Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M11110g27025011451e-160
YDR087C (RRP1)2782547063e-93
Kwal_56.234052802626942e-91
Scas_636.102882566933e-91
AGR158C2672516392e-83
KLLA0C11979g2612515505e-70
Sklu_1568.32202004781e-59
YJR111C28347652.2
CAGL0C04873g29145643.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M11110g
         (266 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M11110g complement(1095317..1096129) similar to sp|P35178 S...   445   e-160
YDR087C (RRP1) [939] chr4 complement(617464..618300) Protein inv...   276   3e-93
Kwal_56.23405                                                         271   2e-91
Scas_636.10                                                           271   3e-91
AGR158C [4469] [Homologous to ScYDR087C (RRP1) - SH] (1043874..1...   250   2e-83
KLLA0C11979g complement(1027919..1028704) similar to sp|P35178 S...   216   5e-70
Sklu_1568.3 YDR087C, Contig c1568 3651-4313 reverse complement        188   1e-59
YJR111C (YJR111C) [3003] chr10 complement(635770..636621) Protei...    30   2.2  
CAGL0C04873g 453303..454178 similar to sp|P47148 Saccharomyces c...    29   3.4  

>CAGL0M11110g complement(1095317..1096129) similar to sp|P35178
           Saccharomyces cerevisiae YDR087c RRP1 involved in
           processing rRNA precursor species to mature rRNAs, start
           by similarity
          Length = 270

 Score =  445 bits (1145), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 223/250 (89%), Positives = 223/250 (89%)

Query: 1   METSKFVKQLASNNRVVREKALETLEQFIVSAQFKKSKQVQFDKLWKGLYYAMWFCDRPR 60
           METSKFVKQLASNNRVVREKALETLEQFIVSAQFKKSKQVQFDKLWKGLYYAMWFCDRPR
Sbjct: 1   METSKFVKQLASNNRVVREKALETLEQFIVSAQFKKSKQVQFDKLWKGLYYAMWFCDRPR 60

Query: 61  PQQRLASTLGALHVRFFDERDSGAEELTVNDKAFVRFSKAFWRIMCLEWLGIDRFRLDKY 120
           PQQRLASTLGALHVRFFDERDSGAEELTVNDKAFVRFSKAFWRIMCLEWLGIDRFRLDKY
Sbjct: 61  PQQRLASTLGALHVRFFDERDSGAEELTVNDKAFVRFSKAFWRIMCLEWLGIDRFRLDKY 120

Query: 121 LLLIRRALFNQFKYLQMRQWHAPLVAKYLERVLGAIPLSGDPKVYNGIPIHVMDIMXXXX 180
           LLLIRRALFNQFKYLQMRQWHAPLVAKYLERVLGAIPLSGDPKVYNGIPIHVMDIM    
Sbjct: 121 LLLIRRALFNQFKYLQMRQWHAPLVAKYLERVLGAIPLSGDPKVYNGIPIHVMDIMLDEW 180

Query: 181 XXXXXXXXXXXXXXXXXXXXXXXFVSGSPLDQVLDILRNLLKNYDNSKILRDKIKKEVLT 240
                                  FVSGSPLDQVLDILRNLLKNYDNSKILRDKIKKEVLT
Sbjct: 181 ERLALEDEEEELEEDKKLEIMKEFVSGSPLDQVLDILRNLLKNYDNSKILRDKIKKEVLT 240

Query: 241 DKRLAQWGIV 250
           DKRLAQWGIV
Sbjct: 241 DKRLAQWGIV 250

>YDR087C (RRP1) [939] chr4 complement(617464..618300) Protein
           involved in maturation of 25S rRNA [837 bp, 278 aa]
          Length = 278

 Score =  276 bits (706), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 132/254 (51%), Positives = 177/254 (69%), Gaps = 4/254 (1%)

Query: 1   METSKFVKQLASNNRVVREKALETLEQFIVSAQFKKSKQVQFDKLWKGLYYAMWFCDRPR 60
           METS FVKQL+SNNR  R  ALE L++++ + QFK++KQ++F+KLWKGLYYAMWF DRPR
Sbjct: 1   METSNFVKQLSSNNRKTRVNALEALKKYLTAKQFKENKQIEFNKLWKGLYYAMWFSDRPR 60

Query: 61  PQQRLASTLGALHVRFFDERD-SGAEELTVNDKAFVRFSKAFWRIMCLEWLGIDRFRLDK 119
           PQQRLA+ LG LH  +FD +D S A+ELT NDKAF++FS+ FW++MC EW  IDR+RLDK
Sbjct: 61  PQQRLANELGELHGLYFDPKDNSTADELTTNDKAFIKFSRGFWKVMCFEWFNIDRYRLDK 120

Query: 120 YLLLIRRALFNQFKYLQMRQWHAPLVAKYLERVLGAIPLSGDPKVYNGIPIHVMDIMXXX 179
           YLLLIRR LF+Q KYLQ R W   LV +Y+++VL  +PLSG PKVY GIPIH++DI+   
Sbjct: 121 YLLLIRRVLFSQLKYLQSRNWDKKLVDEYIKKVLRWLPLSGSPKVYTGIPIHIVDILLDE 180

Query: 180 XXXXXXXXXXXXXXXXXXXXXXXXFVSG---SPLDQVLDILRNLLKNYDNSKILRDKIKK 236
                                          +PL  V+ I ++++ +Y+NSK+LR+KIK+
Sbjct: 181 WERLLKDGDEDDEDEENKEEEMRKIAESAKKTPLADVIAIFQDIVADYNNSKVLREKIKE 240

Query: 237 EVLTDKRLAQWGIV 250
           ++ +D RL  W I+
Sbjct: 241 DLFSDTRLVSWDIL 254

>Kwal_56.23405
          Length = 280

 Score =  271 bits (694), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 131/262 (50%), Positives = 178/262 (67%), Gaps = 12/262 (4%)

Query: 1   METSKFVKQLASNNRVVREKALETLEQFIVSAQFKKSKQVQFDKLWKGLYYAMWFCDRPR 60
           ME+S FVKQLASN R VRE+AL++L++++ + QFK++KQ  FDKLWKGLYYAMWF DRPR
Sbjct: 1   MESSAFVKQLASNTRTVREEALDSLKKYLTTKQFKENKQASFDKLWKGLYYAMWFSDRPR 60

Query: 61  PQQRLASTLGALHVRFFDERDSGAE--ELTVNDKAFVRFSKAFWRIMCLEWLGIDRFRLD 118
           PQQRLA++LG LHV +FD+ D+     ELT+ND+AF++FSKAFWR++CLEW GID  RLD
Sbjct: 61  PQQRLANSLGELHVLYFDKADNQKSNGELTLNDRAFLKFSKAFWRVICLEWYGIDHHRLD 120

Query: 119 KYLLLIRRALFNQFKYLQMRQWHAPLVAKYLERVLGAIPLSGDPKVYNGIPIHVMDIMXX 178
           KYLLL+RR L +Q +YLQ+R+W   +V+ Y+  VL  +PLSGD KVYNGIP H++DI   
Sbjct: 121 KYLLLVRRVLAHQLRYLQLREWDEEVVSNYIRAVLRKLPLSGDKKVYNGIPFHIIDIFVD 180

Query: 179 X----------XXXXXXXXXXXXXXXXXXXXXXXXFVSGSPLDQVLDILRNLLKNYDNSK 228
                                               ++ +PL Q ++I  +L  N +N K
Sbjct: 181 EWEKLILHNGEDEDEEDDEKTNQEDEEAKLQEECARIAETPLAQFVEIFEDLASNINNIK 240

Query: 229 ILRDKIKKEVLTDKRLAQWGIV 250
            LRDKIK+++  D+RL +WG++
Sbjct: 241 SLRDKIKEDIFKDERLKKWGVL 262

>Scas_636.10
          Length = 288

 Score =  271 bits (693), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 136/256 (53%), Positives = 177/256 (69%), Gaps = 6/256 (2%)

Query: 1   METSKFVKQLASNNRVVREKALETLEQFIVSAQFKKSKQVQFDKLWKGLYYAMWFCDRPR 60
           M+TS FVKQL+SNNRVVREK+LE LE+F+VS +    KQ QF+KLWKGLY+AMWF DRPR
Sbjct: 1   MDTSTFVKQLSSNNRVVREKSLEALEKFLVSKKCLSFKQSQFNKLWKGLYFAMWFSDRPR 60

Query: 61  PQQRLASTLGALHVRFFDERDSGAEE----LTVNDKAFVRFSKAFWRIMCLEWLGIDRFR 116
           PQQRLA+ LG L+  +F+E+D+  +E    L+ NDKAF++FSKAFW+I+CLEW  IDRFR
Sbjct: 61  PQQRLANKLGQLYGLYFNEKDNENQENETRLSDNDKAFIKFSKAFWKILCLEWYSIDRFR 120

Query: 117 LDKYLLLIRRALFNQFKYLQMRQWHAPLVAKYLERVLGAIPLSGDPKVYNGIPIHVMDIM 176
           +DKYLLL RR  FNQ KYLQ R W+A LV +Y + VL  +PLSGD KVY+GIP H++DI+
Sbjct: 121 MDKYLLLTRRVFFNQLKYLQSRNWNAKLVEQYCQGVLVDLPLSGDAKVYSGIPFHIIDIL 180

Query: 177 XXXXXXXXXXXXXXXXXXXXXXXXXXXFVS--GSPLDQVLDILRNLLKNYDNSKILRDKI 234
                                       ++   +PL+  + I   L+ N +NSKILR KI
Sbjct: 181 LDEWERLLTDKDDEHDDEEKETDEVDIVIAVKETPLNNFIKIFYGLVSNVNNSKILRTKI 240

Query: 235 KKEVLTDKRLAQWGIV 250
           K+++L D RL +WGI+
Sbjct: 241 KEDLLADPRLIEWGII 256

>AGR158C [4469] [Homologous to ScYDR087C (RRP1) - SH]
           (1043874..1044677) [804 bp, 267 aa]
          Length = 267

 Score =  250 bits (639), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 122/251 (48%), Positives = 167/251 (66%), Gaps = 7/251 (2%)

Query: 1   METSKFVKQLASNNRVVREKALETLEQFIVSAQFKKSKQVQFDKLWKGLYYAMWFCDRPR 60
           ++TS FV+QLASN+R VRE+ALE+L  ++ S Q +K+ Q+QFD+LWKGLY+AMWF DRPR
Sbjct: 4   VQTSPFVRQLASNSRSVREQALESLRSYLASQQLRKAPQLQFDQLWKGLYFAMWFSDRPR 63

Query: 61  PQQRLASTLGALHVRFFDERDSGAEELTVNDKAFVRFSKAFWRIMCLEWLGIDRFRLDKY 120
           PQQRLA+ LG L + F D       +  + D+AFVRFSKAFW++MCLEW  ID  RLDKY
Sbjct: 64  PQQRLAAQLGELSLLFLDG------DTALGDRAFVRFSKAFWKVMCLEWYNIDHHRLDKY 117

Query: 121 LLLIRRALFNQFKYLQMRQWHAPLVAKYLERVLGAIPLSGDPKVYNGIPIHVMDIMXXX- 179
           LLL+RR L+NQ ++L+ R W A LV +Y+ +VL  +PLSG PKVYNGIP H++DI     
Sbjct: 118 LLLVRRVLYNQLRFLRERGWDAALVERYVAKVLQGLPLSGSPKVYNGIPFHIIDIFVDEW 177

Query: 180 XXXXXXXXXXXXXXXXXXXXXXXXFVSGSPLDQVLDILRNLLKNYDNSKILRDKIKKEVL 239
                                    ++ +PL + + + + L  N  N KILR+KIK+++L
Sbjct: 178 ERLVLRDGRDAEDADMPELPEQRDLIAATPLPRFVAVFQGLAANIANIKILREKIKQDLL 237

Query: 240 TDKRLAQWGIV 250
            D+RL  WG++
Sbjct: 238 ADQRLYDWGVL 248

>KLLA0C11979g complement(1027919..1028704) similar to sp|P35178
           Saccharomyces cerevisiae YDR087c RRP1 involved in
           processing rRNA precursor species to mature rRNAs
           singleton, start by similarity
          Length = 261

 Score =  216 bits (550), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 112/251 (44%), Positives = 153/251 (60%), Gaps = 11/251 (4%)

Query: 1   METSKFVKQLASNNRVVREKALETLEQFIVSAQFKKSKQVQFDKLWKGLYYAMWFCDRPR 60
           ME +  VKQLA + +  RE+A E+L +++ +  F+ +KQ QFDKLWKGLYY+MW CD+P 
Sbjct: 1   MENT-LVKQLAGHRKETREQAFESLRKYLTTRNFQNAKQSQFDKLWKGLYYSMWHCDKPI 59

Query: 61  PQQRLASTLGALHVRFFDERDSGAEELTVNDKAFVRFSKAFWRIMCLEWLGIDRFRLDKY 120
           PQQ LA +LG LH+ +   +         N +AF+RFSKAFW+++C+EW  ID  RLDK+
Sbjct: 60  PQQSLAYSLGELHLLYLKGK---------NQQAFIRFSKAFWKVICIEWYRIDHHRLDKF 110

Query: 121 LLLIRRALFNQFKYLQMRQWHAPLVAKYLERVLGAIPLSGDPKVYNGIPIHVMDIMXXX- 179
           LLLIRR L  Q KYL   +W   LV  Y+ +VL  IPLSGD KVYNGIP H++DI+    
Sbjct: 111 LLLIRRCLHFQIKYLHECEWEQALVDDYINKVLKKIPLSGDRKVYNGIPFHIIDILLDEW 170

Query: 180 XXXXXXXXXXXXXXXXXXXXXXXXFVSGSPLDQVLDILRNLLKNYDNSKILRDKIKKEVL 239
                                    VS +PL   + I + L  + +N KILRDKIK+++L
Sbjct: 171 VKVCYGEEEDEEDNEDDKEEEIKEAVSKTPLSDFISIFQELSSDTNNIKILRDKIKEDLL 230

Query: 240 TDKRLAQWGIV 250
            D+RL  W ++
Sbjct: 231 KDQRLRAWDVL 241

>Sklu_1568.3 YDR087C, Contig c1568 3651-4313 reverse complement
          Length = 220

 Score =  188 bits (478), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 128/200 (64%), Gaps = 3/200 (1%)

Query: 53  MWFCDRPRPQQRLASTLGALHVRFFDERDSGAEELTVNDKAFVRFSKAFWRIMCLEWLGI 112
           MWF DRPRPQ RL + LG LH+ FF   ++  +E+T+ DKAF++F+  FW+++CLEW  I
Sbjct: 1   MWFSDRPRPQHRLGNELGELHLLFFAAVEN-KQEITLVDKAFIKFTNGFWKVICLEWYSI 59

Query: 113 DRFRLDKYLLLIRRALFNQFKYLQMRQWHAPLVAKYLERVLGAIPLSGDPKVYNGIPIHV 172
           D  RLDKY+LL+RR LFNQ KYL++R W+  LV KY++ VL  +PLSGD KVYNGIP H+
Sbjct: 60  DHHRLDKYILLVRRVLFNQLKYLKLRNWNEELVLKYIDSVLKKLPLSGDKKVYNGIPFHI 119

Query: 173 MDIMXX--XXXXXXXXXXXXXXXXXXXXXXXXXFVSGSPLDQVLDILRNLLKNYDNSKIL 230
           +DI                               ++ +PL   ++I ++L  N +N K+L
Sbjct: 120 IDIFVDEWEKLVIRDGEDEGEDGEEKDSEECKQLIAATPLSLFVEIFQDLSSNIENIKVL 179

Query: 231 RDKIKKEVLTDKRLAQWGIV 250
           R+KIK+++L D+RL  WGI+
Sbjct: 180 REKIKEDILGDQRLHLWGIL 199

>YJR111C (YJR111C) [3003] chr10 complement(635770..636621) Protein
           of unknown function, has moderate similarity to
           uncharacterized C. albicans Orf6.7664p [852 bp, 283 aa]
          Length = 283

 Score = 29.6 bits (65), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 122 LLIRRALFNQFKYLQMRQWHAPLVAKYLERVLGAIPLSGDPKVYNGI 168
           L +R+ L N+  Y Q   +   L AK+ E +L   PL+G P+  NG+
Sbjct: 75  LPMRKTLINE-NYQQPTFFQKQLTAKFREVILKTGPLAGLPRAINGL 120

>CAGL0C04873g 453303..454178 similar to sp|P47148 Saccharomyces
           cerevisiae YJR111c, start by similarity
          Length = 291

 Score = 29.3 bits (64), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 124 IRRALFNQFKYLQMRQWHAPLVAKYLERVLGAIPLSGDPKVYNGI 168
           +R ++ N+  + Q    H+ +  K+ E +L + PL+G PK  NG+
Sbjct: 80  LRESIINE-GFQQPSILHSTITRKFRESILKSGPLAGLPKAINGL 123

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.326    0.140    0.428 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,207,507
Number of extensions: 269317
Number of successful extensions: 1000
Number of sequences better than 10.0: 10
Number of HSP's gapped: 991
Number of HSP's successfully gapped: 13
Length of query: 266
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 166
Effective length of database: 13,134,309
Effective search space: 2180295294
Effective search space used: 2180295294
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 60 (27.7 bits)