Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M11264g54954018430.0
YMR227C (TAF7)5902358291e-103
Scas_594.66552358171e-101
KLLA0B08305g7352447771e-94
Kwal_26.91765512307292e-89
AFR563C5762316832e-82
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M11264g
         (540 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M11264g complement(1106912..1108561) similar to sp|Q05021 S...   714   0.0  
YMR227C (TAF7) [4183] chr13 complement(722612..724384) Component...   323   e-103
Scas_594.6                                                            319   e-101
KLLA0B08305g 737967..740174 some similarities with sp|Q05021 Sac...   303   1e-94
Kwal_26.9176                                                          285   2e-89
AFR563C [3755] [Homologous to ScYMR227C (TAF67) - SH] (1444641.....   267   2e-82

>CAGL0M11264g complement(1106912..1108561) similar to sp|Q05021
           Saccharomyces cerevisiae YMR227c TAF67, start by
           similarity
          Length = 549

 Score =  714 bits (1843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/540 (70%), Positives = 379/540 (70%)

Query: 1   MAVIKIKKPKKNEGANESEGPKLKKIRISAGNRXXXXXXXXXXXXXXXXXXXXXXXXXXX 60
           MAVIKIKKPKKNEGANESEGPKLKKIRISAGNR                           
Sbjct: 1   MAVIKIKKPKKNEGANESEGPKLKKIRISAGNRKEEKEPKKLKINLKKTDVKKSGSVVKL 60

Query: 61  XXXXXXXXXQSRTPRLRLKPIRIPGEGYDSEASDLEDDPLIESGIILRVLPDVQVDFIKN 120
                    QSRTPRLRLKPIRIPGEGYDSEASDLEDDPLIESGIILRVLPDVQVDFIKN
Sbjct: 61  KLGSKKEEKQSRTPRLRLKPIRIPGEGYDSEASDLEDDPLIESGIILRVLPDVQVDFIKN 120

Query: 121 SIESGDYTGISIKWKGERHAILKLNNVTYGAILVDLPTIIEVNKSVDRKNLFKTFDVTQM 180
           SIESGDYTGISIKWKGERHAILKLNNVTYGAILVDLPTIIEVNKSVDRKNLFKTFDVTQM
Sbjct: 121 SIESGDYTGISIKWKGERHAILKLNNVTYGAILVDLPTIIEVNKSVDRKNLFKTFDVTQM 180

Query: 181 LVCVKPITSEDELFTLEAPETEDLISKHYEEYLDEINDHKVKLFKNANHVNLHSETXXXX 240
           LVCVKPITSEDELFTLEAPETEDLISKHYEEYLDEINDHKVKLFKNANHVNLHSET    
Sbjct: 181 LVCVKPITSEDELFTLEAPETEDLISKHYEEYLDEINDHKVKLFKNANHVNLHSETEAKN 240

Query: 241 XXXXXXXXYHYKHGLTPPLYNVRNRRFRRQMHADEFEYAEKIVDMLLKADAQAEDVKFDL 300
                   YHYKHGLTPPLYNVRNRRFRRQMHADEFEYAEKIVDMLLKADAQAEDVKFDL
Sbjct: 241 LEKLALKKYHYKHGLTPPLYNVRNRRFRRQMHADEFEYAEKIVDMLLKADAQAEDVKFDL 300

Query: 301 IAPSDVPEKGSVSAAPSHVDLSVANKPEVLNXXXXXXXXXXXXXXXXAFQSDEDESESTK 360
           IAPSDVPEKGSVSAAPSHVDLSVANKPEVLN                AFQSDEDESESTK
Sbjct: 301 IAPSDVPEKGSVSAAPSHVDLSVANKPEVLNEDVTLQDDDEDLDLEEAFQSDEDESESTK 360

Query: 361 RSDALFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSVAKSGDDNEKRQHTE 420
           RSDALF                                      SVAKSGDDNEKRQHTE
Sbjct: 361 RSDALFGDQDEEGGDEVEQDNGEDEDDDDDDEDDDEEEEEEEVGSVAKSGDDNEKRQHTE 420

Query: 421 LLADELNELVSTLEHTKDKLEKATNPLLKSRFVDSIXXXXXXXXXXXXXXXXXXNQLSGG 480
           LLADELNELVSTLEHTKDKLEKATNPLLKSRFVDSI                  NQLSGG
Sbjct: 421 LLADELNELVSTLEHTKDKLEKATNPLLKSRFVDSIKKLEKEVELKKKQLKESENQLSGG 480

Query: 481 TGPVSSTGIVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDQNDLDMM 540
           TGPVSSTGIV                                         LDQNDLDMM
Sbjct: 481 TGPVSSTGIVDEDDEDQDDEDDDEDEEEEEEEGEGEGEEDKDDSKEDKEEELDQNDLDMM 540

>YMR227C (TAF7) [4183] chr13 complement(722612..724384) Component of
           the TAF(II) complex (TBP-associated factor), required
           for activated transcription by RNA polymerase II [1773
           bp, 590 aa]
          Length = 590

 Score =  323 bits (829), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 148/235 (62%), Positives = 188/235 (80%), Gaps = 1/235 (0%)

Query: 72  RTPRLRLKPIRIPGEGYDSEASDLEDDPLIESGIILRVLPDVQVDFIKNSIESGDYTGIS 131
           + P+LRLKPIRIPGE YDSEASD+EDDPLIESG+ILR+LPD+Q++F+KNS+ESGDY+GIS
Sbjct: 83  KAPKLRLKPIRIPGEAYDSEASDIEDDPLIESGVILRILPDIQLEFVKNSLESGDYSGIS 142

Query: 132 IKWKGERHAILKLNNVTYGAILVDLPTIIEVNKSVDRKNLFKTFDVTQMLVCVKPITSED 191
           IKWK ERHA++ +N+V YGAILVDLPT+IEVNKSVDRKNL KTFDV+QML+C++PI  E+
Sbjct: 143 IKWKNERHAVVTINDVMYGAILVDLPTVIEVNKSVDRKNLLKTFDVSQMLLCIRPIQEEE 202

Query: 192 ELFTLEAPETEDLISKHYEEYLDEINDHKVKLFKNANHVNLHSETXXXXXXXXXXXXYHY 251
           E++ LEAP+TEDL+ KH+E   DEI ++K    K  N   L S+             Y Y
Sbjct: 203 EVYALEAPDTEDLVVKHFEGIEDEIWENKETFLKGYNGAPL-SDMEAKHLKEIALKGYDY 261

Query: 252 KHGLTPPLYNVRNRRFRRQMHADEFEYAEKIVDMLLKADAQAEDVKFDLIAPSDV 306
           KHG++PPLYNVRNRRFRR+M  +E +Y EK+VDMLLK D QAE+V +DL+  S++
Sbjct: 262 KHGISPPLYNVRNRRFRRKMDPNEIDYVEKVVDMLLKQDKQAEEVSYDLVDKSEL 316

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 36/44 (81%), Positives = 39/44 (88%)

Query: 413 NEKRQHTELLADELNELVSTLEHTKDKLEKATNPLLKSRFVDSI 456
           +E RQHTELLADELNEL +TL HTK KL KATNPLLKSRF+DSI
Sbjct: 436 DENRQHTELLADELNELETTLAHTKHKLSKATNPLLKSRFIDSI 479

>Scas_594.6
          Length = 655

 Score =  319 bits (817), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 149/235 (63%), Positives = 187/235 (79%), Gaps = 1/235 (0%)

Query: 72  RTPRLRLKPIRIPGEGYDSEASDLEDDPLIESGIILRVLPDVQVDFIKNSIESGDYTGIS 131
           + PRLRLKPIRIPGEGYDSEASD+EDDPLIESGIILRVLPD+QV+F+KNSIESGDY+G++
Sbjct: 113 KAPRLRLKPIRIPGEGYDSEASDIEDDPLIESGIILRVLPDIQVEFVKNSIESGDYSGLT 172

Query: 132 IKWKGERHAILKLNNVTYGAILVDLPTIIEVNKSVDRKNLFKTFDVTQMLVCVKPITSED 191
           +KW G RHA++ +N   YGAILVDLPT+IEVNKSVDRKNL KTFDV+QML+C+K I  ED
Sbjct: 173 VKWLGHRHAVVNINGNMYGAILVDLPTVIEVNKSVDRKNLLKTFDVSQMLICIKTIQKED 232

Query: 192 ELFTLEAPETEDLISKHYEEYLDEINDHKVKLFKNANHVNLHSETXXXXXXXXXXXXYHY 251
           E+FTL+AP +EDL++KHY +  +EI  +K  L K  N  +L SE             Y Y
Sbjct: 233 EVFTLKAPNSEDLVTKHYSDIEEEILGNKKVLMKEQN-TDLLSELEKQYLDEIATKGYDY 291

Query: 252 KHGLTPPLYNVRNRRFRRQMHADEFEYAEKIVDMLLKADAQAEDVKFDLIAPSDV 306
           KHGL+PPLYNVRNRRFRR+M   EFEYAE++V+ LL+ D +AE+V ++L+  S++
Sbjct: 292 KHGLSPPLYNVRNRRFRRKMGPSEFEYAEEVVETLLRQDEKAENVTYELVDESEM 346

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 30/43 (69%), Positives = 38/43 (88%)

Query: 414 EKRQHTELLADELNELVSTLEHTKDKLEKATNPLLKSRFVDSI 456
           E RQH ELLADEL+EL +TL HT++KL+K TNPLL+SRF+D+I
Sbjct: 486 EDRQHVELLADELSELETTLTHTRNKLQKVTNPLLRSRFIDNI 528

>KLLA0B08305g 737967..740174 some similarities with sp|Q05021
           Saccharomyces cerevisiae YMR227c TAF67 TFIID subunit
           (TBP-associated factor), 67 kD singleton, hypothetical
           start
          Length = 735

 Score =  303 bits (777), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 137/244 (56%), Positives = 183/244 (75%), Gaps = 1/244 (0%)

Query: 72  RTPRLRLKPIRIPGEGYDSEASDLEDDPLIESGIILRVLPDVQVDFIKNSIESGDYTGIS 131
           +TP+ R+KP+R+PGEGYDSEASD+EDDPLIE GIILRVLPD+  +F+KNSIESGDY+ +S
Sbjct: 141 KTPKFRIKPVRVPGEGYDSEASDVEDDPLIEEGIILRVLPDLSAEFVKNSIESGDYSDVS 200

Query: 132 IKWKGERHAILKLNNVTYGAILVDLPTIIEVNKSVDRKNLFKTFDVTQMLVCVKPITSED 191
           IKWKGERHA++K+N V YGA+LV+LP+IIEVNKSVDRKNL KTFDV+QML+CV+ +  E+
Sbjct: 201 IKWKGERHAVVKVNGVQYGAVLVNLPSIIEVNKSVDRKNLLKTFDVSQMLICVRTVNKEE 260

Query: 192 ELFTLEAPETEDLISKHYEEYLDEINDHKVKLFKNANHVNLHSETXXXXXXXXXXXXYHY 251
           E+F+L+  +TEDL  KH+EEY  EI + + +  +  N   L ++             Y Y
Sbjct: 261 EVFSLQVSDTEDLTKKHFEEYQKEITEQRKQQLRGYNGGPL-TDAESKNIEQIINKRYDY 319

Query: 252 KHGLTPPLYNVRNRRFRRQMHADEFEYAEKIVDMLLKADAQAEDVKFDLIAPSDVPEKGS 311
           KHG+TPPLYN RNRRFR +M    F+Y E+ V+ LLK DA+AE+  ++L+    + ++ S
Sbjct: 320 KHGITPPLYNARNRRFRHRMGPTAFDYVERTVEKLLKLDAEAEEFGYELVNEDAIQQQRS 379

Query: 312 VSAA 315
            SAA
Sbjct: 380 TSAA 383

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 34/44 (77%)

Query: 413 NEKRQHTELLADELNELVSTLEHTKDKLEKATNPLLKSRFVDSI 456
           NE+ QH ELL DEL EL STLE  ++K  + TNPLLK+RF++SI
Sbjct: 536 NEEEQHRELLLDELRELESTLELNRNKASRTTNPLLKTRFLESI 579

>Kwal_26.9176
          Length = 551

 Score =  285 bits (729), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 137/230 (59%), Positives = 180/230 (78%), Gaps = 1/230 (0%)

Query: 72  RTPRLRLKPIRIPGEGYDSEASDLEDDPLIESGIILRVLPDVQVDFIKNSIESGDYTGIS 131
           + PR R+KP+R+PGEGYDSEASD+EDDPLIE G+ILRVLPDVQ +F+KN IESGD++G+S
Sbjct: 83  KAPRFRIKPVRVPGEGYDSEASDIEDDPLIEEGVILRVLPDVQTEFVKNCIESGDFSGLS 142

Query: 132 IKWKGERHAILKLNNVTYGAILVDLPTIIEVNKSVDRKNLFKTFDVTQMLVCVKPITSED 191
           +KWKGERHA++K+N   YGA+LV+LPT IEVNKS+DRKNL KTFDV+QML+CV+ I  E+
Sbjct: 143 LKWKGERHAVVKINGYQYGAVLVNLPTTIEVNKSIDRKNLLKTFDVSQMLLCVRTIDHEE 202

Query: 192 ELFTLEAPETEDLISKHYEEYLDEINDHKVKLFKNANHVNLHSETXXXXXXXXXXXXYHY 251
           E+F+L  P++EDL++KHY+EY +EI + K  L++  N   L ++             Y Y
Sbjct: 203 EVFSLVPPDSEDLVTKHYDEYKNEIIECKKTLYRGFNGGPL-TDAEANNIDNIVKKGYDY 261

Query: 252 KHGLTPPLYNVRNRRFRRQMHADEFEYAEKIVDMLLKADAQAEDVKFDLI 301
           KHGLTPPLYNVRNRRFRR++   E +Y EK V+ LL+ DA+AE V +DL+
Sbjct: 262 KHGLTPPLYNVRNRRFRRRLTTQEVDYVEKTVEHLLEQDAEAEGVSYDLV 311

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 32/44 (72%), Positives = 37/44 (84%)

Query: 413 NEKRQHTELLADELNELVSTLEHTKDKLEKATNPLLKSRFVDSI 456
           +E+RQH+ELL DEL EL STL   K KLEKATNPLLKSRF++SI
Sbjct: 415 DEERQHSELLQDELEELESTLHQNKQKLEKATNPLLKSRFIESI 458

>AFR563C [3755] [Homologous to ScYMR227C (TAF67) - SH]
           (1444641..1446371) [1731 bp, 576 aa]
          Length = 576

 Score =  267 bits (683), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 130/231 (56%), Positives = 174/231 (75%), Gaps = 1/231 (0%)

Query: 71  SRTPRLRLKPIRIPGEGYDSEASDLEDDPLIESGIILRVLPDVQVDFIKNSIESGDYTGI 130
           ++ PR+R+KP RIPGEGYDSEASD+EDDPL+E GIILRVLPD+Q +F+KNSIESGDY+ I
Sbjct: 94  TKAPRIRVKPPRIPGEGYDSEASDIEDDPLMEEGIILRVLPDLQAEFVKNSIESGDYSNI 153

Query: 131 SIKWKGERHAILKLNNVTYGAILVDLPTIIEVNKSVDRKNLFKTFDVTQMLVCVKPITSE 190
           SIKWKGERHA++ +N   YGA+LV+LPT+IEVNKSVDRKN+ K FDV+QML+CV  I+ E
Sbjct: 154 SIKWKGERHAVVSINGHQYGAVLVNLPTVIEVNKSVDRKNMLKAFDVSQMLLCVALISRE 213

Query: 191 DELFTLEAPETEDLISKHYEEYLDEINDHKVKLFKNANHVNLHSETXXXXXXXXXXXXYH 250
           +++F L+ P+TEDL+ KH+E Y  EI D +  + +     +L ++             Y 
Sbjct: 214 EDVFDLQPPDTEDLVKKHFENYEKEICDARKIMIQGFQGGSL-TDAESKHMDAILEKGYD 272

Query: 251 YKHGLTPPLYNVRNRRFRRQMHADEFEYAEKIVDMLLKADAQAEDVKFDLI 301
           YKHG+T PLYNVRNRRFRR+M   E +Y ++ V+ LLK D +AE+  ++L+
Sbjct: 273 YKHGITAPLYNVRNRRFRRRMTGSEIDYVDRTVEFLLKQDGEAEEFTYELV 323

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 32/40 (80%)

Query: 417 QHTELLADELNELVSTLEHTKDKLEKATNPLLKSRFVDSI 456
           QH ELL DEL EL S L+  +DKL KATNPLLKSRFVDSI
Sbjct: 439 QHNELLRDELGELESILQQNRDKLAKATNPLLKSRFVDSI 478

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.132    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,958,073
Number of extensions: 476134
Number of successful extensions: 1407
Number of sequences better than 10.0: 9
Number of HSP's gapped: 1411
Number of HSP's successfully gapped: 14
Length of query: 540
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 434
Effective length of database: 12,926,601
Effective search space: 5610144834
Effective search space used: 5610144834
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 64 (29.3 bits)