Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M09042g45244520480.0
AGL308W21644949e-04
YJR094C (IME1)36038960.001
Kwal_47.1820925737730.53
Sklu_2108.161160664.9
Kwal_23.469526759646.7
Scas_691.2d26550637.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M09042g
         (445 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M09042g 901459..902817 weakly similar to sp|P21190 Saccharo...   793   0.0  
AGL308W [4004] [Homologous to ScYJR094C (IME1) - SH] complement(...    41   9e-04
YJR094C (IME1) [2985] chr10 complement(604486..605568) Transcrip...    42   0.001
Kwal_47.18209                                                          33   0.53 
Sklu_2108.1 YDR101C, Contig c2108 2435-4270 reverse complement         30   4.9  
Kwal_23.4695                                                           29   6.7  
Scas_691.2d                                                            29   7.4  

>CAGL0M09042g 901459..902817 weakly similar to sp|P21190
           Saccharomyces cerevisiae YJR094c IME1 transcription
           factor required for sporulation, hypothetical start
          Length = 452

 Score =  793 bits (2048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/445 (88%), Positives = 394/445 (88%)

Query: 1   MNNSCPGVTEKDKFIIRRNLILFDEDEEFKRLTDIRSSYIPLSRAMHSSSPNFKEAKVAS 60
           MNNSCPGVTEKDKFIIRRNLILFDEDEEFKRLTDIRSSYIPLSRAMHSSSPNFKEAKVAS
Sbjct: 1   MNNSCPGVTEKDKFIIRRNLILFDEDEEFKRLTDIRSSYIPLSRAMHSSSPNFKEAKVAS 60

Query: 61  RGCKTYRQSEDINGDNSHEISTLNNYFFDGGNPHPTTNNTIKLATNWDDTDKYINFSVCE 120
           RGCKTYRQSEDINGDNSHEISTLNNYFFDGGNPHPTTNNTIKLATNWDDTDKYINFSVCE
Sbjct: 61  RGCKTYRQSEDINGDNSHEISTLNNYFFDGGNPHPTTNNTIKLATNWDDTDKYINFSVCE 120

Query: 121 ELTPVTDYKNCIIDQDPLLLADSPLNMSVSTDMIDNDLGSAYSELDFHSNYDFEDYSISY 180
           ELTPVTDYKNCIIDQDPLLLADSPLNMSVSTDMIDNDLGSAYSELDFHSNYDFEDYSISY
Sbjct: 121 ELTPVTDYKNCIIDQDPLLLADSPLNMSVSTDMIDNDLGSAYSELDFHSNYDFEDYSISY 180

Query: 181 DNNYRGDYFNDSTEDVSPNFSKSTNYTSKLPIEIIHTQPHKLINPKILSTTFDIELSSFI 240
           DNNYRGDYFNDSTEDVSPNFSKSTNYTSKLPIEIIHTQPHKLINPKILSTTFDIELSSFI
Sbjct: 181 DNNYRGDYFNDSTEDVSPNFSKSTNYTSKLPIEIIHTQPHKLINPKILSTTFDIELSSFI 240

Query: 241 NEETYLLXXXXXXXXXXXXXXXXXXXNIQNIASITNSSGELMKEANFCNEQNERDSVVXX 300
           NEETYLL                   NIQNIASITNSSGELMKEANFCNEQNERDSVV  
Sbjct: 241 NEETYLLSSKYSEASSFSSIFSYDIDNIQNIASITNSSGELMKEANFCNEQNERDSVVTI 300

Query: 301 XXXXXXXXXXXXXXXXXXXHFPIPDQHKFNDNIEYYYYFDPDEGNPIILPEYPPLRTYEV 360
                              HFPIPDQHKFNDNIEYYYYFDPDEGNPIILPEYPPLRTYEV
Sbjct: 301 KLETKNNKKTTKYSIKKETHFPIPDQHKFNDNIEYYYYFDPDEGNPIILPEYPPLRTYEV 360

Query: 361 STGFXXXXXXXXXXXPVIKTKKSQANSYVHRTSKNRIRKSKDSKSNKEFFTSLLSKLDRY 420
           STGF           PVIKTKKSQANSYVHRTSKNRIRKSKDSKSNKEFFTSLLSKLDRY
Sbjct: 361 STGFKKKKRINKEPKPVIKTKKSQANSYVHRTSKNRIRKSKDSKSNKEFFTSLLSKLDRY 420

Query: 421 CVNAYGRRSRNQEYYDKVRFQEILY 445
           CVNAYGRRSRNQEYYDKVRFQEILY
Sbjct: 421 CVNAYGRRSRNQEYYDKVRFQEILY 445

>AGL308W [4004] [Homologous to ScYJR094C (IME1) - SH]
           complement(121864..122514) [651 bp, 216 aa]
          Length = 216

 Score = 40.8 bits (94), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 402 DSKSNKEFFTSLLSKLDRYCVNAYGRRSRNQEYYDKVRFQEILY 445
           DS    EF  +L SKL RYC   +   S+  EY+DK+R QE+ Y
Sbjct: 166 DSPEQYEFVHALTSKLSRYC-GYFVADSKEMEYFDKIRLQEVEY 208

>YJR094C (IME1) [2985] chr10 complement(604486..605568)
           Transcription factor required for sporulation, positive
           regulator of IME2 and many sporulation genes [1083 bp,
           360 aa]
          Length = 360

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 23/38 (60%)

Query: 408 EFFTSLLSKLDRYCVNAYGRRSRNQEYYDKVRFQEILY 445
           EF   L SKL RY        S +Q+YYDKVRFQEI Y
Sbjct: 316 EFLKKLNSKLSRYAAAYSFSSSNDQDYYDKVRFQEISY 353

 Score = 29.3 bits (64), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 21/40 (52%)

Query: 189 FNDSTEDVSPNFSKSTNYTSKLPIEIIHTQPHKLINPKIL 228
           F  +    S +F KS    S     ++HTQP  LINP+IL
Sbjct: 46  FGSTISPRSWHFEKSDKIASSQLQNLVHTQPIHLINPQIL 85

>Kwal_47.18209
          Length = 257

 Score = 32.7 bits (73), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 4/37 (10%)

Query: 409 FFTSLLSKLDRYCVNAYGRRSRNQEYYDKVRFQEILY 445
           F   +  KL RYC    G  + +  Y+DK+R QEI+Y
Sbjct: 216 FVQYITHKLSRYC----GYLASDSHYHDKLRLQEIMY 248

>Sklu_2108.1 YDR101C, Contig c2108 2435-4270 reverse complement
          Length = 611

 Score = 30.0 bits (66), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 27/60 (45%), Gaps = 8/60 (13%)

Query: 81  STLNNYFFDGGNPHPTTNNTIKLATNW----DDTDKYINF----SVCEELTPVTDYKNCI 132
           S   N   + G  HPTT +  +LA+ W    DD D   N+    S  E  + V  YK CI
Sbjct: 77  SAFKNKVNERGIAHPTTIDVDELASGWCPELDDVDVLKNWNKNVSADEAGSTVNGYKRCI 136

>Kwal_23.4695
          Length = 267

 Score = 29.3 bits (64), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 6/59 (10%)

Query: 387 SYVHRTSKNRIRKSKDSKSNKEFFTSLLSKLDRYCVNAYGRRSRNQEYYDKVRFQEILY 445
           SY+  TS+ ++++ K+SKS   FF  L+SK   + VN       ++E +D+ R  E  Y
Sbjct: 172 SYLQITSE-KLQRLKESKSGSPFFDKLVSKWQDFAVNEA-----DEETFDEERPTEKYY 224

>Scas_691.2d
          Length = 265

 Score = 28.9 bits (63), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 21/50 (42%), Gaps = 14/50 (28%)

Query: 408 EFFTSLLSKLDRYCVNAYG--------------RRSRNQEYYDKVRFQEI 443
           EF   L  KL RY                    + S  QEY+DKVRFQEI
Sbjct: 207 EFLKQLHMKLARYTTKPTTNYLYCNPDPNKCQLQLSLEQEYFDKVRFQEI 256

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.133    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,275,302
Number of extensions: 693659
Number of successful extensions: 1833
Number of sequences better than 10.0: 29
Number of HSP's gapped: 1830
Number of HSP's successfully gapped: 30
Length of query: 445
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 340
Effective length of database: 12,961,219
Effective search space: 4406814460
Effective search space used: 4406814460
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 63 (28.9 bits)