Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M09086g1446142469460.0
YJR092W (BUD4)144884410891e-125
Kwal_33.1438013157888454e-93
KLLA0E05962g12177698311e-91
AGL306C12597997183e-77
Scas_672.2710724396662e-71
Scas_674.2810331893311e-30
Sklu_2036.15951271681e-11
AGL293C98470780.63
KLLA0F23507g48748732.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M09086g
         (1424 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M09086g complement(904879..909219) similar to sp|P47136 Sac...  2680   0.0  
YJR092W (BUD4) [2983] chr10 (598649..602995) Protein required fo...   424   e-125
Kwal_33.14380                                                         330   4e-93
KLLA0E05962g complement(536856..540509) weakly similar to sp|P47...   324   1e-91
AGL306C [4006] [Homologous to ScYJR092W (BUD4) - SH] (124072..12...   281   3e-77
Scas_672.27                                                           261   2e-71
Scas_674.28                                                           132   1e-30
Sklu_2036.1 YJR092W, Contig c2036 2091-3874 reverse complement         69   1e-11
AGL293C [4019] [Homologous to ScYER114C (BOI2) - SH; ScYBL085W (...    35   0.63 
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    33   2.3  

>CAGL0M09086g complement(904879..909219) similar to sp|P47136
            Saccharomyces cerevisiae YJR092w budding protein, start
            by similarity
          Length = 1446

 Score = 2680 bits (6946), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1333/1424 (93%), Positives = 1333/1424 (93%)

Query: 1    MEAETTVDSLLKEIDMEMEMQSGNDVAQSNGYLLPLQEIGDETMDMLVQYXXXXXXXXXX 60
            MEAETTVDSLLKEIDMEMEMQSGNDVAQSNGYLLPLQEIGDETMDMLVQY          
Sbjct: 1    MEAETTVDSLLKEIDMEMEMQSGNDVAQSNGYLLPLQEIGDETMDMLVQYNTENNANSNV 60

Query: 61   XXXXXXXXXXXXKVDDPQDLLPMENNYDDDEEQGDESDTTNLLSGNKHLTEEESEQVLVD 120
                        KVDDPQDLLPMENNYDDDEEQGDESDTTNLLSGNKHLTEEESEQVLVD
Sbjct: 61   NANANANANQWNKVDDPQDLLPMENNYDDDEEQGDESDTTNLLSGNKHLTEEESEQVLVD 120

Query: 121  SKNLVXXXXXXXXXXXXXXXQVVEDEVSDSQLSNDMDDTRTLNFSVKGTEPLLADELQDK 180
            SKNLV               QVVEDEVSDSQLSNDMDDTRTLNFSVKGTEPLLADELQDK
Sbjct: 121  SKNLVLPPSSSKSNLINNLKQVVEDEVSDSQLSNDMDDTRTLNFSVKGTEPLLADELQDK 180

Query: 181  EPDMIEVSTIYDGPDMISMADDSDTEDIDLLSKAKKPVSPSKIPITNAQTINYFKDAPVE 240
            EPDMIEVSTIYDGPDMISMADDSDTEDIDLLSKAKKPVSPSKIPITNAQTINYFKDAPVE
Sbjct: 181  EPDMIEVSTIYDGPDMISMADDSDTEDIDLLSKAKKPVSPSKIPITNAQTINYFKDAPVE 240

Query: 241  DAKLQTVPDDIPLETKQTTVSNDILSNVETLLPPTLERPSFVISNLKEASQSVENLGFPD 300
            DAKLQTVPDDIPLETKQTTVSNDILSNVETLLPPTLERPSFVISNLKEASQSVENLGFPD
Sbjct: 241  DAKLQTVPDDIPLETKQTTVSNDILSNVETLLPPTLERPSFVISNLKEASQSVENLGFPD 300

Query: 301  YEEDSQSEQETSVLHHTPTDFHAHEFEVFATELPDINVTPSIKPIDIDNNCEHENRLVSE 360
            YEEDSQSEQETSVLHHTPTDFHAHEFEVFATELPDINVTPSIKPIDIDNNCEHENRLVSE
Sbjct: 301  YEEDSQSEQETSVLHHTPTDFHAHEFEVFATELPDINVTPSIKPIDIDNNCEHENRLVSE 360

Query: 361  EESKGVISSVPENENLPAVKSNPSSNSISDMLEIRQENKLDETLNMIDHQLSSNKSIDSV 420
            EESKGVISSVPENENLPAVKSNPSSNSISDMLEIRQENKLDETLNMIDHQLSSNKSIDSV
Sbjct: 361  EESKGVISSVPENENLPAVKSNPSSNSISDMLEIRQENKLDETLNMIDHQLSSNKSIDSV 420

Query: 421  KTVSDNNISKSANDGSVEDVADSGKETSDIARNIEESHNSLINLTSGNNFDQSMHNDLIE 480
            KTVSDNNISKSANDGSVEDVADSGKETSDIARNIEESHNSLINLTSGNNFDQSMHNDLIE
Sbjct: 421  KTVSDNNISKSANDGSVEDVADSGKETSDIARNIEESHNSLINLTSGNNFDQSMHNDLIE 480

Query: 481  ESNTRVNVTESDITASEDSFNGSHDQNSSLNNLTKNDNGIQQNLEDNHTGIQPEMVVPEE 540
            ESNTRVNVTESDITASEDSFNGSHDQNSSLNNLTKNDNGIQQNLEDNHTGIQPEMVVPEE
Sbjct: 481  ESNTRVNVTESDITASEDSFNGSHDQNSSLNNLTKNDNGIQQNLEDNHTGIQPEMVVPEE 540

Query: 541  VTTTLPEVNILPASENMLENTSESEISVQFLQNRDNEDKVSSDPQLEENIRSTETVMNTQ 600
            VTTTLPEVNILPASENMLENTSESEISVQFLQNRDNEDKVSSDPQLEENIRSTETVMNTQ
Sbjct: 541  VTTTLPEVNILPASENMLENTSESEISVQFLQNRDNEDKVSSDPQLEENIRSTETVMNTQ 600

Query: 601  ETFEPKPAKKNQYTDREIEVLNSQKDISEATDXXXXXXXXXXXXXXFTXXXXXXXXXXXX 660
            ETFEPKPAKKNQYTDREIEVLNSQKDISEATD              FT            
Sbjct: 601  ETFEPKPAKKNQYTDREIEVLNSQKDISEATDNSAVNSRISSSASNFTPVLPPLPKLEKL 660

Query: 661  SIDDPFDDEFETSNESMQMKNSVKPTDYLSIWHLQEQTTKAVSPALXXXXXXXXXXXXTK 720
            SIDDPFDDEFETSNESMQMKNSVKPTDYLSIWHLQEQTTKAVSPAL            TK
Sbjct: 661  SIDDPFDDEFETSNESMQMKNSVKPTDYLSIWHLQEQTTKAVSPALSSNSQFSYNSNSTK 720

Query: 721  SSVASPVPATAFKFKPKIVSRSKYYYPDNNIQQEQSMDFIYTKLPSILDPMRRNTINSKK 780
            SSVASPVPATAFKFKPKIVSRSKYYYPDNNIQQEQSMDFIYTKLPSILDPMRRNTINSKK
Sbjct: 721  SSVASPVPATAFKFKPKIVSRSKYYYPDNNIQQEQSMDFIYTKLPSILDPMRRNTINSKK 780

Query: 781  IRQTVIDKRKSHPSFSVDEGNTITEVNIEPEVKVQPISIENDSSSLKANNQDDNESCSSG 840
            IRQTVIDKRKSHPSFSVDEGNTITEVNIEPEVKVQPISIENDSSSLKANNQDDNESCSSG
Sbjct: 781  IRQTVIDKRKSHPSFSVDEGNTITEVNIEPEVKVQPISIENDSSSLKANNQDDNESCSSG 840

Query: 841  SQAFVTPSATMDNFDSQFNELGTSFENDLENVLNYFDKDINTNTSSDLIEETTTKNQALP 900
            SQAFVTPSATMDNFDSQFNELGTSFENDLENVLNYFDKDINTNTSSDLIEETTTKNQALP
Sbjct: 841  SQAFVTPSATMDNFDSQFNELGTSFENDLENVLNYFDKDINTNTSSDLIEETTTKNQALP 900

Query: 901  TSKVWSESVDYSLPTGEEPNVDHNIMKKLLNTENSELNECRSDQEHHIIDNAGLGIWRST 960
            TSKVWSESVDYSLPTGEEPNVDHNIMKKLLNTENSELNECRSDQEHHIIDNAGLGIWRST
Sbjct: 901  TSKVWSESVDYSLPTGEEPNVDHNIMKKLLNTENSELNECRSDQEHHIIDNAGLGIWRST 960

Query: 961  ANDIATGNVDMFALNGRDISISKSEMTNDIDMGIFSDKKSLVHTPELSPVKSTHVGSPFK 1020
            ANDIATGNVDMFALNGRDISISKSEMTNDIDMGIFSDKKSLVHTPELSPVKSTHVGSPFK
Sbjct: 961  ANDIATGNVDMFALNGRDISISKSEMTNDIDMGIFSDKKSLVHTPELSPVKSTHVGSPFK 1020

Query: 1021 VISPKKNTQKDLKDGTTAEKRVSSESEAAQISIMSAVGEITNKDTAVVDDASNKDNIDAG 1080
            VISPKKNTQKDLKDGTTAEKRVSSESEAAQISIMSAVGEITNKDTAVVDDASNKDNIDAG
Sbjct: 1021 VISPKKNTQKDLKDGTTAEKRVSSESEAAQISIMSAVGEITNKDTAVVDDASNKDNIDAG 1080

Query: 1081 QVGNEGEPIVDKGLLYLHLQGTTKLSLAGINAHHPKYSIEFDNGKNVVRTDWTELDSRGT 1140
            QVGNEGEPIVDKGLLYLHLQGTTKLSLAGINAHHPKYSIEFDNGKNVVRTDWTELDSRGT
Sbjct: 1081 QVGNEGEPIVDKGLLYLHLQGTTKLSLAGINAHHPKYSIEFDNGKNVVRTDWTELDSRGT 1140

Query: 1141 ISLNKEFEIPIDQSINKLIITLMIKYTRLTNELVEVTKRIPIGKKFPFGKMKYRTETQFV 1200
            ISLNKEFEIPIDQSINKLIITLMIKYTRLTNELVEVTKRIPIGKKFPFGKMKYRTETQFV
Sbjct: 1141 ISLNKEFEIPIDQSINKLIITLMIKYTRLTNELVEVTKRIPIGKKFPFGKMKYRTETQFV 1200

Query: 1201 ERSTVKDEWDYLFARDGSFGRCEILLDESLFEKIRFKEQDLSFDLLNKWSRLQNNSSSKV 1260
            ERSTVKDEWDYLFARDGSFGRCEILLDESLFEKIRFKEQDLSFDLLNKWSRLQNNSSSKV
Sbjct: 1201 ERSTVKDEWDYLFARDGSFGRCEILLDESLFEKIRFKEQDLSFDLLNKWSRLQNNSSSKV 1260

Query: 1261 TQEALYDLPRRPAYKVGSLKVKGCFLERVSNDEKFPVSLKKAKSIVEKYRSQQDITKEGY 1320
            TQEALYDLPRRPAYKVGSLKVKGCFLERVSNDEKFPVSLKKAKSIVEKYRSQQDITKEGY
Sbjct: 1261 TQEALYDLPRRPAYKVGSLKVKGCFLERVSNDEKFPVSLKKAKSIVEKYRSQQDITKEGY 1320

Query: 1321 LLQEGGDLSSQMKNRFFKLNGVELVGYHEVSMKPKIRINMLXXXXXXXXXXXXXXXXNVR 1380
            LLQEGGDLSSQMKNRFFKLNGVELVGYHEVSMKPKIRINML                NVR
Sbjct: 1321 LLQEGGDLSSQMKNRFFKLNGVELVGYHEVSMKPKIRINMLKVVKVIGKDDVVTGKDNVR 1380

Query: 1381 NFTTWVLMNDCFQLVFDDGEVITFSDESSLADEQSWYMKLKEVV 1424
            NFTTWVLMNDCFQLVFDDGEVITFSDESSLADEQSWYMKLKEVV
Sbjct: 1381 NFTTWVLMNDCFQLVFDDGEVITFSDESSLADEQSWYMKLKEVV 1424

>YJR092W (BUD4) [2983] chr10 (598649..602995) Protein required for
            axial budding but not for bipolar budding [4347 bp, 1448
            aa]
          Length = 1448

 Score =  424 bits (1089), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 294/844 (34%), Positives = 438/844 (51%), Gaps = 114/844 (13%)

Query: 662  IDDPFDDEFETSNESMQMKNSVKPTDYLSIWHLQEQTTKAVSP-ALXXXXXXXXXXXXTK 720
             ++PF DE +TSN+S+ +  S+KP+DY+SIWH+QE+  K+ SP ++            T 
Sbjct: 603  FNEPFIDENDTSNDSIDLTRSMKPSDYISIWHIQEEEIKSNSPESIANSQFSQQSSITTA 662

Query: 721  SSVASPV--PATAFKFKPKIVSRSKYYYPDNNIQQEQSMD---FIYTKLP-SILDPMRRN 774
            S+V S     +T+FKFKP+IVSRS+ Y P + +      D   +I +    + LDPMRRN
Sbjct: 663  STVDSKKDNGSTSFKFKPRIVSRSRIYNPKSRVSSLNYYDNEDYILSNSEWNALDPMRRN 722

Query: 775  TINSKKIRQTVIDKRKSH-----PSF----SVDEG--NTITEVNIEPEVKVQPIS----- 818
            T+ SK+I Q  I  +K H     PS       D G  N   EV    E +  P+S     
Sbjct: 723  TLISKRI-QDNIRTQKGHAPLIRPSIMKLNGEDSGFQNHFLEVEQPQEHENIPLSTHLSE 781

Query: 819  ------IENDSSSLKANNQDDNESC-----SSGSQAFVTPSATMDNFDSQFNELGTSFEN 867
                  +  D   L  N QD+ E       S+G   F        +FD    ELG     
Sbjct: 782  QDITTNVGLDEQKLPTNTQDEAEISIREIESAGDITFNRGDLLSLSFDE---ELG----Q 834

Query: 868  DLENVLNYFDKDINT-----NTSSDLIEETTTKNQALPTSKVWSESVDYSLPTG--EEPN 920
            D  N L+  D D  +     + SS    +++ K+     + +W  S +   P    ++P 
Sbjct: 835  DFANFLDALDHDSTSFNHGPDDSSSFQRDSSKKS----FNSLWESSYELKPPPSIRKQP- 889

Query: 921  VDHNIMKKLLNTE---NSELNECRSDQEHHIIDNAGLGIWRSTANDIATGNVDMFALNGR 977
            +  ++++KLL ++   +++L + R ++        G+G+ ++   D++       ++ G 
Sbjct: 890  IAPDVLQKLLESDTKDDADLEKIREERITEPRTGLGIGMLKTPVKDVSIALA--ASIKGY 947

Query: 978  DISISKSE-----MTND--IDMGIFSDKKSLVHTPE-----LSPVKSTHVGSPFKVISP- 1024
            + S S ++     M N   I + +F D +    TP      +SP+K  HV SPFKV+   
Sbjct: 948  EASFSDTDSRPEGMNNSDAITLNMFDDFEEDKMTPSTPVRSISPIKR-HVSSPFKVVKAG 1006

Query: 1025 --KKNTQKDLKDGTTAEKRVSSESEAAQISIMSAVGEITNKDTAVVDDASNKDNIDAGQ- 1081
              ++N + ++K     E     E++  +  I   +             A  KDN++A + 
Sbjct: 1007 NKQENNEINIKAEEEIEPMTQQETDGLKQDIPPLL-------------AQTKDNVEAKEE 1053

Query: 1082 -VGNEGEP------IVDKGLLYLHLQGTTKLSLAGINAHHPKYSIEFDNGKNVVRTDWTE 1134
             +    EP        D G LYL ++  + L+L G  +H   Y+I FDNG+NVV+T W  
Sbjct: 1054 TITQLEEPQDVEQEFPDMGTLYLSIKAISTLALYGTKSHRATYAIVFDNGENVVQTPWES 1113

Query: 1135 LDSRGTISLNKEFEIPID--------------QSINKLIITLMIKYTRLTNELVEVTKRI 1180
            L   G I +NKEFE+PID               S  K +ITL  KY +  +ELVE+  ++
Sbjct: 1114 LPYDGNIRINKEFELPIDFKGKAETSSASSERDSYKKCVITLKCKYEKPRHELVEIVDKV 1173

Query: 1181 PIGKKFPFGKMKYRTETQFVERSTVKDEWDYLFARDGSFGRCEILLDESLFEKIRFKEQD 1240
            P+GK F FGK KY+ E ++V++   +DEWDYLFA+DGSF RCEI ++E   + + F    
Sbjct: 1174 PVGKSF-FGKTKYKFEKKYVQKKPKQDEWDYLFAQDGSFARCEIEINEEFLKNVAFNTSH 1232

Query: 1241 LSFDLLNKWSRLQNNSSSKVTQEALYDLPRRPAYKVGSLKVKGCFLERVSNDEKFPVSLK 1300
            + ++++NKWSR+ +        + LY+LPR+  +KV SL V+ CFLER S  E+FP    
Sbjct: 1233 MHYNMINKWSRIADKIHG---SKRLYELPRKAPHKVASLDVEACFLERTSAFEQFPKQFS 1289

Query: 1301 KAKSIVEKYRSQQDITKEGYLLQEGGDLSSQMKNRFFKLNGVELVGYHEVSMKPKIRINM 1360
                IV KY+ QQ+I KEGYLLQ+GGDL  +++NRFFKL+G +L GYHE+S K KI IN+
Sbjct: 1290 LVNKIVSKYKLQQNIYKEGYLLQDGGDLKGKIENRFFKLHGSQLSGYHEISRKAKIDINL 1349

Query: 1361 LXXXXXXXXXXXXXXXXNVRNFTTWVLMNDCFQLVFDDGEVITFSDESSLADEQSWYMKL 1420
            L                  RNFT WVL N+CFQLVFDDGE ITF+ E S  ++  WY KL
Sbjct: 1350 LKVTKVLRNEDIQADNGGQRNFTDWVLFNECFQLVFDDGERITFNAECSNEEKSDWYNKL 1409

Query: 1421 KEVV 1424
            +EVV
Sbjct: 1410 QEVV 1413

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 107/238 (44%), Gaps = 31/238 (13%)

Query: 2   EAETTVDSLLKEIDMEMEMQSGNDVAQS------NGYLLPLQEIGDETMDMLVQYXXXXX 55
           +AE+TVDSLLKEID EME Q+ +++ Q+      + + LPLQEIGD+TM+MLV++     
Sbjct: 3   DAESTVDSLLKEIDNEME-QTKSNITQNGSEDTPHNWKLPLQEIGDDTMEMLVKHNTRSN 61

Query: 56  XXXXXXXXXXXXXXXXXKVDDPQDLLPMENNYDDDEEQGDESDTTNLLSGNKHLTEEESE 115
                                   LL + +  ++      +    N ++ N  L    S 
Sbjct: 62  ATENSRGRSPSKMSTISNESLNLGLLRVNSELEESPAAVHQERIKNSVA-NGALGHANSP 120

Query: 116 QVLVDSKNLVXXXXXXXXXXXXXXXQVVEDEVSDSQLSNDMDDTRTLNFSVKGTEPLLAD 175
           +VL + KN+                ++  DE    +LS     +  L F++K T+PLL+ 
Sbjct: 121 KVLNNLKNMA-----------QDIDKLARDEEKPVKLS-----SSPLKFTLKSTQPLLSY 164

Query: 176 ELQDKEPDMIEVSTIY-DGPDMISMADDSDTEDIDLLSKAKKPVSPSKIPITNAQTIN 232
                    IE+ T Y D  +    A    T+   +L       SPS+IPITNA +IN
Sbjct: 165 PESPIHRSSIEIETNYDDEDEEEEDAYTCLTQSPQILH------SPSRIPITNAVSIN 216

>Kwal_33.14380
          Length = 1315

 Score =  330 bits (845), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 257/788 (32%), Positives = 400/788 (50%), Gaps = 81/788 (10%)

Query: 666  FDDEFETSNESMQMKNSVKPTDYLSIWHLQEQTTKAVSPALXXXXXXXXXXXXTK-SSVA 724
            F D  +TS +S+ +  S+KP+DYLSIW  Q++ T+  SP L            T+ SSV+
Sbjct: 559  FGDIGDTSQDSLDITTSLKPSDYLSIWRSQKEYTRP-SPTLSANSQFSQSSNVTRTSSVS 617

Query: 725  SPVPATAFKFKPKIVSRSKYYYP--DNNIQQEQSMDFIYTKLP--SILDPMRRNTINSKK 780
            +P   + FK KP+I+SRSK YYP   + +    + D   +K+   SILDP+RRNT  S+K
Sbjct: 618  AP---SKFKLKPRIISRSKIYYPPPQDEVNPRFNEDVYVSKVSGNSILDPLRRNTKVSRK 674

Query: 781  IRQTVIDKRKSHPSF-SVDEGNTITEVNIEPEVKVQPISIEND---SSSLKANNQDDNES 836
            I++    +R    S  SV +   I     E +   + + IEN    S +L  N+  + E+
Sbjct: 675  IQEQFPSRRPLLESEDSVIKSQLIETKAGEEQTLTEDVDIENSYERSDALSENDLSETEN 734

Query: 837  -CSSGSQAFVTPSATMDNFDSQFNELGTSFENDLENVLNYFDKDINTNTSSDLIEETTTK 895
               + S     P  + DN D    ELG +        LNY     N  T    ++E   K
Sbjct: 735  EQYAASIKLSMPEVSGDNLDVS-EELGNAL-----RALNY-----NNIT----LKEAEDK 779

Query: 896  NQALPTSKVWSE-----SVDYSLPTGEEPN------VDHNIMKKLLNTENSELNECRSDQ 944
            ++A     +W +      +D  L  GEE        ++  ++ KLL +E  E  E  ++ 
Sbjct: 780  SKASLVFHIWDKNNYQNGIDLEL--GEEQEHQTKQVIEKEVLTKLL-SEGPETTEKSTED 836

Query: 945  EHHIIDNAGLGIWRSTANDIATGNVDMFALNGRDISISKSEMTNDIDMGIFSDKKSLVHT 1004
                +     G  ++T  DIA    D F    +   + +S  T  +      D     HT
Sbjct: 837  SPFNV----FGQLKNTDGDIAICRTDSF----KGFEVVRSMSTESVQHNF--DHFPHPHT 886

Query: 1005 PELSPVKSTHVGSPFKVISPKK---NTQKDLKDGTTAEKRVSSESEAAQISIMSAVGEIT 1061
            P  SP K  HV SPFK++  +K    T     +  ++ K   +E+   + ++ S      
Sbjct: 887  P--SPAKKMHVDSPFKIVGARKMIKETGSPTGESKSSIKASKNEAHPLEFNLASH----- 939

Query: 1062 NKDTAVVDDASNKDNIDAGQVGNEGEPIVDKGLLYLHLQGTTKLSLAGINAHHPKYSIEF 1121
            N  TA          I+  +  ++   + D G LY+ +     + L+ I  H+PK S+EF
Sbjct: 940  NNSTA--------STIEGSRRSSKSSKLKDNGKLYVLINSIQNIKLSEIGRHNPKISMEF 991

Query: 1122 DNGKNVVRTDWTELDSRGTISLNKEFEIPID----QSINKLIITLMIKYTRLTNELVEVT 1177
            DNG N+V+T W  L     I +N+E+E+ +D    + I +++IT+  +Y R  +ELVE T
Sbjct: 992  DNGTNIVQTPWQPLTKDSAI-INQEYELIMDDIEPEKIPQIVITMKCRYDRPESELVEHT 1050

Query: 1178 KRIPIGKKFPFGKMKYRTETQFVERSTVKDEWDYLFARDGSFGRCEILLDESLFEKIRFK 1237
            +RIP+ KK PFGK KY     F+++    DEWD  FA+DGSF RC I ++ +L  +  + 
Sbjct: 1051 ERIPMKKKLPFGKKKYTLRKTFLQKKVEVDEWDNKFAKDGSFARCTIPMNSALLHQASYN 1110

Query: 1238 EQDLSFDLLNKWSRLQNNSSSKVTQEALYDLPRRPAYKVGSLKVKGCFLERVSNDEKFPV 1297
            +++L+F L N+W R   +++   T   ++ LPR+ AYK+G L +  C+L R SN EKFP 
Sbjct: 1111 KKELNFLLYNEWER---DTTCATTTSNVHQLPRKEAYKIGELSLTMCYLPRTSNLEKFPK 1167

Query: 1298 SLKKAKSIVEKYRSQQDITKEGYLLQEGGDLSSQMKNRFFKLNGVELVGYHEVSMKPKIR 1357
            +L+ A+ +V KY  QQ+I  EG+L QEGGD+ + ++ R+F L G +L+ +HE+S KP+  
Sbjct: 1168 TLQLAQDVVSKYAEQQNIKFEGFLWQEGGDVETSLQKRYFVLRGTQLIAHHEISKKPRAL 1227

Query: 1358 INMLXXXXX-XXXXXXXXXXXNVRNFTTWVLMNDCFQLVFDDGEVITFSDESSLADEQSW 1416
            IN+L                  VRNF+  VL ++C +LVF++GEVI    ES+   E+ W
Sbjct: 1228 INLLKVVSVIGEGKLTETNVKKVRNFSDVVLFSECLKLVFENGEVINLDAESTELKEK-W 1286

Query: 1417 YMKLKEVV 1424
               L  VV
Sbjct: 1287 TDLLTRVV 1294

 Score = 38.1 bits (87), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 8/48 (16%)

Query: 3  AETTVDSLLKEIDMEMEMQSGNDVAQSNGYLLPLQEIGDETMDMLVQY 50
          A  TVDSLL EID E+   +   +        PL+E+GDETM+ +V +
Sbjct: 11 ASATVDSLLSEIDQEIPPHATQQI--------PLEEVGDETMEKVVHH 50

>KLLA0E05962g complement(536856..540509) weakly similar to sp|P47136
            Saccharomyces cerevisiae YJR092w BUD4 budding protein
            singleton, start by similarity
          Length = 1217

 Score =  324 bits (831), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 243/769 (31%), Positives = 376/769 (48%), Gaps = 99/769 (12%)

Query: 664  DPFDDEFETSNESMQMKNSVKPTDYLSIWHLQEQTTKAVSPALXXXXXXXXXXXXTKSSV 723
            D F+D  ETS+ES+ + +S    +YLSIWH Q+     +SPAL              SSV
Sbjct: 517  DLFNDH-ETSHESIDLTSSSHKENYLSIWHSQKTGGSFISPALSTNSQFSTQSRT--SSV 573

Query: 724  ASPVPATAFKFKPKIVSRSKYYYPDNNIQQEQSMDFIYTKLPSILDPMRRNTINSKKIRQ 783
             +    ++FKFK +I+S S + +     +Q      + T+  S LDP+RRNTI SK+I+Q
Sbjct: 574  PTNHSGSSFKFKSRIISNS-HVFKQEAFRQFSDEYVLSTQDDSKLDPLRRNTIMSKRIQQ 632

Query: 784  TVIDKRKSHP---SFSVDEGNTITEVNIEPEVKVQPISIENDSSSLKANNQDDNESCSSG 840
             +  + K +P    F++DE +       EP +  + I I  D S       D     S  
Sbjct: 633  ELKTQAKMYPFANKFALDESS-------EPSIHNESI-ITGDISRTSDKAVDTTNILSHK 684

Query: 841  SQAFVTPSATMDNFDSQFNELGTSFENDLENVLNYFDKDINTNTSSDLIEETTTKNQALP 900
            +   + P +T   F S                L+ FDKD   +    L EE+   N    
Sbjct: 685  NLTLLPPQSTETVFSS---------------FLDNFDKD---DFEEKLAEESRL-NSKKN 725

Query: 901  TSKVWSESVDYSLPTGEEPNVD----HNIMKKLLNTENSELNECRSDQEHHIIDNAGLGI 956
                W    D S  +G   NVD       + ++L+ +N ++ +  S    HI D   L  
Sbjct: 726  LQTTWGHFRDVS--SG---NVDIKATQQQIAEVLHNQNEDVVQVGS----HIQDVKVL-- 774

Query: 957  WRSTANDIATGNVDMFALNGRDISISKSEMTNDIDMGIFSDKKSLVHTPELSPVKSTHVG 1016
                      GN     + G D+  S S+++              V T + SP+K  HVG
Sbjct: 775  ---------LGN----EIEGYDVQKSVSDLS--------------VETTKKSPIK--HVG 805

Query: 1017 SPFKVISPKKNTQKDLKDGTTAEKRVSSESEAAQISIMSAVGEITNKDTAVVDDASNKDN 1076
            SPFKV   K  ++   +     E+  +  +E  Q +  +++  +                
Sbjct: 806  SPFKV---KARSETPPQSPVVYERDTTEVNEGLQRAPTTSLASVY--------------- 847

Query: 1077 IDAGQVGNEGEPIVDKGLLYLHLQGTTKLSLAGINAHHPKYSIEFDNGKNVVRTDWTELD 1136
            ++      E   + D G LYL L+    L L  I  H+ KY IEFDNGK V+ T W  + 
Sbjct: 848  LENSLQEFESSELQDHGKLYLKLKSINSLRLQQIKRHNAKYCIEFDNGKEVIETPWESIP 907

Query: 1137 SRGTISLNKEFEIPIDQSINKLIITLMIKYTRLTNELVEVTKRIPIGKKFPFGKMKYRTE 1196
              G I +++EFE+ ++ +   L +T+ I+YT   N+L EV ++IPI K+F FGK KYR E
Sbjct: 908  EDGPIKMSQEFEVNMESNNVTLFMTMKIRYTSPQNQLTEVVEKIPIKKRFAFGKTKYRLE 967

Query: 1197 TQFVERSTVKDEWDYLFARDGSFGRCEILLDESLFEKIRFKEQDLSFDLLNKWSRLQNNS 1256
             +FV +    D+WD+ FA+DGSF RC++ +++++ ++I++K  +L F+ LN+W R  +  
Sbjct: 968  KRFVTKKLKYDDWDFKFAKDGSFARCQVNVNKNMLKQIKYKTNELHFEFLNEWEREFDEK 1027

Query: 1257 SSKVTQE-ALYDLPRRPAYKVGSLKVKGCFLERVSNDEKFPVSLKKAKSIVEKYRSQQDI 1315
             ++  +E  L+ LPR+   KV SL V   +L R S+ E+FP +LK  +   EKY  QQ +
Sbjct: 1028 IAQTYKEDELWKLPRKNPSKVCSLTVDVMYLPRTSSMERFPKNLKAVQKCCEKYLEQQRV 1087

Query: 1316 TKEGYLLQEGGDLSSQMKNRFFKLNGVELVGYHEVSMKPKIRINMLXXXXXXXXXXXXXX 1375
              EG+L QEGGD+   +K R+  L G EL+ + EV+ KP+  +N+L              
Sbjct: 1088 NNEGFLWQEGGDVEGMLKRRYMILKGTELIAHDEVTRKPQTLLNLL-NVVDIYSDGKTAT 1146

Query: 1376 XXNVRNFTTWVLMNDCFQLVFDDGEVITFSDESSLADEQSWYMKLKEVV 1424
               +RNFT  VL +DCF+L+F + EVI F+ +S+L  +Q W   L  VV
Sbjct: 1147 GKQMRNFTDMVLFSDCFKLLFANDEVINFNADSNLLKQQ-WVEILTSVV 1194

>AGL306C [4006] [Homologous to ScYJR092W (BUD4) - SH] (124072..127851)
            [3780 bp, 1259 aa]
          Length = 1259

 Score =  281 bits (718), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 226/799 (28%), Positives = 368/799 (46%), Gaps = 99/799 (12%)

Query: 665  PFDDEFETSNESMQM-KNSVKPTDYLSIWHLQEQTTKAVSPALXXXX--XXXXXXXXTKS 721
            PF  + + SN S+   K ++KP++YLSIWHLQE   +  SPA                ++
Sbjct: 500  PFGHDSDRSNNSVSYSKRTLKPSNYLSIWHLQEAQMRHDSPAFSANSQFSCKMVGESKRT 559

Query: 722  SVASPVPATA------FKFKPKIVSRSKYYYPDNNIQQEQSMDFIYTKLPSILDPMRRNT 775
            S+ S   +        FKFKPK+VSR + YY  +  +  Q     Y            N 
Sbjct: 560  SLESSRLSAKYESRFKFKFKPKLVSRRRIYYNKDQWRNFQEPPTRYYS----------NC 609

Query: 776  INSKKIRQTVIDKRKSHPSFSVDEGNTITEVNIEPEVKVQPISIENDSSSLKANNQDDNE 835
              S  I   V     S    S +  +  T  N++   +V  +   N+  S   N      
Sbjct: 610  TESDHISSDVPGTPVSPSIKSRNLCHGRTRGNMKMVERVNSLCSANERLSSAGN------ 663

Query: 836  SCSSGSQAFVTPSATMDNFDSQ-----FNELGTSFENDL------------ENVLNYFDK 878
                G + F++ S+ +D    +      +E+ T    DL            E +  + D 
Sbjct: 664  ----GDETFLSASSNLDVTSRRPSVDIISEIST---KDLLPKIKQDSDGFNELIKTFVDH 716

Query: 879  DINTNTSSDLIEETTTKNQALPTSKVWSESV------DYSLPTGEEPNVDHNIMKKLLNT 932
            D  +  +   I       +      +W  S+      DY    G  P      + KLL+ 
Sbjct: 717  DEQSQQTDSTIASYRRGTRDTTIYHIWEHSIQENSISDY----GNSPTAGKGTISKLLDN 772

Query: 933  ENSELNECRSDQEHHIIDNAGLGIWRSTANDIATGNVDMFALNGRDI--SISKSEMTNDI 990
               E      D ++  +   GLGI + T  D     + + +  G +   S S     N  
Sbjct: 773  HEVEF-----DGKNSFV--TGLGIIKKTDQDSRVDVLRIDSTQGIEAIQSFSPYSYRNAF 825

Query: 991  DMGIFSDKKSLVHTPELSPVKSTHVGSPFK-VISPKKNTQKDLKDGTTAEKRVSSESEAA 1049
            D    +  KS  H  E   ++++ +G+PF+  IS     Q  L     A +R ++     
Sbjct: 826  D--PVTPTKSAYHGCEA--LQASQMGTPFRPAISTTLQAQSGLGHKRPAVERPTTAQLGN 881

Query: 1050 QISIMSAVGEITNKDTAVVDDASNKDNIDAGQVGNEGEPIVDKGLLYLHLQGTTKLSLAG 1109
             +S      E++ +     ++   + ++             D G LY    G  +L+L  
Sbjct: 882  YVS-----AEMSPEVQEPAEETKKRTDLQ------------DNGQLYFVFVGIEQLALRD 924

Query: 1110 INAHHPKYSIEFDNGKNVVRTDWTELDSRGTISLNKEFEIPI-DQSINKLIITLMIKYTR 1168
            I  H  + SIEFDNG NVV+++W  L   G++SLN+E+ + I ++S+  +IITL  +Y  
Sbjct: 925  IERHSAECSIEFDNGNNVVQSEWLPLPKSGSMSLNQEYSVIIAEESLPNMIITLKCRYKS 984

Query: 1169 LTNELVEVTKRIPIGKKF-PFGKMKYRTETQFVERSTVKDEWDYLFARDGSFGRCEILLD 1227
               ELVE+T+++P+  K    GK KY+   + + R    DEWDY  A+DGSF RC+  +D
Sbjct: 985  PKKELVEITEKVPLKSKCCGLGKPKYKQVKKLLRREMDFDEWDYKIAQDGSFARCKEQID 1044

Query: 1228 ESLFEKIRFKEQDLSFDLLNKWSRLQNNSSSKVTQEALYDLPRRPAYKVGSLKVKGCFLE 1287
            E L + +R+K+Q   + LL++W R   + S +  ++  ++LPR PA+  G+L V  C+L 
Sbjct: 1045 EELLKNVRYKKQQFRWTLLSEWER---DHSKEHKRKRAWELPRLPAHPAGALVVDMCYLP 1101

Query: 1288 RVSNDEKFPVSLKKAKSIVEKYRSQQDITKEGYLLQEGGDLSSQMKNRFFKLNGVELVGY 1347
            R S  EKFP +L+ A+ +V K++ Q+ I  EG++ QEGGD +  +K R+F LNG +LV +
Sbjct: 1102 RTSRFEKFPKTLQIARRVVNKFKEQKAIAMEGFMWQEGGD-TEVLKRRYFTLNGTQLVAH 1160

Query: 1348 HEVSMKPKIRINMLXXXX--XXXXXXXXXXXXNVRNFTTWVLMNDCFQLVFDDGEVITFS 1405
            HE++ KPK  IN+L                  + R FT  VL+++CF L F++GE I F+
Sbjct: 1161 HEITKKPKAMINLLRVEKLLTEAEISREMLSSSSRCFTDLVLLHECFVLFFENGEEIMFN 1220

Query: 1406 DESSLADEQSWYMKLKEVV 1424
             ++   ++  W  KL++V+
Sbjct: 1221 PDTK-TEKLEWIEKLRKVI 1238

>Scas_672.27
          Length = 1072

 Score =  261 bits (666), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 152/439 (34%), Positives = 233/439 (53%), Gaps = 49/439 (11%)

Query: 1001 LVHTPELSP-VKSTHVGSPFKVISPKK--------NTQKDLKDGTTAEKRVSSESEAAQI 1051
            L  TP  +P ++  HV SPFKV+SP K        NT  D  D    +++V    +    
Sbjct: 642  LTKTPIQTPKIQHYHVESPFKVVSPLKLSKEKTEGNTNTDHDDKPILKEKVPPSED---- 697

Query: 1052 SIMSAVGEITNKDTAVVDDASNKDNIDAGQVGNEGEPIV--DKGLLYLHLQGTTKLSLAG 1109
                    I  ++   V +    D+       N+ EP+   D+G++Y+ L+G ++L L G
Sbjct: 698  --------IEGEEDLQVLELPEPDH-------NDTEPVALKDQGIVYITLEGLSRLKLDG 742

Query: 1110 INAHHPKYSIEFDNGKNVVRTDWTELDSRGTISLNKEFEIPIDQ---SINKLIITLMIKY 1166
            IN+H   YSIE           W  + S G+I L K+  + +D      N L +T+  +Y
Sbjct: 743  INSHRAAYSIEISLNGCQTTLPWKNMPSDGSIDLAKKLSVVLDSDKTKTNILKVTIKCRY 802

Query: 1167 TRLTNELVEVTKRIPIGKKFPFGKMKYRTETQFVERSTVKDEWDYLFARDGSFGRCEILL 1226
             R  NE+VEV ++IP+ + F FGK KY ++T++V+     DEW  +   DG+   CE  L
Sbjct: 803  ERQKNEIVEVVEKIPVKQNFLFGKKKYISKTKYVQVPVRPDEWVDIIKNDGTLAVCEFPL 862

Query: 1227 DESLFEKIRFKEQDLSFDLLNKWSRLQNNSSSKVTQEALYDLPRRPAYKVGSLKVKGCFL 1286
            ++ + E   F+ Q    +L+NKW+R  + ++  V               +G++ V  C+L
Sbjct: 863  EQKVLEHAAFQTQKYDLNLVNKWTRNSHKNNEWV---------------LGTMAVSLCYL 907

Query: 1287 ERVSNDEKFPVSLKKAKSIVEKYRSQQDITKEGYLLQEGGDLSSQMKNRFFKLNGVELVG 1346
            +R S+ E FP + + A+ I++K + Q DITKEGYLLQ+GGD+   ++ RF++L G +L G
Sbjct: 908  KRSSDLEVFPSTFEIAERIIKKCQIQNDITKEGYLLQQGGDIKGGLQRRFYRLQGTQLTG 967

Query: 1347 YHEVSMKPKIRINMLXXXXXXXXXXXXXXXXNV-RNFTTWVLMNDCFQLVFDDGEVITFS 1405
            YHEVSM P+I IN+L                 V  N T  +L+ DC  LVF++ E +TF+
Sbjct: 968  YHEVSMVPQIIINLLKVKSVLGSDDMVKEDERVFTNHTNLILLGDCLDLVFENNEKMTFT 1027

Query: 1406 DESSLADEQSWYMKLKEVV 1424
             ESS+ D + WYMKLKEVV
Sbjct: 1028 VESSIEDHKDWYMKLKEVV 1046

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 61/133 (45%), Gaps = 21/133 (15%)

Query: 662 IDDPFDDEFETSNESMQMKNSVKPTDYLSIWHLQEQTTK-----AVSPALXXXXXXXXXX 716
           + +PF+D   T+ ES  + N   P+ YLSIWH Q  T       + SP L          
Sbjct: 391 LSNPFEDYLNTTEESTFLANPETPSTYLSIWHSQAGTKPINFLDSTSPVLSINSQFTNLS 450

Query: 717 XXTKSSVASPVPATAFKFKPKIVSRSKYYYPDNNIQQEQSMDFIYTKLPSI--LDPMRRN 774
               S+ ++P  ++ + FKPK+V +SK Y      Q+E      YT +P +    P R+ 
Sbjct: 451 KA--SAFSTPPISSHYNFKPKVVKKSKIY------QKE------YTPVPWVKKTTPKRKQ 496

Query: 775 TINSKKIRQTVID 787
              S  + +T ID
Sbjct: 497 EPTSDLVPETDID 509

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 36/60 (60%), Gaps = 12/60 (20%)

Query: 2  EAETTVDSLLKEIDMEMEMQSGNDVAQSN-----------GYLLPLQEIGDETMDMLVQY 50
          ++E  VD+LLKEID E+E  + ND  Q +            + +PL EIGDETM+M+V Y
Sbjct: 5  KSEVGVDNLLKEIDDELEY-TFNDSKQDSLLEDQQVLVDGQFQIPLHEIGDETMEMIVTY 63

>Scas_674.28
          Length = 1033

 Score =  132 bits (331), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 107/189 (56%), Gaps = 14/189 (7%)

Query: 1248 KWSRLQNNSSSKVTQEALYDLPRRPAYKVGSL-KVKGCFLERVSN--------DEKFPVS 1298
            +W +  +    K+ +E  +++P +     G L K++   +ER S+         E+FP S
Sbjct: 823  EWEKFPSGGVLKIDKE--FEVPIKAESDDGFLQKIEIILMERRSDIIATVVEFRERFPKS 880

Query: 1299 LKKAKSIVEKYRSQQDITKEGYLLQEGGDLSSQMKNRFFKLNGVELVGYHEVSMKPKIRI 1358
            LK A +I++ Y++QQDI  EG+L Q+GGDL+  ++ R+FKLNG EL+GYHE+S +PKI I
Sbjct: 881  LKYAHTILDNYKAQQDIHMEGFLFQDGGDLNGMIQKRYFKLNGNELIGYHEISNEPKISI 940

Query: 1359 NMLXXXXXXXXXXX---XXXXXNVRNFTTWVLMNDCFQLVFDDGEVITFSDESSLADEQS 1415
            N+L                     R  + +VLM +CFQLVFD+ EVITF  E S      
Sbjct: 941  NLLKVSKIVGQEDMLNDVSVNNEKRIMSNFVLMGECFQLVFDNDEVITFDVEGSKEVRDE 1000

Query: 1416 WYMKLKEVV 1424
            WY K+  V+
Sbjct: 1001 WYQKINRVI 1009

 Score =  109 bits (272), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 141/525 (26%), Positives = 226/525 (43%), Gaps = 127/525 (24%)

Query: 684  KPTDYLSIWHLQEQTTKAVS----PALXXXXXXXXXXXXTK-SSVAS------PVPATA- 731
            +P  YL+IWH QE  T ++     P +            T  ++VAS       +P+ + 
Sbjct: 464  QPRSYLNIWHNQESITSSIVSTSSPTISYASNFSHDSELTNPTTVASISLQTLSMPSMSK 523

Query: 732  FKFKPKIVSRSKYYYPDNNIQQEQSMDFIYTKLPSILDPMRRNTINSKKIRQTVIDKR-- 789
            FKFKPK+ +R +                       ILDPMRRNTI SKKI+  VI  R  
Sbjct: 524  FKFKPKLHTRPRV----------------------ILDPMRRNTIKSKKIQDNVIHSRDL 561

Query: 790  KSHPSFSVDEGNTITEVNIEPEVKVQPISIENDSSSLKANNQDDNESCSSGSQAFVTPSA 849
            KS  S+  D  N   +++   E       +    S L+ N   ++ + S+  + ++    
Sbjct: 562  KSE-SYKEDTNNDAIDLSNVGEFGN---FLNFFDSELQENLVSNDINNSNIERDYI---- 613

Query: 850  TMDNFDSQFNELGTSFENDLENVLNYFDKDINTNTSSDLIEETTTKNQALPTSKVWSESV 909
                +D +  E G           +  D DIN + S D+IE+   +N             
Sbjct: 614  KFKVWDDEIYENG-----------HLMDLDINKSMSRDIIEDLLERN------------- 649

Query: 910  DYSLPTGEEPNVDHNIMKKLLNTENSELNECRSDQEHHIIDNAGLGIWRSTANDIATGNV 969
                   +EP+         L++EN+E  E             GLGI R+    ++  N 
Sbjct: 650  ------NDEPD---------LHSENNETMEL------------GLGILRTPNKHVSINNA 682

Query: 970  DMFALNGRDISISKSEMTNDIDMGIFSDKKSLVHTPEL-SPVKS-THVGSPFKVISPKKN 1027
               +++G + SIS +E    I   +  + +  V TP L +P K  +H+ SPFKV+     
Sbjct: 683  Q--SIHGYEPSISDTESV--ITSLLIENLEPKVSTPNLNAPAKRDSHISSPFKVLP---- 734

Query: 1028 TQKDLKDGTTAEKRVSSESEAAQISIMSA-VGEITNKDTAVVDDASNKDNIDAGQVGNEG 1086
                       +K   ++ E + +S+  A V  +  K  A  + A    +    +V N  
Sbjct: 735  --------KKVKKEEEAKKEESLLSVQEAPVQNVPIKKVAFANVAEKSSD---KKVTN-- 781

Query: 1087 EPIVDKGLLYLHLQGTTKLSLAGINAHHPKYSIEFDNGKNVVRTDWTELDSRGTISLNKE 1146
               +D+G+LY+ ++    L L  I+ H   Y IEFDNGKNV RT+W +  S G + ++KE
Sbjct: 782  ---MDRGVLYIKVKQIADLKLQAISHHKATYCIEFDNGKNVTRTEWEKFPSGGVLKIDKE 838

Query: 1147 FEIPI-----DQSINKLIITLMIKYTRLTNELVEVTKRIPIGKKF 1186
            FE+PI     D  + K+ I LM + + +   +VE  +R P   K+
Sbjct: 839  FEVPIKAESDDGFLQKIEIILMERRSDIIATVVEFRERFPKSLKY 883

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 42/75 (56%), Gaps = 14/75 (18%)

Query: 164 FSVKGTEPLLADELQ-DKEPDMIEVSTIYDGPDMISMADDSDTEDIDL-LSKAKKPV--S 219
           FS+KGT+PLL+     DK      + T+   P    +A+D + +D  L L++    V  S
Sbjct: 124 FSLKGTKPLLSYSASTDK------MYTVKINP----LAEDMENDDSPLELTQTSPQVRHS 173

Query: 220 PSKIPITNAQTINYF 234
           PSKIPITN  +IN F
Sbjct: 174 PSKIPITNIISINKF 188

>Sklu_2036.1 YJR092W, Contig c2036 2091-3874 reverse complement
          Length = 595

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 69/127 (54%), Gaps = 14/127 (11%)

Query: 663 DDPFDDEFETSNESMQMKNSVKPTDYLSIWHLQEQTTKAVSPALXXXXXXXXXXXXT-KS 721
           D PF D+ + SN+S+ +  S+KP+DYLSIWH QE   K  SPA+            T  S
Sbjct: 465 DYPFGDDQDISNDSIDITKSLKPSDYLSIWHTQENLLKNSSPAISANSQFSQQSESTLPS 524

Query: 722 SVASPVPATAFKFKPKIVSRSKYYYPDNNIQQEQSMD-------FI-YTKLPSILDPMRR 773
           S+ + +    FKFKP++VSRSK  Y  N++  +++++       F+  T   S+LDP  +
Sbjct: 525 SIRTNI---KFKFKPRVVSRSKICY--NHVTSQKAIEHPIEDELFLSQTTEKSVLDPFEK 579

Query: 774 NTINSKK 780
                KK
Sbjct: 580 KYSTFKK 586

>AGL293C [4019] [Homologous to ScYER114C (BOI2) - SH; ScYBL085W (BOI1)
            - SH] (156902..159856) [2955 bp, 984 aa]
          Length = 984

 Score = 34.7 bits (78), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 10/70 (14%)

Query: 1281 VKGCFLERVSNDEKFPVSLKKAKSIVEKYR------SQQDITKEGYLLQEGGDLSSQMKN 1334
            VKG   +R  N+ K P+S K+  + +E  R      + QD    G++ ++G       KN
Sbjct: 697  VKG---KRRGNNVK-PISKKQTSAFMEGIRNVTVNDAVQDAACSGWMSKKGAGTMGVWKN 752

Query: 1335 RFFKLNGVEL 1344
            RFF L+G  L
Sbjct: 753  RFFVLHGTRL 762

>KLLA0F23507g complement(2198603..2200066) similar to sp|P24719
            Saccharomyces cerevisiae YOR351c MEK1 ser/thr protein
            kinase, start by similarity
          Length = 487

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 5/48 (10%)

Query: 1179 RIPIGKKFPFGKMKYRTETQFVERSTVKDEWDYL-----FARDGSFGR 1221
            ++P G KF F  +K  T +QF+    +K EWD           G+FG 
Sbjct: 105  QLPNGAKFKFSAVKSETMSQFMTGLRIKSEWDRWKIVPRIVGSGTFGH 152

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.308    0.127    0.345 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 47,275,583
Number of extensions: 2236512
Number of successful extensions: 11508
Number of sequences better than 10.0: 591
Number of HSP's gapped: 11622
Number of HSP's successfully gapped: 738
Length of query: 1424
Length of database: 16,596,109
Length adjustment: 114
Effective length of query: 1310
Effective length of database: 12,649,657
Effective search space: 16571050670
Effective search space used: 16571050670
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 68 (30.8 bits)