKLGLSSN----PNMKVLDLYPGPGIH 55
           M V +P I  +  +K +YGF+YL +P  + K+F+KL L+        +KVLDLYPG GI 
Sbjct: 1   MSVPIPGIKDISKLKFFYGFKYLWNPTVYNKIFDKLDLTKTYKHPEELKVLDLYPGVGIQ 60

Query: 56  SAVLYNKVQPQQYTMMECRRDFLSNLRNIYTDGPMELVKKDPYKWESYTELIDQEKLFVP 115
           SA+ YNK  P+QY+++E R      L   +   P++++K+DPY W +Y+ LID+E++FVP
Sbjct: 61  SAIFYNKYCPRQYSLLEKRSSLYKFLNAKFEGSPLQILKRDPYDWSTYSNLIDEERIFVP 120

Query: 116 KKADYNVVNKDFYIMANLTEKKHEGLLMQWMNCVGNRNWLFRFGRSPMLIWMPTPTASKL 175
           +    + +N  F  +AN+T +  EGL+MQW++C+GN+NWL+RFG+  ML+WMP+ TA KL
Sbjct: 121 EVQSSDHINDKFLTVANVTGEGSEGLIMQWLSCIGNKNWLYRFGKVKMLLWMPSTTARKL 180

Query: 176 LADSGDHSRHKCSLVREAFTDTKLVALSQEEDMKSFNSVCLDKSNPLVIPDGTDYGGKDF 235
           LA  G HSR KCS+VREAFTDTKL+A+S   ++K F+S C+++ +P++      +  K  
Sbjct: 181 LARPGMHSRSKCSVVREAFTDTKLIAISDANELKGFDSQCIEEWDPILFSAAEIWPTKGK 240

Query: 236 PIALVEFTPKKHDIDLDNWEFVTKHLMVLYKTPLIDAIDCLGHGARDYFSANI-DKDHIH 294
           PIALVE  P   D D+DNW++VT+HLM+L +TPL   +D LGHG + YF++ I DKD   
Sbjct: 241 PIALVEMDPIDFDFDVDNWDYVTRHLMILKRTPLNTVMDSLGHGGQQYFNSRITDKD--- 297

Query: 295 LLKKCPQDFTNNDFVYLTNLFHLWPFKPDVYMDFLDIYQ 333
           LLKKCP D TN++F+YLT LF  WPFKPD+ MDF+D+YQ
Sbjct: 298 LLKKCPIDLTNDEFIYLTKLFMEWPFKPDILMDFVDMYQ 336

>Sklu_2383.2 YMR228W, Contig c2383 8318-9334 reverse complement
          Length = 338

 Score =  346 bits (888), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 166/337 (49%), Positives = 231/337 (68%), Gaps = 6/337 (1%)

Query: 1   MKVAVPTI-SQLHIKSYYGFRYLLDPDWHQKVFEKLGLSSNPNM---KVLDLYPGPGIHS 56
           M V +PT+ S   IK YYGF+YLL+   H +++ KL L S   M   KVLDLYPGP  HS
Sbjct: 1   MSVHIPTLNSATKIKHYYGFKYLLNSSVHTQIYNKLQLQSTYKMDELKVLDLYPGPSQHS 60

Query: 57  AVLYNKVQPQQYTMMECRRDFLSNLRNIYTDGPMELVKKDPYKWESYTELIDQEKLFVPK 116
           A+  N   P+QY +M+ R DF+  +++ +    MEL ++DPY+W SYT++I++EK FVP 
Sbjct: 61  AIFRNIFNPKQYVLMDSRPDFVKFIQDNFAGTSMELYQRDPYEWSSYTDMIEKEKRFVPN 120

Query: 117 KADYNVVNKDFYIMANLTEKKHEGLLMQWMNCVGNRNWLFRFGRSPMLIWMPTPTASKLL 176
           +   + ++  F +MANLT    EGL MQW++C+GN+NWL RFGR  ML+W+P  TA K+L
Sbjct: 121 RQSRDKIHNQFLVMANLTGMIGEGLFMQWLSCIGNKNWLQRFGRVKMLVWVPEATAHKVL 180

Query: 177 ADSGDHSRHKCSLVREAFTDTKLVALSQEEDMKSFNSVCLDKSNPLVIPDGTDYGGKDFP 236
           A  G   R KCS+V EAFTDTKLVA S    ++ F+S  L++ +P++      +     P
Sbjct: 181 ARPGSLIRAKCSVVTEAFTDTKLVATSDSSTLQKFSSSLLEEHDPIIFSTRDTWLNSGKP 240

Query: 237 IALVEFTPKKHDIDLDNWEFVTKHLMVLYKTPLIDAIDCLGHGARDYFSANIDKDHIHLL 296
           I+L+E  P  HDIDLDNW++VTKHL++L  TPL  AID LGHG + YFS  ++ D + L+
Sbjct: 241 ISLLEVNPIDHDIDLDNWDYVTKHLLILKSTPLHTAIDSLGHGGKQYFSEKVE-DKL-LM 298

Query: 297 KKCPQDFTNNDFVYLTNLFHLWPFKPDVYMDFLDIYQ 333
            KCP+D TN +FVYLT++F+ WPFKPD+YMDF+D++Q
Sbjct: 299 DKCPKDLTNKEFVYLTSIFNNWPFKPDIYMDFIDVFQ 335

>Scas_594.5
          Length = 343

 Score =  335 bits (859), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 159/340 (46%), Positives = 231/340 (67%), Gaps = 9/340 (2%)

Query: 1   MKVAVPTISQLH-IKSYYGFRYLLDPDWHQKVFEKLGLSS-NPNMKVLDLYPGPGIHSAV 58
           M ++VPT   L  I   YG +YL++P    K+F+KL     +  +KVLD+YPGP + S +
Sbjct: 1   MSLSVPTTGVLSKITQRYGSQYLINPKVFDKIFKKLDFKEYSSTLKVLDMYPGPCVQSTM 60

Query: 59  LYNKVQPQQYTMMECRRDFLSNLRNIYT-DGPMELVKKDPYKWESYTELIDQEKLFVPKK 117
            YNK QP+QY +ME R  F+  +++ +    P+E  ++DPY WES+ E+I++EKL VP+K
Sbjct: 61  FYNKYQPKQYVLMESRSQFVKLIKSEFPFPSPLERTERDPYHWESFIEIIEKEKLLVPEK 120

Query: 118 ADYNVVNKDFYIMANLTEKKHEGLLMQWMNCVGNRNWLFRFGRSPMLIWMPTPTASKLLA 177
                ++  F ++ N+T + +E L+MQW +C+GNRNWL RFGR  ML+W+P  TASKL+A
Sbjct: 121 QPLTHIHNSFLVVGNVTNRNNESLIMQWFHCIGNRNWLQRFGRVRMLLWVPLSTASKLMA 180

Query: 178 DSGDHSRHKCSLVREAFTDTKLVALSQEEDMKSFNSVCLDKSNPLVIPDGTDYGGKDF-- 235
           +     R K S++REAFTDT+L+A+S   ++K F+ + LD+SNP+V  + +   G     
Sbjct: 181 EPKSKLRSKASVIREAFTDTRLLAISNIAELKKFDKIVLDESNPIVFGEDSMLKGAGVSS 240

Query: 236 --PIALVEFTPKKHDIDLDNWEFVTKHLMVLYKTPLIDAIDCLGHGARDYFSANIDKDHI 293
              IAL+E  PK HD+DL+NW++VTKHLM+L +T LIDA++ LGHGA+DYF+  I+    
Sbjct: 241 ATSIALLEINPKNHDLDLENWDYVTKHLMILKQTKLIDALESLGHGAKDYFTEKIEDS-- 298

Query: 294 HLLKKCPQDFTNNDFVYLTNLFHLWPFKPDVYMDFLDIYQ 333
             L K P + TN+DF+YLT +F  WPFKPD+YMDF+DI Q
Sbjct: 299 TYLNKTPGEMTNDDFIYLTKIFANWPFKPDIYMDFVDILQ 338

>Kwal_26.9180
          Length = 341

 Score =  330 bits (845), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 162/341 (47%), Positives = 232/341 (68%), Gaps = 11/341 (3%)

Query: 1   MKVAVPTISQL-HIKSYYGFRYLLDPDWHQKVFEKLGL----SSNPNMKVLDLYPGPGIH 55
           M + V  + +L  I+ YYGFRYLL+   H+K+F KL L    S    +KVLDLYPGP  H
Sbjct: 1   MALKVQPLQELAKIQHYYGFRYLLNKAVHEKIFSKLKLKDTYSDVNKLKVLDLYPGPAQH 60

Query: 56  SAVLYNKVQPQQYTMMECRRDFLSNLR--NIYTDGPMELVKKDPYKWESYTELIDQEKLF 113
           S VL N ++P Q+ +M+ R DF+ ++R  ++ ++G ++L  +DPY W+SYT +I++EKLF
Sbjct: 61  SVVLNNYLKPSQHVLMDARPDFVKHIRALSLESNGNLQLYNRDPYDWQSYTNMIEKEKLF 120

Query: 114 VPKKADYNVVNKDFYIMANLTEKKHEGLLMQWMNCVGNRNWLFRFGRSPMLIWMPTPTAS 173
           VP K   + ++K+F +MANLT    EGL MQW+ C+GN+NWL RFGR  ML+W+   TA 
Sbjct: 121 VPTKQPQDAIHKEFLVMANLTGMIGEGLFMQWLACIGNKNWLQRFGRVKMLVWVQESTAL 180

Query: 174 KLLADSGDHSRHKCSLVREAFTDTKLVALSQEEDMKSFNSVCLDKSNPLVIPDGTDYGGK 233
           KLLA  G+H R KCS+V EAFTDTKLVA    +++  F++  L    P+V P    +   
Sbjct: 181 KLLARPGEHLRSKCSVVAEAFTDTKLVATMDSKNISKFSTSVLSTHEPIVFPSQDVWAPS 240

Query: 234 DFPIALVEFTPKKHDIDLDNWEFVTKHLMVLYKTPLIDAIDCLGHGARDYFSANI-DKDH 292
             PI+L+E  P  H IDLDN+++ TKHL++L  TPL +++D LGHG ++YF   I DK+ 
Sbjct: 241 GKPISLLEVNPLDHIIDLDNFDYATKHLLILKSTPLSESLDSLGHGGKEYFRRVIRDKN- 299

Query: 293 IHLLKKCPQDFTNNDFVYLTNLFHLWPFKPDVYMDFLDIYQ 333
             LL++CP+D T  +F+ +T+LF  WPFKPD+YMDF+D++Q
Sbjct: 300 --LLQRCPKDLTCREFIEITDLFDKWPFKPDIYMDFIDVFQ 338

>KLLA0B08283g complement(736483..737490)
           gi|3024184|sp|P87250|MTF1_KLULA Kluyveromyces lactis
           MITOCHONDRIAL REPLICATION PROTEIN MTF1 (MITOCHONDRIAL
           TRANSCRIPTION FACTOR MTTFB), start by similarity
          Length = 335

 Score =  232 bits (591), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 123/334 (36%), Positives = 205/334 (61%), Gaps = 13/334 (3%)

Query: 1   MKVAVPTISQLHIKSYYGFRYLLDPDWHQKVFEKLGLSS---NPNMKVLDLYPGPGIHSA 57
           +K  +P  +++H  + YG ++  +P    ++ +KL L S   + ++++LD+Y GP I S 
Sbjct: 7   LKSVLPLANKIH--TSYGSQFEKNPKVINQILDKLNLESYYKSESLQILDIYAGPLIQSV 64

Query: 58  VLYNKVQPQQYTMMECRRDFLSNLRNIYTDGP-MELVKKDPYKWESYTELIDQEKLFVPK 116
           +L  +++P+++ ++E R  F+   +    D P M    K+PYKWE++ E+ +++++  P 
Sbjct: 65  ILNERLKPKKHVLLEDRLKFVELYQATLKDHPSMVNYNKNPYKWETFLEMTNEDRVLTPS 124

Query: 117 KADYNVVNKDFYIMANLTEKKHEGLLMQWMNCVGNRNWLFRFGRSPMLIWMPTPTASKLL 176
               + ++ +F I ANLT KK E L +Q++ C+ N+NW+ RFG   ML+W+P  TA KL 
Sbjct: 125 MQKRDHIHNEFLIAANLTNKKGEQLYVQYLQCIANQNWMQRFGLVKMLVWIPQQTARKLF 184

Query: 177 ADSGDHSRHKCSLVREAFTDTKLVALSQEEDMKSFNSVCLDKSNPLVIPDGTDYGGKDFP 236
           A   +  R++ +L+ E  T+TKLVA S E  +K F   C++K +P++IP  +D    D  
Sbjct: 185 APFSNKDRNRLTLLSELATNTKLVATS-ENSVKKFLPDCIEKFDPVIIP--SDNKSPD-D 240

Query: 237 IALVEFTPKKHDIDLDNWEFVTKHLMVLYKTPLIDAIDCLGHGARDYFSANIDKDHIHLL 296
           ++LVE  P+ H IDLD+W+FVT+ LM+L   P+ + I+ LGHGARD+F + +D     LL
Sbjct: 241 LSLVEINPRDHSIDLDHWDFVTQKLMILKSKPVEEMIEILGHGARDWFISRLDP---VLL 297

Query: 297 KKCPQDFTNNDFVYLTNLFHLWPFKPDVYMDFLD 330
           KK P + T  +   +  +F LWPFKP + +DF D
Sbjct: 298 KKKPYELTYLEIDEIAKVFALWPFKPSLLVDFYD 331

>AFR564W [3756] [Homologous to ScYMR228W (MTF1) - SH]
           complement(1446758..1447762) [1005 bp, 334 aa]
          Length = 334

 Score =  226 bits (575), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 122/325 (37%), Positives = 195/325 (60%), Gaps = 17/325 (5%)

Query: 11  LHIKSYYGFRYLLDPDWHQKVFEKLGLSSNPNM---KVLDLYPGPGIHSAVLYNKVQPQQ 67
           L +K  YG   L  P   +  +++L L  + +M   +VL+LYPG G+ S + ++  +P+ 
Sbjct: 17  LAVKFSYGRTLLHSPTAIELAYKRLNLQEHYDMSKVQVLELYPGTGLPSYIFHDIYKPKL 76

Query: 68  YTMMECRRDFLSNL-RNIYTDGPMELVKKDPYKWESYTELIDQEKLFVPKKADYNVVNKD 126
             +ME +  +   + +++     ++L K+DPY WES+  LID++K+  P+    + ++  
Sbjct: 77  QVLMESKPAYAKVIEQHLTLLDNIKLHKEDPYMWESFVSLIDEKKIMQPEVQTRDHIHDS 136

Query: 127 FYIMANLTEKKHEGLLMQWMNCVGNRNWLFRFGRSPMLIWMPTPTASKLLADSGDHSRHK 186
           F +M NLT+K+ E L MQ++ C+ N+NW+ RFG   ML W+P  TA KLL+  G  SR +
Sbjct: 137 FIVMGNLTDKRGEQLYMQYLQCIANKNWMQRFGLVRMLFWVPQTTAIKLLSPCGFKSRSR 196

Query: 187 CSLVREAFTDTKLVALSQEEDMKSFNSVCLDKSNPLVIPDG-TDYGGKDFPIALVEFTPK 245
           CS++ EA TDT+L+A +  +++ SF    LDK +PL++P+  TDY       AL+E  P 
Sbjct: 197 CSVITEAVTDTRLIA-TTPDNLASFGPGVLDKHDPLILPENKTDY-------ALLEVLPL 248

Query: 246 KHDIDLDNWEFVTKHLMVLYKTPLIDAIDCLGHGARDYFSANIDKDHIHLLKKCPQDFTN 305
            H++ L+ W++  + L+V   TPL D ++ LGHGA D+    ID +   LLKK P   TN
Sbjct: 249 NHNMKLEYWDYCMQRLLVCKSTPLEDILEVLGHGASDFLKCRIDPE---LLKKKPMQLTN 305

Query: 306 NDFVYLTNLFHLWPFKPDVYMDFLD 330
            +F  + +L+ LWPFKP +Y DF D
Sbjct: 306 QEFTKIASLYALWPFKPSIY-DFYD 329

>Scas_27.1
          Length = 265

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 28/73 (38%)

Query: 36  GLSSNPNMKVLDLYPGPGIHSAVLYNKVQPQQYTMMECRRDFLSNLRNIYTDGPMELVKK 95
           GL      KV    PG  +HS +    +      ++      + N  NI  DG  E+V  
Sbjct: 75  GLRGCNYYKVTVQGPGADLHSGIFGGVIAEPMIDLVSVLNSLVDNKGNILIDGIREMVAP 134

Query: 96  DPYKWESYTELID 108
              K ES  E ID
Sbjct: 135 VTEKEESLYEAID 147

>KLLA0C08888g 776287..781614 similar to sp|O13423 Candida albicans
            Glucan synthase, start by similarity
          Length = 1775

 Score = 30.4 bits (67), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 2/70 (2%)

Query: 239  LVEFTPKKHDIDLDNWEFVTKHLMVLYKTP--LIDAIDCLGHGARDYFSANIDKDHIHLL 296
            L+EF  K  ++ + N +FV  H+++L + P  +I  +D L      +  A+ID   I   
Sbjct: 1631 LIEFIQKVLELSIFNLDFVLVHIILLLQVPILMIPNVDTLHSLMLFWRKADIDARPIIFK 1690

Query: 297  KKCPQDFTNN 306
            KK    F  N
Sbjct: 1691 KKGKSKFNAN 1700

>Sklu_2433.9 YFR044C, Contig c2433 13344-14852
          Length = 502

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 28/73 (38%)

Query: 36  GLSSNPNMKVLDLYPGPGIHSAVLYNKVQPQQYTMMECRRDFLSNLRNIYTDGPMELVKK 95
           GL      KV    PG  +HS +    +      ++      + N  NI  DG  E+V  
Sbjct: 235 GLRGCNYYKVTVQGPGADLHSGIFGGVIAEPMIDLVSVLNSLVDNKGNILIDGIREMVAP 294

Query: 96  DPYKWESYTELID 108
              K ES  E ID
Sbjct: 295 VTEKEESLYEAID 307

>Scas_674.2
          Length = 1004

 Score = 30.0 bits (66), Expect = 3.1,   Method: Composition-based stats.
 Identities = 29/101 (28%), Positives = 42/101 (41%), Gaps = 11/101 (10%)

Query: 14  KSYYGFRYLLDPDWHQKVFEKL-GLSSNPNMKVLDLYPGPGIHSAVLYNKVQ-PQQYTMM 71
           + Y   +  LD D+ Q   E L  +  N    +L         SA L+NK +      +M
Sbjct: 715 EEYNNLKQYLDNDFFQNNHEDLLNIHINATSDIL------AQSSAELFNKFKIMMDAHLM 768

Query: 72  ECRRDFLSNLRNIYTD---GPMELVKKDPYKWESYTELIDQ 109
           E ++  + N R    D     MEL K    KWE   ELI++
Sbjct: 769 ENKKLMIDNFRTATNDVITKEMELFKPKRNKWEESIELINR 809

>KLLA0D03927g 331864..332472 no similarity, hypothetical start
          Length = 202

 Score = 29.3 bits (64), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 69/166 (41%), Gaps = 16/166 (9%)

Query: 151 NRNWLFRFGRSPMLIWMPTPTASKLLADSGDHSRHKCSLVR-EAFTDTKLVALSQEEDMK 209
           N+ WL   GRSP    +   +  + L  +  H  +   + + E F  T L +  +   MK
Sbjct: 34  NKPWLK--GRSPKPCSLKLKSGMEFLTVNTSHPLNDEDVKKFEKFVGTVLSSGVRAFYMK 91

Query: 210 SFNSVCLDKSNPLVIPDGTDYGGKDF-PIALVEF-----TPKKHDIDLDNWEFVTKHLMV 263
                  D+    V  DG ++  K+F PI+   F       + ++I ++N   V +  + 
Sbjct: 92  GNGGKLPDERCMYVSSDGREFDIKNFLPISYPRFDGDMTVEQAYEILVENKYLVPRDYIP 151

Query: 264 LYKTPLIDAID---CLGHGARDYFSANIDKDHIHLLKKCPQDFTNN 306
           +    +ID      CL  G+ D F ANI+   +  ++K  + F   
Sbjct: 152 I----VIDGGGFPFCLRKGSEDVFFANIESGELIFIEKDLETFVTG 193

>Scas_648.5
          Length = 1408

 Score = 29.6 bits (65), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 37/89 (41%), Gaps = 7/89 (7%)

Query: 148  CVGNRNWLFRFGRSPMLIWMPTPTASKL------LADSGDHSRHKCSLVREAFTDTKLVA 201
            C+ N+NW  R   +  L  M      ++      +  S  +  H C L    F    +  
Sbjct: 932  CLSNKNWKIRDIAARSLSSMTVNAFEQMEKLCMGITLSNQNKLHGCLLGMYYFITENIEL 991

Query: 202  LSQEEDMKSFNSVCLDKSNPLVIPDGTDY 230
             SQ++  K F S+ LD+  P ++ D  D+
Sbjct: 992  QSQQDHCKHFLSILLDRL-PEIVADTKDF 1019

>CAGL0L02189g complement(256073..257743) similar to sp|Q02206
           Saccharomyces cerevisiae YKR008w RSC4 member of RSC
           complex which remodels the structure of chromatin, start
           by similarity
          Length = 556

 Score = 29.3 bits (64), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 3/41 (7%)

Query: 18  GFRYLLDPDWHQKVFEKLGLSSNPNMKVLDLYPGPGIHSAV 58
           G +   +PDW Q +F+   +S N NM  L L P   IH+ V
Sbjct: 430 GSKPSTNPDWFQYIFKGNQMSQNENMYSLSLQP---IHTQV 467

>AGL337C [3975] [Homologous to ScYMR313C - SH] (79693..81438) [1746
           bp, 581 aa]
          Length = 581

 Score = 29.3 bits (64), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 36/77 (46%), Gaps = 8/77 (10%)

Query: 82  RNIYTDGPMELVKKDPYK-WESYTELIDQ-------EKLFVPKKADYNVVNKDFYIMANL 133
           R +Y +   EL +   ++ W     ++D+        + FV K+ D+N V   + I+   
Sbjct: 49  RTMYHNAIAELDRCTTFEEWIEKARVVDEITGADLWRRNFVSKRYDFNSVLNQYGIITEA 108

Query: 134 TEKKHEGLLMQWMNCVG 150
            + +  GLLMQ  + VG
Sbjct: 109 LDDEDLGLLMQKFSTVG 125

>CAGL0M11374g complement(1117223..1120177) weakly similar to
           sp|P32591 Saccharomyces cerevisiae YJL176c SWI3
           transcription regulatory protein, hypothetical start
          Length = 984

 Score = 29.3 bits (64), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 40/92 (43%), Gaps = 15/92 (16%)

Query: 121 NVVNKDFYIMANLTEKKHEGLLMQWMNCVGNRNWLFRFGRSPMLIWMPTPTASKLLADSG 180
           N + K F +   + EK+ E LL+Q +    N        RS M I      A+K+L D+ 
Sbjct: 883 NQMEKSFDLEKRMLEKQQESLLLQRLQIAKN-------ARSVMEI------ATKILEDAD 929

Query: 181 DHSRHKCSL--VREAFTDTKLVALSQEEDMKS 210
           D    K  L  +R+   D    +L+   D KS
Sbjct: 930 DKEALKKDLEVIRDHVMDPPTPSLATPGDSKS 961

>Scas_691.7
          Length = 714

 Score = 28.9 bits (63), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 15/61 (24%), Positives = 33/61 (54%)

Query: 78  LSNLRNIYTDGPMELVKKDPYKWESYTELIDQEKLFVPKKADYNVVNKDFYIMANLTEKK 137
           L+ L +I+T+   ++V    Y+     +    +++++P KA +N++N D  I  N  ++ 
Sbjct: 284 LARLNSIWTELEGDVVILGGYRGSILRDAKTHKRIWIPIKAGFNMINYDLTIGPNDEDEA 343

Query: 138 H 138
           H
Sbjct: 344 H 344

>CAGL0K11088g complement(1078328..1081246) highly similar to
           sp|P41810 Saccharomyces cerevisiae YDR238c SEC26, start
           by similarity
          Length = 972

 Score = 28.5 bits (62), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 30/69 (43%)

Query: 160 RSPMLIWMPTPTASKLLADSGDHSRHKCSLVREAFTDTKLVALSQEEDMKSFNSVCLDKS 219
           R  + I     T    + DS  H R     +    T+ K    SQ+ED ++       ++
Sbjct: 457 RGALWILGEYSTTESEIQDSWKHIRQSIGEIPILQTELKNQRKSQDEDDEATEESATKQA 516

Query: 220 NPLVIPDGT 228
            P+++PDGT
Sbjct: 517 GPVILPDGT 525

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.139    0.444 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,821,108
Number of extensions: 604646
Number of successful extensions: 1294
Number of sequences better than 10.0: 20
Number of HSP's gapped: 1286
Number of HSP's successfully gapped: 20
Length of query: 333
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 231
Effective length of database: 13,065,073
Effective search space: 3018031863
Effective search space used: 3018031863
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 62 (28.5 bits)