Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M08954g85083837420.0
YDR475C87680210331e-127
Scas_660.307748068391e-100
Scas_699.297167816468e-73
YOR019W7304386232e-69
Kwal_47.182467734175943e-65
AEL233C7934285512e-59
KLLA0F02684g7794404042e-40
CAGL0H08261g7342593373e-32
Scas_595.137662231534e-10
YGR237C7852011501e-09
CAGL0F07975g7702021463e-09
Kwal_14.10286801981429e-09
KLLA0E15642g766381357e-08
ADL147W626391258e-07
AFR071W1577130712.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M08954g
         (838 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M08954g 890764..893316 weakly similar to tr|Q99248 Saccharo...  1446   0.0  
YDR475C (YDR475C) [1291] chr4 complement(1407452..1410082) Prote...   402   e-127
Scas_660.30                                                           327   e-100
Scas_699.29                                                           253   8e-73
YOR019W (YOR019W) [4832] chr15 (368126..370318) Protein of unkno...   244   2e-69
Kwal_47.18246                                                         233   3e-65
AEL233C [2273] [Homologous to ScYOR019W - SH; ScYDR475C - SH] (1...   216   2e-59
KLLA0F02684g 242962..245301 some similarities with sgd|S0005545 ...   160   2e-40
CAGL0H08261g 810168..812372 weakly similar to tr|Q99248 Saccharo...   134   3e-32
Scas_595.13                                                            64   4e-10
YGR237C (YGR237C) [2185] chr7 complement(963302..965659) Protein...    62   1e-09
CAGL0F07975g complement(782229..784541) similar to sp|P50089 Sac...    61   3e-09
Kwal_14.1028                                                           59   9e-09
KLLA0E15642g 1393066..1395366 weakly similar to sp|P50089 Saccha...    57   7e-08
ADL147W [1594] [Homologous to ScYGR237C - SH] complement(431887....    53   8e-07
AFR071W [3263] [Homologous to ScYKR031C (SPO14) - SH] complement...    32   2.7  

>CAGL0M08954g 890764..893316 weakly similar to tr|Q99248
           Saccharomyces cerevisiae YOR019w, hypothetical start
          Length = 850

 Score = 1446 bits (3742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 721/838 (86%), Positives = 721/838 (86%)

Query: 1   MEQDESLRSFYRRVKVYRRSVXXXXXXXXXXXXNLDSRLCESESALSGNDSLEPGTPVLD 60
           MEQDESLRSFYRRVKVYRRSV            NLDSRLCESESALSGNDSLEPGTPVLD
Sbjct: 1   MEQDESLRSFYRRVKVYRRSVGDGEPGLGGDIGNLDSRLCESESALSGNDSLEPGTPVLD 60

Query: 61  AVDGRKKQRSVSVRANAKVRPCVSFNTVPLPSKHTLLDEYEQDFPGVQLFPQEYTMEEYY 120
           AVDGRKKQRSVSVRANAKVRPCVSFNTVPLPSKHTLLDEYEQDFPGVQLFPQEYTMEEYY
Sbjct: 61  AVDGRKKQRSVSVRANAKVRPCVSFNTVPLPSKHTLLDEYEQDFPGVQLFPQEYTMEEYY 120

Query: 121 DDESGYVSEDNQNYMLHNSYITPEIVERLNKNATTRSSSPPPLDREYPSAGKQKKMSSKQ 180
           DDESGYVSEDNQNYMLHNSYITPEIVERLNKNATTRSSSPPPLDREYPSAGKQKKMSSKQ
Sbjct: 121 DDESGYVSEDNQNYMLHNSYITPEIVERLNKNATTRSSSPPPLDREYPSAGKQKKMSSKQ 180

Query: 181 QANITKMFKIAKNGRIVREDYPSRPTLVNDAFILNRDLNDWHNTWRSRRHTIEQRKEDLS 240
           QANITKMFKIAKNGRIVREDYPSRPTLVNDAFILNRDLNDWHNTWRSRRHTIEQRKEDLS
Sbjct: 181 QANITKMFKIAKNGRIVREDYPSRPTLVNDAFILNRDLNDWHNTWRSRRHTIEQRKEDLS 240

Query: 241 ETFEYPQLLFPQQTKPSEPVIMMGEDYKPLTXXXXXXXXXXXXXXXSTSGPRVVLCHISG 300
           ETFEYPQLLFPQQTKPSEPVIMMGEDYKPLT               STSGPRVVLCHISG
Sbjct: 241 ETFEYPQLLFPQQTKPSEPVIMMGEDYKPLTKEQRKKEKIIHKKIESTSGPRVVLCHISG 300

Query: 301 KRHTWVGLDWTIKRLSNDGDHIVVLAHIPRMXXXXXXXXXXXXXXXXXXXXXXXXDVNRK 360
           KRHTWVGLDWTIKRLSNDGDHIVVLAHIPRM                        DVNRK
Sbjct: 301 KRHTWVGLDWTIKRLSNDGDHIVVLAHIPRMISSRRLITSASASRSRSRTRSRSRDVNRK 360

Query: 361 AYNKGDYEASAFSLGQDNNENLNKHEDFVEWASGYSQEDVETTMENIFDYIANILPEERS 420
           AYNKGDYEASAFSLGQDNNENLNKHEDFVEWASGYSQEDVETTMENIFDYIANILPEERS
Sbjct: 361 AYNKGDYEASAFSLGQDNNENLNKHEDFVEWASGYSQEDVETTMENIFDYIANILPEERS 420

Query: 421 VKITVEVVVGAALHTIIDATNAYQPDLMVASTLRWERTDNLVLWKSNLLIDKLATVFPLP 480
           VKITVEVVVGAALHTIIDATNAYQPDLMVASTLRWERTDNLVLWKSNLLIDKLATVFPLP
Sbjct: 421 VKITVEVVVGAALHTIIDATNAYQPDLMVASTLRWERTDNLVLWKSNLLIDKLATVFPLP 480

Query: 481 LFVVPARRMFLFEHGLEEESKQIEISLXXXXXXXXXXXXVTGDIVESEADKKIVPPKRIG 540
           LFVVPARRMFLFEHGLEEESKQIEISL            VTGDIVESEADKKIVPPKRIG
Sbjct: 481 LFVVPARRMFLFEHGLEEESKQIEISLEKENIEMEKENNVTGDIVESEADKKIVPPKRIG 540

Query: 541 TIGPPERRLVGADSFTAGFNMKRPSLGTSVSAPIAENVFEEESGSETXXXXXXXXXXXXX 600
           TIGPPERRLVGADSFTAGFNMKRPSLGTSVSAPIAENVFEEESGSET             
Sbjct: 541 TIGPPERRLVGADSFTAGFNMKRPSLGTSVSAPIAENVFEEESGSETGSDVDSELSDLSS 600

Query: 601 XXXXXKLTVREKLHLKARSYRLQTAQYLKDLDNNKSISHEEIQIKKVETIINQTIKFSLA 660
                KLTVREKLHLKARSYRLQTAQYLKDLDNNKSISHEEIQIKKVETIINQTIKFSLA
Sbjct: 601 DEGNDKLTVREKLHLKARSYRLQTAQYLKDLDNNKSISHEEIQIKKVETIINQTIKFSLA 660

Query: 661 IXXXXXXXXXXXXXXXTKLKRVITGGAVLNPQSGSKKSMLSVLDNPKTTRKKKSLSATTS 720
           I               TKLKRVITGGAVLNPQSGSKKSMLSVLDNPKTTRKKKSLSATTS
Sbjct: 661 IEDLGSESDDDDDVGLTKLKRVITGGAVLNPQSGSKKSMLSVLDNPKTTRKKKSLSATTS 720

Query: 721 GVSGNRVPRSSQIKFASSVKHKDGNNALGNSVVHTKPQIQVHAASEDSSPKLTPIRSYNT 780
           GVSGNRVPRSSQIKFASSVKHKDGNNALGNSVVHTKPQIQVHAASEDSSPKLTPIRSYNT
Sbjct: 721 GVSGNRVPRSSQIKFASSVKHKDGNNALGNSVVHTKPQIQVHAASEDSSPKLTPIRSYNT 780

Query: 781 GSSNQAGLKTMKSNNSLRRVXXXXXXXXXXXXXXXXXXXXXGGFMSLFKGKSKERSES 838
           GSSNQAGLKTMKSNNSLRRV                     GGFMSLFKGKSKERSES
Sbjct: 781 GSSNQAGLKTMKSNNSLRRVKSNDSSRISQSSKKSSSSTSSGGFMSLFKGKSKERSES 838

>YDR475C (YDR475C) [1291] chr4 complement(1407452..1410082) Protein
           of unknown function [2631 bp, 876 aa]
          Length = 876

 Score =  402 bits (1033), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 274/802 (34%), Positives = 390/802 (48%), Gaps = 115/802 (14%)

Query: 2   EQDESLRSFYRRVKVYRRSVXXXXXXXXXXXXNLDSRLCESESALSGNDSLEPGTPVLDA 61
           +QDE+LR+ Y+ VK+Y R                   L + +   S ND       +LD+
Sbjct: 5   DQDEALRNSYKYVKLYVRQDQLEDTVDI---------LAKQDEDKSNNDDRRSLASILDS 55

Query: 62  VDGRKKQRSVSVRANAKVRPCVSFNTVPLPSKHTLLDEYEQDFPGVQLFPQEYTMEEYYD 121
                  +     +N K  PCVSFNTVP     + LDE +++FPGVQ+   +YTMEEYYD
Sbjct: 56  S---SSVKKKGKGSNEKYLPCVSFNTVPRSRVSSPLDEEKREFPGVQI-SADYTMEEYYD 111

Query: 122 DESGYVSEDNQNYMLHNSYITPEIVERLNKNATTRSSSPPPLDREYPSAGKQKKMSSKQQ 181
           DESG+ S++N +Y   NSY +     R    +  R SSPPP              +SK+ 
Sbjct: 112 DESGFTSDNNADYFSGNSYSS----RREGSASPGRYSSPPP--------------ASKRN 153

Query: 182 ANITKMFKIAKNGRIVREDYPSRPTLVNDAFILNRDLNDWHNTWRSRRHTIEQRKEDLSE 241
             I KMFKI++NG+IVREDYP+ PT +NDA +++R   +W   W  +++ I+ R E   +
Sbjct: 154 IKIGKMFKISENGKIVREDYPTTPTDINDALVISRAYANWRQLWIKKKNQIDHRLEQKRD 213

Query: 242 TFEYPQLLFPQQTKPSE----PVIMMG----EDYKPLTXXXXXXXXXXXXXXXSTSGPRV 293
            F YP +LFP   K S     P I       + + PLT                 + PR 
Sbjct: 214 FFNYPTILFPPNKKKSSEGATPTIKFNPPIEDGFTPLTKSQKRKERVLSEKVGFPNTPRT 273

Query: 294 VLCHISGKRHTWVGLDWTIKRLSNDGDHIVVLAHIPRMXX-------XXXXXXXXXXXXX 346
           +LCHISG++HTWV LDW ++ L  + DHIVVLA++PR+                      
Sbjct: 274 ILCHISGRKHTWVALDWALRTLIQNTDHIVVLANLPRLTKNNFEDNDSMSERKRMLMMMD 333

Query: 347 XXXXXXXXXDVNRKAYNKGDYEASAFSLGQDNNENLNKHEDFVEWASGYSQEDVETTMEN 406
                        ++ ++      A SLG + ++N  KH++F+EW SGY+Q ++E  +++
Sbjct: 334 DSRSVSSARRSRSRSRSRSICTRRALSLGPEESDNKLKHQNFIEWTSGYTQNEIERKLQD 393

Query: 407 IFDYIANILPEERSVKITVEVVVGAALHTIIDATNAYQPDLMVASTLRWERTDNLVLWKS 466
           +FDY+  I+P++RSVK+TVE+++G    T+++A N Y PD  V+STLRWERTD+LV WKS
Sbjct: 394 LFDYVTLIIPQDRSVKVTVEILIGKTKKTLLEAINIYLPDFFVSSTLRWERTDSLVRWKS 453

Query: 467 NLLIDKLATVFPLPLFVVPARRMFLFEHGLEEESKQIEISLXXXXXXXXXXXXVTGDIVE 526
           N L DKL T FP+P F+VPA+RMF  E  L++E K+ E++                    
Sbjct: 454 NFLTDKLCTNFPIPTFIVPAKRMFDLEIDLQKEFKEPEVT-------------------- 493

Query: 527 SEADKKIVPPKRIGTIGPPE--RRLVGAD-SFTAGFNMKRP-----SLGTSVSAPIAENV 578
                     K+  T GP         AD S     N+KR      S+ +   AP A   
Sbjct: 494 ----------KQKNTSGPKPGFSHSKSADASIPTISNIKRKQDNDYSIDSLCYAPEANGA 543

Query: 579 ----FEEESGSETXXXXXXXXXXXXXXXXXXKLTVREKLHLKARSYRLQTAQYLKDLDNN 634
                EE S  E                    ++V+EKL   AR  R   AQ L D D++
Sbjct: 544 NNSSREEASDDELNAFKDDENDVMSVKSLTSNISVKEKLCTMARKRRKSMAQQLNDADHD 603

Query: 635 KSISHEEIQIKKVETIINQTIKFSLAIXXXXXX---------XXXXXXXXXTKLKRVITG 685
            SI   +  +KK+  I+  ++KFSL I                         +LKRVITG
Sbjct: 604 SSIPPGQRHLKKLNIILESSLKFSLEIDSITDSIENGDVDEKRAHSMESGFEELKRVITG 663

Query: 686 GAVLNPQSGSKKSMLSVLDNPKTTR---------------KKKSLSATTSGVSGNRVPRS 730
           GA     +  ++SML VLDNP ++R               K K  S T + ++ +     
Sbjct: 664 GAPPRHVATPQRSMLDVLDNPSSSRSKSKSRSSSKSRIRDKSKPSSPTATDINSSASASR 723

Query: 731 S---QIKFASSVKHKDGNNALG 749
           S   QIKFASSVK+ DGN ALG
Sbjct: 724 SRSPQIKFASSVKNVDGNAALG 745

>Scas_660.30
          Length = 774

 Score =  327 bits (839), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 247/806 (30%), Positives = 385/806 (47%), Gaps = 122/806 (15%)

Query: 49  NDSLEPGTPVLDAVDGRKKQRSVSVRANAKVRPCVSFNTVPLP-SKHTLLDEYEQDFPGV 107
           N  L P TP  + +  +++     +R     + CVSFNT+P+  SK +LLDEYE DFPGV
Sbjct: 19  NIKLYPDTPKSETLVAKERNPYPYLR----YKKCVSFNTIPVKTSKDSLLDEYEPDFPGV 74

Query: 108 QLF-PQEYTMEEYYDDESGYVSEDNQNYMLHNSYITPEIVERLNKNATTRSSSPPPLDRE 166
           QL+ P  YTM+EYYD+ESGY+S DN ++ +HN YIT +        +  +   PPP    
Sbjct: 75  QLYAPDNYTMDEYYDNESGYIS-DNPDFHIHNKYITQKGF------SNVKEILPPPTT-- 125

Query: 167 YPSAGKQKKMSSKQQANITKMFKIAKNGRIVREDYPSRPTLVNDAFILNRDLNDWHNTWR 226
             + GK+  +S+        +FKIA+NG+IVREDYPSRPTL N+A ++NR + DW + W 
Sbjct: 126 --NGGKRVALSN--------LFKIAENGKIVREDYPSRPTLSNEAVVINRAVLDWGSLWE 175

Query: 227 SRRHTIEQRKEDLSETFEYPQLLFPQQTKPSEPVIMMGED-YKPLTXXXXXXXXXXXXXX 285
            R+  I+ R E   E F+Y   LF Q+ K +   I   ED Y PL+              
Sbjct: 176 KRKLQIDSRLEKKEEVFQYSSTLFSQKNKNNN--IPKKEDPYMPLSKEQKRKEKVLREAV 233

Query: 286 XSTSGPRVVLCHISGKRHTWVGLDWTIKRLSNDGDHIVVLAHIPRMXXXXXXXXXXXXXX 345
              + PR +LC +SG+RHTWV LDWTIK L+ D D +VV+A++P+M              
Sbjct: 234 GFPTIPRTILCLLSGRRHTWVALDWTIKCLAQDTDQVVVVANLPKM-------------- 279

Query: 346 XXXXXXXXXXDVNRKAYNKGDYEASAFSLGQDNNENLNK-----HEDFVEWASGYSQEDV 400
                      ++    NK    + + +  Q  + +  K      ED  EW++GYS++ +
Sbjct: 280 -----------IDLSKSNKRGSRSRSRTRSQARSRSSEKLYSTLPEDEEEWSAGYSKDVI 328

Query: 401 ETTMENIFDYIANILPEE-RSVKITVEVVVGAALHTIIDATNAYQPDLMVASTLRWERTD 459
           E  + +IF YI+ +L +  +S+KITVE+++G     + +  NAY PD +++STL+W+RT+
Sbjct: 329 EQKLRDIFRYISVLLTKNPKSIKITVELILGKTKKILCEVINAYTPDFIISSTLKWQRTE 388

Query: 460 NLVLWKSNLLIDKLATVFPLPLFVVPARRMFLFEHGLEEESKQIEISLXXXXXXXXXXXX 519
           +LV WKS  L DK+ T +P+P++VVPA+RMF FE  L   +KQ                 
Sbjct: 389 SLVQWKSRKLTDKICTSYPVPVYVVPAKRMFDFERKL---AKQF-------------ANP 432

Query: 520 VTGDIVESEADKKIVPPKRIGTIGPPERRLVGADSFTAGFNMKRPSLGTSVSAPIAENVF 579
           ++    E       + PK I         ++ A+   +  ++  P L   V     ++V 
Sbjct: 433 ISTSEEELSTKNNFIHPKLIHANSEMSPAIISAEQNYSSEDIYSPKLACIVDD--KDSVI 490

Query: 580 EEESGSETXXXXXXXXXXXXXXXXXXKLTVREKLHLKARSYRLQTAQYLKDLDNNKSISH 639
            E  G++                    L  + KLH  AR +R   A+ + ++  + ++  
Sbjct: 491 AE--GNDDIDDDNADQLSINSVSSSSSL--QTKLHRTARKHRQIMARKIDEITKDLTLDQ 546

Query: 640 EEIQIKKVETIINQTIKFSLAIXXXXXXXXXXXXXXXTKLKRVITGGAVLNPQSGSKKSM 699
            + Q+ K++ +I  +++FSL +                 LK ++ G       SG  K M
Sbjct: 547 AKKQLSKLDIVIESSLQFSLELDTMPDLDMETRNANLNNLKSIMKG------VSGGAKPM 600

Query: 700 LSVLDNPKTTRKKKSLSATTSGVSGNRVPRSSQIKFASSVKHKDGNNALGNSVVHTKPQI 759
            S+LD     + K  L  T+S +S       S+I+F+++ K  D N ALGN+  ++    
Sbjct: 601 RSMLDVGPLPKLK--LKKTSSPISTQH--HKSKIQFSANSKKIDENGALGNTKDYS---- 652

Query: 760 QVHAASEDSSPKLTPIRSYN---------------TGSSNQAGLKTMKSNNSLRRVXXXX 804
                       L PIRSYN               + SS    L+ ++SN S ++     
Sbjct: 653 ------------LKPIRSYNEPSSVSTDGRSIHSVSHSSYGETLRKIRSNESTKKSSIRH 700

Query: 805 XXXXXXXXXXXXXXXXXGGFMSLFKG 830
                             G  SLF+G
Sbjct: 701 SNTTSSNTSSNSSGGSRWGLFSLFRG 726

>Scas_699.29
          Length = 716

 Score =  253 bits (646), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 223/781 (28%), Positives = 322/781 (41%), Gaps = 171/781 (21%)

Query: 81  PCVSFNTVPLPSKHTLLDEY-EQDFPGVQLFPQEYTMEEYYDDESGYVSEDNQNYMLHNS 139
           PCVSFNTVP  S      EY + DF GV +                  S   Q +  H  
Sbjct: 35  PCVSFNTVPSSSSEK---EYPDLDFEGVTM-----------------PSMKRQPFYYH-- 72

Query: 140 YITPEIVERLNKNATTRSSSPPPLDREYPSAGK-QKKMSSKQQANITKMFKIAKNGRIVR 198
                                     EYPS  +     + K+Q ++ +MFK+A+ G+IVR
Sbjct: 73  --------------------------EYPSNSQLCSSKNPKRQKSMNEMFKMAQGGKIVR 106

Query: 199 EDYPSRPTLVNDAFILNRDLNDWHNTWRSRRHTIE-QRKEDLSETFEYPQLLFPQQTKPS 257
            DYPSRP + N+A I+ +    W   WR R+  IE +RK D    F+Y  +LFP + K  
Sbjct: 107 VDYPSRPMVDNEAMIMTKKQPLWRKKWRERKKIIEARRKCDGDSVFKYRFILFPHEEKQK 166

Query: 258 EPVIMMG---EDYKPLT--------------XXXXXXXXXXXXXXXSTSGPRVVLCHISG 300
           E     G   + Y  L+                              T+ PR ++CHISG
Sbjct: 167 EGKGSGGTLKKRYMGLSNNSSHSSSKTDVKLKEQKRQKEVINLKIGDTNLPRTIVCHISG 226

Query: 301 KRHTWVGLDWTIKRLSNDGDHIVVLAHIPRMXXXXXXXXXXXXXXXXXXXXXXXXDVNRK 360
           +RHTWV LDW  K L  D DH+V+LA++PRM                             
Sbjct: 227 RRHTWVALDWLFKELVQDTDHVVILANLPRMVC--------------------------- 259

Query: 361 AYNKGDYEASAFSLGQDNNENLNKHEDFVEWASGYSQEDVETTMENIFDYIANILPEERS 420
              +         + QD  + L +     EW SGYS+  V + +  I +YI+ ILP ++S
Sbjct: 260 ---RSKVAPDTKKIIQDEPKLLEE-----EWTSGYSENLVASRIARILEYISLILPVDKS 311

Query: 421 VKITVEVVVGAALHTIIDATNAYQPDLMVASTLRWERTDNLVLWKSNLLIDKLATVFPLP 480
           +KITVE+ +G     +IDA N Y P+L V  TL+W +T+NL+ +KSN+L+D     +P+P
Sbjct: 312 IKITVEIAIGKTKKVLIDAINIYTPNLFVFGTLKWSKTENLISYKSNILMDTFCVHYPIP 371

Query: 481 LFVVPARRMFLFEHGLEEESKQIEISLXXXXXXXXXXXXVTGDIVESEADKKIVPPKRIG 540
            F+VPARRM  FE  L+E+                            E  K       + 
Sbjct: 372 TFIVPARRMSKFELSLQEQ------------------------FANCEQQKSFKKNNHVD 407

Query: 541 TIGPPERRLVGA----DSFTAGFNMKRPSLGTSVSAPIAENVFEEESGSETXXXXXXXXX 596
            +   ++ ++ A    DS TAG+     S   + S    E   +++  +E+         
Sbjct: 408 KVNKNQQSIMLAVQSQDSLTAGYE----SSTETDSLDSVEKTSDDKDDNES--------- 454

Query: 597 XXXXXXXXXKLTVREKLHLKARSYRLQTAQYLKDLD-NNKSISHEEIQIKKVETIINQTI 655
                    +   R  L   AR YR    + L  L+ N K ++++E Q+ K++ II  +I
Sbjct: 455 VDTLRSYSNQTGTRANLCNIARDYRHSMLKELNTLEANKKKLTNQERQLGKLDIIIKASI 514

Query: 656 KFSLAIXXXXXXXXXXXXXXXTKLKRVITGGAVLNPQSGSKKSMLSVLD----NPKTTRK 711
           +  L                   LK  ITGG     +S S+    S+LD    +P+   K
Sbjct: 515 RLVLKTDEIDEQSIATNNKDYMNLKTTITGG-----KSRSQSRPRSMLDVNGYDPRAETK 569

Query: 712 KKSLSATTSGVSGNRVPRSSQIKFASSVKHKDGNNALGNSVVHTKPQIQVHAASEDSSPK 771
           +  L AT     G     SSQI+FA +V  KDG +ALG      KPQ      +   S K
Sbjct: 570 QSELGATLYQSRG-----SSQIRFAGNVNPKDGKSALG---TIKKPQ---SGGASIPSSK 618

Query: 772 LTPIRSYNTGSSNQAGLKTMKSNNSL--RRVXXXXXXXXXXXXXXXXXXXXXGGFMSLFK 829
                SYN    +   L+ +KS   L  R+                      GGF+SLFK
Sbjct: 619 YISDYSYN----DVIPLRKIKSTGGLHPRKSSESTRSTASSKSVGEKTKPKSGGFLSLFK 674

Query: 830 G 830
           G
Sbjct: 675 G 675

>YOR019W (YOR019W) [4832] chr15 (368126..370318) Protein of unknown
           function [2193 bp, 730 aa]
          Length = 730

 Score =  244 bits (623), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 141/438 (32%), Positives = 225/438 (51%), Gaps = 67/438 (15%)

Query: 66  KKQRSVSVRANAK--VRPCVSFNTVPLPSKHTLLDEYEQDFPGVQLFPQEYTMEEYYDDE 123
           + ++++  RA  K   +P V+F+TVP  + ++ +D+  + F GV + P  YTMEE YDDE
Sbjct: 29  RNEQNLKKRAKKKGSFQPSVAFDTVPSTAGYSSIDDSREGFKGVPV-PNYYTMEECYDDE 87

Query: 124 SGYVSEDNQNYMLHNSYITPEIVERLNKNATTRSSSPPPLDREYPSAGKQKKMSSKQQAN 183
           +   S  N  Y L +++ +   +    +N +  SS P           +  K+  K  ++
Sbjct: 88  TDSFSP-NLQYYLRDTFQSSPFLNTRKENKSESSSFP----------MRSSKLLEKN-SD 135

Query: 184 ITKMFKIAKNGRIVREDYPSRPTLVNDAFILNRDLNDWHNTWRSRRHTIEQRKEDLSETF 243
           I K F ++KNG+IVR DYPS P +VN+  ++NR   +W   WR R+  I +R  D  + F
Sbjct: 136 IKKYFLVSKNGKIVRRDYPSTPVIVNETLMINRFEKNWIKLWRQRKLQINERLNDKKKWF 195

Query: 244 EYPQLLFPQQ-TKPSEPVIMMGEDYKPLTXXXXXXXXXXXXXXXSTSGPRVVLCHISGKR 302
            YP+L+F ++  KP    +  G+D  P T                 + P+ ++CHI+GK+
Sbjct: 196 TYPELIFSEERIKP----LYRGDDSAPCTKEQKRKHKILQQKVGYPNNPKTIVCHINGKK 251

Query: 303 HTWVGLDWTIKRLSNDGDHIVVLAHIPRMXXXXXXXXXXXXXXXXXXXXXXXXDVNRKAY 362
           HTWV LDWT+ + + + DHIVV+  +P+M                          NRK  
Sbjct: 252 HTWVALDWTVYKFARNLDHIVVITTLPKMIS------------------------NRKKT 287

Query: 363 NKGDYEASAFSLGQDNNENLNKHEDFVEWASGYSQEDVETTMENIFDYIANILPEER-SV 421
            K D                       EWA GY +E ++  + +IFDYI  ++   + SV
Sbjct: 288 AKDD----------------------TEWAPGYQKEVIDQKLNDIFDYILQLVKVVKISV 325

Query: 422 KITVEVVVGAALHTIIDATNAYQPDLMVASTLRWERTDNLVLWKSNLLIDKLATVFPLPL 481
           KIT+E++VG    +++D  N + PD +V +TL+ ER +NL+ +KS  L D     +P+P 
Sbjct: 326 KITLEIIVGKIKKSLVDVINVHTPDFLVLATLKHERNENLITYKSKKLTDVFPVSYPIPT 385

Query: 482 FVVPARRMFLFEHGLEEE 499
           FVVP++RM+ FE  L+ E
Sbjct: 386 FVVPSKRMYSFELNLQRE 403

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/184 (28%), Positives = 86/184 (46%), Gaps = 35/184 (19%)

Query: 628 LKDLDNNKSISHEEIQIKKVETIINQTIKFSLAIXXXXXXXXXXXXXXXTKLKRVITGGA 687
           L+D + ++  + E++ +KK++ II +++K SLAI                     + G  
Sbjct: 489 LQDDEKDRECTKEKLLLKKIDIIIRESLKSSLAI-------------------ETLPGKN 529

Query: 688 VLNPQSGSKKSMLS---VLDNPKTTRKKKSL--------SATTSGVSGNRVPRSSQIKFA 736
           V     G + S      + +  K T+ +KSL          TT+ +  +  P +SQIKFA
Sbjct: 530 VSQSSHGDQISSFKNALIGNGSKNTKFRKSLIPYSSSEEQNTTTTIKLSSSP-TSQIKFA 588

Query: 737 SSVKHKDGNNALGNSVVHTKPQIQVHAASEDSSPKLTPIRSYNTGSSNQAGLKTMKSNNS 796
           +SVKHKDG  ALG +     P I+ H+ S D      P    ++   N   L+ +KS  +
Sbjct: 589 TSVKHKDGRAALGKA--RNLPDIR-HSISFDKENSFDP-SDKSSSVDNSIPLRKVKSAGA 644

Query: 797 LRRV 800
           LR+V
Sbjct: 645 LRKV 648

>Kwal_47.18246
          Length = 773

 Score =  233 bits (594), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 137/417 (32%), Positives = 215/417 (51%), Gaps = 32/417 (7%)

Query: 81  PCVSFNTVPLPSKHTLLDEYEQDFPGVQLFPQEYTMEEYYDDESGYVSEDNQNYMLHNSY 140
           P VSF+TVPL +  T  +++++          EYT EE+YD+E    S D         +
Sbjct: 49  PGVSFDTVPLLAG-TACEDFDEGHCSDHTL--EYTEEEFYDNE---CSPD---------F 93

Query: 141 ITPEIVERLN-KNATTRSSSPPPLDREYPSAGKQKKMSSKQQANITKM--FKIAKNGRIV 197
           + P   +RL    + +RSSSP          G+     S   + +  +    +  +GRI 
Sbjct: 94  LRPSGNDRLMVPFSHSRSSSPL--------RGQSGTSMSLIDSTMNGLDGIHVGADGRIT 145

Query: 198 REDYPSRPTLVNDAFILNRDLNDWHNTWRSRRHTIEQRKEDLSETFEYPQLLFPQQTKPS 257
           R DYPSRPT+VNDA ++NR   D+   W  R+  I+QR       F +P +LFP +   +
Sbjct: 146 RTDYPSRPTIVNDALVINRTHKDYSALWLKRKEQIDQRLRSREAHFVFPDILFPPEKVAN 205

Query: 258 EPVIMMGEDYKPLTXXXXXXXXXXXXXXXSTSGPRVVLCHISGKRHTWVGLDWTIKRLSN 317
            P   + + Y PL+                 + PR +LC+ISG++HTWV LDW +KR S 
Sbjct: 206 LP---LSDGYTPLSKEERRKALIIGKKIGYPNSPRTILCYISGRKHTWVSLDWLLKRFSQ 262

Query: 318 DGDHIVVLAHIPRMXXXXXXXXXXXXXXXXXXXXXXXXDVNRKAYNKGDYEASAFSLGQD 377
           D DH+V++ ++P+M                          +    +      SA   G D
Sbjct: 263 DVDHLVIITNLPKMSNHRSRSRSRSRSTAPRSRSAAPSTHSSSGVSSIQRTLSADGHG-D 321

Query: 378 NNENLNKHEDFVEWASGYSQEDVETTMENIFDYIANILPEERSVKITVEVVVGAALHTII 437
           +N+++  HE ++EWASGY  + ++ T+ NI  Y+  ILP+ R+VK+TVE+V+G     ++
Sbjct: 322 HNKHV--HEHWLEWASGYDADQIKETLNNILRYVTTILPDHRAVKVTVEIVIGKLQKIVV 379

Query: 438 DATNAYQPDLMVASTLRWERTDNLVLWKSNLLIDKLATVFPLPLFVVPARRMFLFEH 494
           DA N Y PDL+V S+LR +  ++LV WKSN + DK+    P+P+ +VP ++M   E+
Sbjct: 380 DAINVYGPDLIVLSSLRSKPDESLVRWKSNGVNDKICQTLPIPILLVPVKKMLELEN 436

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 88/198 (44%), Gaps = 30/198 (15%)

Query: 614 HLKARSYRLQTAQYLKDLDNNKSISHEEIQIKKVETIINQTIKFSLAIXXXXXXXXXXXX 673
           HL+  + R +    + D+DN+  +S EE  I K+++I N ++ F                
Sbjct: 521 HLE--TCRREIKAKMLDIDNDTRLSSEEKIILKLDSITNASLHF-----INELDDKGRST 573

Query: 674 XXXTKLKRVITGGAVLNPQSGSKKSMLSVLDNPKTTRKKKSLSATTSGVSGNRVP----- 728
               +LKRVITG    +    +KKSML V  N       KS + T++    ++VP     
Sbjct: 574 ESFEELKRVITGDTNRDTVR-AKKSMLDV-GNSSMLDVGKSSNQTSNKQGNSQVPTIFFD 631

Query: 729 --------RSSQIKFASSVKHKDGNNALGNSVVHTKPQIQVHAASEDSSPKLTPIRSYNT 780
                   +SSQIKFASSVK  DG         HT+ +    + S D S  L P  S  T
Sbjct: 632 EDSISPVKKSSQIKFASSVKRNDGKEG------HTESKPIERSISYDLS--LRPESSQGT 683

Query: 781 GSSNQAGLKTMKSNNSLR 798
            +S    L+ ++S   ++
Sbjct: 684 NNSRNMDLRKVRSATGIK 701

>AEL233C [2273] [Homologous to ScYOR019W - SH; ScYDR475C - SH]
           (193752..196133) [2382 bp, 793 aa]
          Length = 793

 Score =  216 bits (551), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 132/428 (30%), Positives = 219/428 (51%), Gaps = 51/428 (11%)

Query: 81  PCVSFNTVPLPS------KHTLLDEYEQDFPGVQLFPQEYTMEEYYDDESGYVSEDNQNY 134
           P +SF+TVP+        +   L E+++ + G  L   +YT+EEYY++E    + D ++ 
Sbjct: 73  PTISFDTVPIQGISPEEDEQDALHEHQRAY-GTSL---DYTLEEYYNNEDTSYNHDYRSG 128

Query: 135 MLHNSYITPEIVERLNKNATTRSSSPPPLDREYPSAGKQKKMSSKQQANITKMFKIAKNG 194
             +   ++P            RS SP      Y S  +  K            F +  +G
Sbjct: 129 GGYAGELSP-----------LRSLSP----SRYGSGAQLAK------------FDVLPDG 161

Query: 195 RIVREDYPSRPTLVNDAFILNRDLNDWHNTWRSRRHTIEQRK-EDLSETFEYPQLLFPQQ 253
           R VR DYPS+ TL++D+F+LN+   +W + W++R+  IE+RK E+    + YP +LFP+ 
Sbjct: 162 RRVRIDYPSKSTLLSDSFVLNKTHREWRSKWKARKAQIERRKLEEPQRWYRYPSILFPET 221

Query: 254 TKPSEPVIMMGEDYKPLTXXXXXXXXXXXXXXXSTSG----PRVVLCHISGKRHTWVGLD 309
                 + M+ ++                    +  G    PR+VLCH+SG++HTW  +D
Sbjct: 222 KVDLSDLPMINDEGVAYNSNQRANMKRIARVVRTPVGFPVSPRIVLCHVSGRKHTWAAVD 281

Query: 310 WTIKRLSNDGDHIVVLAHIPRMXXXXXXXXXXXXXXXXXXXXXXXXDVNRKAYNKGDYEA 369
           W ++    D DH+VV+A++PR+                                 G    
Sbjct: 282 WVLQNFIADSDHLVVVANLPRLMSRFGYMSRSVSRSRSRSRSRSVRRTT------GLNST 335

Query: 370 SAFSLGQDNNENLNKHEDFVEWASGYSQEDVETTMENIFDYIANILPEERSVKITVEVVV 429
           S+F  G D +E++ K++D  EW +GY+   +ET ++++ +YI  I+PE+ ++K+TVEV++
Sbjct: 336 SSF--GSDVSESMTKNKD-EEWCNGYTVGSIETILDHLIEYITFIIPEKLAIKVTVEVMI 392

Query: 430 GAALHTIIDATNAYQPDLMVASTLRWERTDNLVLWKSNLLIDKLATVFPLPLFVVPARRM 489
           G     +I+A N + PDL+VAST +++  D L+  +S  L   LA  +PLP+FVVPA+RM
Sbjct: 393 GKTRQVLIEALNLHCPDLLVASTTKYKENDGLLDHRSKRLTTVLANYYPLPVFVVPAKRM 452

Query: 490 FLFEHGLE 497
           FL    LE
Sbjct: 453 FLLGMQLE 460

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 92/184 (50%), Gaps = 26/184 (14%)

Query: 619 SYRLQTAQYLKDLDNNKSISHEEIQIKKVETIINQTIKFSLAIXXXXXXXXXXXXXXXTK 678
           +YR +  +    +D++ ++  +E    K++ +IN ++KF+  +                +
Sbjct: 557 TYRRRVQKRFSKIDSDSTLQADERHFNKLDAVINASLKFNKEL-------ENSKSPSILE 609

Query: 679 LKRVITGGAVLNPQSG-SKKSMLSVLDNPKTTRKKKSLSATTSGVSGNRVP-RSSQIKFA 736
           L+R+ITGG      +G  KKSML VLD P    +K+      +  +G+  P R+++IKF 
Sbjct: 610 LQRIITGG---EKHTGFRKKSMLDVLDLPSAKPRKQDPIPKPNLSAGDPTPRRTTRIKFE 666

Query: 737 SSVKHKDGNNALGNSVVHTKPQIQVHAASEDSSPKLTPIRSYNTGSSNQAGLKTMKSNNS 796
           ++VK  DG+ A+  S             S++   +++P+R     S +Q+ L    SNNS
Sbjct: 667 ATVKDVDGSTAVQQS------------PSDEVLREMSPLRQVQ--SLSQSNLMKYVSNNS 712

Query: 797 LRRV 800
           LR+V
Sbjct: 713 LRKV 716

>KLLA0F02684g 242962..245301 some similarities with sgd|S0005545
           Saccharomyces cerevisiae YOR019w, hypothetical start
          Length = 779

 Score =  160 bits (404), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 120/440 (27%), Positives = 204/440 (46%), Gaps = 53/440 (12%)

Query: 75  ANAKVRPCVSFNTVPLPSKHTLLDEYEQDFPGVQLFPQEYTMEEYYDDESGYVSEDNQNY 134
           A  K+ P VS++TVP+         Y+ D   +     +Y ++ +YD      S+D+ + 
Sbjct: 50  AGEKLVPTVSWDTVPIEGVSNEESGYDSDPHNL-----DYALDRFYD------SDDSHDD 98

Query: 135 MLHNSY-------ITPEIVERLNKNATTRSSSP--PPLDREYPSAGKQKKMSSKQQANIT 185
           + H          ITP + +R+      R SSP  P  + ++       ++     +N  
Sbjct: 99  IRHGRGSSRTHLGITPTLTDRV------RGSSPMRPRQNNDFTF-----QLDVGGSSNNP 147

Query: 186 KMFKIAKNGRIVREDYPSRPTLVNDAFILNRDLNDWHNTWRSRRHTIEQRKE-DLSETFE 244
           K+F    NG I R DYPSRP L N+A I  +   DW + WR R   +E+RKE  +S  F+
Sbjct: 148 KIF-FGPNGEIRRRDYPSRPVLFNNALIRTQYHKDWKHEWRQRVEKMEERKETGVSTYFK 206

Query: 245 YPQLLFPQQTKPSEPVIMMGEDYKPLTXXXXXXXXXXXXXXXSTSG----PRVVLCHISG 300
           +P++LFP+         ++ ++ + +                +  G    PR +L HISG
Sbjct: 207 FPEILFPKVKVDLTDAPLVNDNGEMIQKERRASIKRHLKVVRTPVGLVKTPRTILVHISG 266

Query: 301 KRHTWVGLDWTIKRLSNDGDHIVVLAHIPRMXXXXXXXXXXXXXXXXXXXXXXXXDVNRK 360
           + HTWV LDW +  L+ D D+IV++A+IPR                             +
Sbjct: 267 REHTWVALDWAMAELAEDIDYIVIIANIPRRDWSTRSGSYTRSRSASRSRS--------R 318

Query: 361 AYNKGDYEASAFSLGQDNNENLNKHEDFVEWASGYSQEDVETTMENIFDYIANILPEERS 420
           + ++    +     G D++      +    W  G +  +V   ++ + +Y + ++   + 
Sbjct: 319 SRSRMRSVSRTREFGTDDD------QPDATWCDGCTVGEVNDLLQRLIEY-STLIMGGKK 371

Query: 421 VKITVEVVVGAALHTIIDATNAYQPDLMV-ASTLRWERTDNLVLWKSNLLIDKLATVFPL 479
           +KITVE+V+G+    +ID+ NAY PD  V  S++    + ++V+ KS  L   L   FP+
Sbjct: 372 LKITVEIVIGSTSQILIDSLNAYAPDFFVIGSSIDKYGSGSVVVHKSRHLAPVLMQYFPI 431

Query: 480 PLFVVPARRMFLFEHGLEEE 499
           P+F V ARRM  FE  L+ +
Sbjct: 432 PVFFVAARRMGWFEKKLQRD 451

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 85/209 (40%), Gaps = 40/209 (19%)

Query: 619 SYRLQTAQYLKDLDNNKSISHEEIQIKKVETIINQTIKFSLAIXXXXXXXXXXXXXXXTK 678
           +YR    + LK LD +  +   E    K+++IIN T+ F+  +                +
Sbjct: 517 NYRCLVDKKLKLLDEDTGLPTPEQYYGKMDSIINATLNFNKELETWGDSADM------AE 570

Query: 679 LKRVITGGAVLNPQSGSKKSMLSVLDNPKTTRKK---------KSLSATTSGVSGNRVPR 729
           +KR ITGG  + P+   KKSML   D P   + K         +++    +     ++P+
Sbjct: 571 IKRSITGG--VRPRVMKKKSMLDFSDLPPKRKSKIPTEHENSKETMDFNQNTFKNKKLPK 628

Query: 730 -------------------SSQIKFASSVKHKDGNNALGNSVVHTKPQIQVHAA--SEDS 768
                                 IKFA+SVK KDG  A+   +    P  Q       EDS
Sbjct: 629 VVLSSPPPSRPVSPLANNGEGGIKFANSVKSKDGKGAI-QRIKSYDPYSQNSDPFDREDS 687

Query: 769 SPKLTPIRSYNTGSSNQAGLKTMKSNNSL 797
           +  L+ +RS+    S+   L+ + S  SL
Sbjct: 688 ALSLSVVRSHQP-KSDSTSLRKVLSTTSL 715

>CAGL0H08261g 810168..812372 weakly similar to tr|Q99248
           Saccharomyces cerevisiae YOR019w, hypothetical start
          Length = 734

 Score =  134 bits (337), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 79/259 (30%), Positives = 128/259 (49%), Gaps = 25/259 (9%)

Query: 79  VRPCVSFNTVPLPSKHTLLDEYEQDFPGVQLFPQEYTMEEYYDDESGYVSED---NQNYM 135
           +RP VS++TVP    ++ +++ +  FPGV++      ++     +   +      N  ++
Sbjct: 34  IRPSVSYDTVPKYIGYSAIEDMDGGFPGVEVTKHTVPVKTDLSRKGATLGSQVFLNPRFL 93

Query: 136 LHNSYITPEI--VERLNKNATTRSSSPPPLDREYPSAGKQKKMSSKQQANITKMFKIAKN 193
           LHN     +   +ER+ K    R     PL     S  + KK           +F    +
Sbjct: 94  LHNHVSGDDDYEIERMKK----RIFDASPLANNPLSLTRSKK----------SVFNYTAD 139

Query: 194 GRIVREDYPSRPTLVNDAFILNRDLNDWHNTWRSRRHTIEQRKEDLSETFEYPQLLFPQ- 252
           G+I+R DYP++P  VN   I +R    W   W  R+  IE   E   E F YP +LFP+ 
Sbjct: 140 GKIIRSDYPTKPVFVNKIIIRSRTNVHWDERWAQRKSKIEYNMEHKDEKFMYPDILFPEV 199

Query: 253 QTKPSEPVIMMGEDYKPLTXXXXXXXXXXXXXXXSTSGPRVVLCHISGKRHTWVGLDWTI 312
           + KP    ++MG+D+ P+T                 + PR V+C+ISG+RHTW GLDW +
Sbjct: 200 KEKP----LIMGDDFVPITKEQRRRNKILTIKQAHPTLPRTVVCYISGRRHTWAGLDWAV 255

Query: 313 KRLSNDGDHIVVLAHIPRM 331
           + L+ + DH+V++A IP+M
Sbjct: 256 RSLA-ENDHLVIVATIPKM 273

 Score =  134 bits (337), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 119/414 (28%), Positives = 186/414 (44%), Gaps = 53/414 (12%)

Query: 391 WASGYSQEDVETTMENIFDYIANILPEERSVKITVEVVVGAALHTIIDATNAYQPDLMVA 450
           W SGY+ ++++T + ++F+YI  I P  +++K+T+E+ +      +IDA N Y PD ++ 
Sbjct: 287 WVSGYTFDEIDTIISDLFEYIKVIKPVHKALKVTIEISIERTKGALIDAINVYSPDFLIL 346

Query: 451 STLRWERTDNLVLWKSNLLIDKLATVFPLPLFVVPARRMFLFEHGLEEESKQIEISLXXX 510
            TL+W+R +NLV ++ N ++DKL T FP+P F+VPARR+F+ E  +EEE+    I     
Sbjct: 347 GTLKWQRYENLVSYRGNNMVDKLCTTFPIPTFIVPARRLFMLEKEIEEETLTKLI----- 401

Query: 511 XXXXXXXXXVTGDIVESEADKKIVPPKRIGTIGPPERRLVGADSFTAGFNMKRPSLGTSV 570
                           S+  KK V P+      P   +LV  DSF      ++  L  S 
Sbjct: 402 ----------------SDNTKKAVTPENEEIEYPRSPKLVSTDSFGFWSKNEQKLLDESY 445

Query: 571 SAPIAENV--FEEESGSETXXXXXXXXXXXXXXXXXXKL-----TVREKLHLKARSYRLQ 623
           S    + +   +E   S T                   L     ++  KL   A + R  
Sbjct: 446 SISTKDKLEKRQESFTSLTTHESEDSLAIEDDDDRDSNLLESTESIVSKLKSIAITNRKN 505

Query: 624 TAQYLKDLDNNKS-ISHEEIQIKKVETIINQTIKFSLAIXXXXXXXXXXXXXXXTKLKRV 682
               L++ DN  S I+ +E Q+ KV  II  ++  S  I                 L++V
Sbjct: 506 MMADLEEFDNEHSNINTKENQLAKVSLIIKHSLNSSNTIKNLTQNLDEENRGFAV-LQKV 564

Query: 683 ITGGAVLNPQSGSKKSMLSVLDNPKTTRKKKSLSATTSGVSGNRVPRSSQIKFASSVKHK 742
           ITG   +  +S  K SM+  +           ++    G S  +  R SQIKFAS+VK  
Sbjct: 565 ITGTGTV--ESRPKFSMVDAV----------RVNGKIPGESSAK-KRRSQIKFASNVKPT 611

Query: 743 DGNNALGNSVVHTKPQIQVHAASEDSSPKLTPIRSYNTGSSNQAGLKTMKSNNS 796
           DG   LG       P+I         S   +P+R+ +   SN++ L T  SN S
Sbjct: 612 DGTAGLGT------PRIVGPTGESQYSGGTSPLRTVD---SNESAL-TFASNGS 655

>Scas_595.13
          Length = 766

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 98/223 (43%), Gaps = 34/223 (15%)

Query: 292 RVVLCHISGKRHTWVGLDWTIKRLSNDGDHIVVLAHIPR---MXXXXXXXXXXXXXXXXX 348
           R V C+ISG+R TW  +DW I+ ++ DGDH++++  IP    +                 
Sbjct: 337 RTVSCYISGRRFTWATVDWYIENIAKDGDHVIIMTCIPEFETLVEKANYQAFRDRLNSDG 396

Query: 349 XXXXXXXDVNRKAYNKGDYEASAFSLGQDNNENLNKHEDFVEWASGYSQEDVETTMENIF 408
                       ++NK  YE+         +E L     ++E       ++  T    I 
Sbjct: 397 TSPSISRSSKDSSFNKDGYESKI-------SEGL-----YIEAI----YQEARTKCRQIL 440

Query: 409 DYIANILPEERSVKITVEVVVGAALHTIIDATNA-YQPDLMVASTLRWE-----RTDNLV 462
           +Y A  L E + VKIT+E+V   +    ++A  A Y+P+L + ST+        R  N+ 
Sbjct: 441 NYYAKRL-ENKKVKITIEMVKDNSSKRAVNAIEALYRPNLQLFSTVSTNIQIKFRNGNV- 498

Query: 463 LWKSNLLIDKLATVFPLPLFVVPARRMFLFEHGLEEESKQIEI 505
             K    I K    F +P+F+VP    FL  + L + S++ E+
Sbjct: 499 --KFPFFIMKH---FFIPVFIVPFE--FLNPNLLMDPSEKYEL 534

>YGR237C (YGR237C) [2185] chr7 complement(963302..965659) Protein of
           unknown function, has weak similarity to uncharacterized
           C. albicans Orf6.794p [2358 bp, 785 aa]
          Length = 785

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 87/201 (43%), Gaps = 27/201 (13%)

Query: 292 RVVLCHISGKRHTWVGLDWTIKRLSNDGDHIVVLAHIPRMXXXXXXXXXXXXXXXXXXXX 351
           RVV C+ISG+R+TW  +DW ++ L+ +GDH+V++  IP                      
Sbjct: 337 RVVSCYISGRRYTWSSVDWYVENLTRNGDHLVIITTIPEFEAKIDTLAYKEKRRHR---- 392

Query: 352 XXXXDVNRKAYNKGD--YEASAFSLGQDNNENLNKHEDFVEWASGYSQE----DVETTME 405
                + R   N  +    AS   +G D +  L         ++G   E    + + T  
Sbjct: 393 -----LERMTSNTSESMTTASHSLIGPDLSSPL---------STGIRIEAIHNEAKQTCS 438

Query: 406 NIFDYIANILPEERSVKITVEVVV-GAALHTIIDATNAYQPDLMVASTLRWERTDNLVLW 464
           +I +Y A  L   + V+I++E+V   +    II AT+ Y+P L V ST+           
Sbjct: 439 DILNYYARRL-ATKIVRISIEMVKENSTRSAIISATSLYRPSLQVISTVSANIQIKFRNG 497

Query: 465 KSNLLIDKLATVFPLPLFVVP 485
           K  L    L   F +P FVVP
Sbjct: 498 KVKLPF-FLMKHFAMPAFVVP 517

>CAGL0F07975g complement(782229..784541) similar to sp|P50089
           Saccharomyces cerevisiae YGR237c, start by similarity
          Length = 770

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 91/202 (45%), Gaps = 22/202 (10%)

Query: 292 RVVLCHISGKRHTWVGLDWTIKRLSNDGDHIVVLAHIPRMXXXXXXXXXXXXXXXXXXXX 351
           R ++C+ISG+R+TW  +DW I+ ++ DGDH+V+++ +P                      
Sbjct: 316 RTIMCYISGRRYTWSSVDWYIENVAADGDHLVIVSRVPEFEKELETLCNQEKRKSK---- 371

Query: 352 XXXXDVNRKAYNKGDYEASAFSLGQDNNENLNKHEDFVEWAS-GYSQEDVET----TMEN 406
                + ++  ++ D   S +S     +   +   D V  ++ G+  E +          
Sbjct: 372 -----LQQRNSDRSD-RISVYSESHTLSSTPSSDPDAVTPSTIGFRAEAIRDRAREVCRE 425

Query: 407 IFDYIANILPEERSVKITVEVVVG-AALHTIIDATNAYQPDLMVASTLRWERTDNLVLWK 465
           + DY A  L +++  KITVE+V   +    I  A   Y P+  + ST+    T+  + ++
Sbjct: 426 LLDYYAYRL-KDKITKITVEIVKSDSTKDAITGAAGVYAPNFQIISTV---STNTQIKFR 481

Query: 466 SNLLIDKLATV--FPLPLFVVP 485
           +  +      +  +P+P F++P
Sbjct: 482 NGNVKLPFFVLKHYPMPTFLIP 503

>Kwal_14.1028
          Length = 680

 Score = 59.3 bits (142), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 84/198 (42%), Gaps = 29/198 (14%)

Query: 292 RVVLCHISGKRHTWVGLDWTIKRLSNDGDHIVVLAHIPRMXXXXXXXXXXXXXXXXXXXX 351
           R ++C ISG++HTW  +DW +K L+ DGD++++   IP                      
Sbjct: 308 RTIICSISGRKHTWSAVDWYVKNLARDGDYLIIATRIPVFEESVKRTPAPQTHLTE---- 363

Query: 352 XXXXDVNRKAYNKGDYEASAFSLGQDNNENLNKHEDFVEWASGYSQEDVETTMENIFDYI 411
                 N    NK        S  Q+   ++ +    V+     +++     +    D +
Sbjct: 364 ------NYDPRNKNQ------SRSQERKSSITEQGLLVQDIDILARQKCNDILNYYLDKL 411

Query: 412 ANILPEERSVKITVEVVV-GAALHTIIDATNAYQPDLMVASTLRWERTDNLVLWKSN--- 467
           ++     + VK+TVE++   + +  +  A   Y+PDL + ST+    + NL +   N   
Sbjct: 412 SH-----KCVKVTVEIIKDNSTVFALTSAIALYKPDLKIVSTV----STNLHIKFKNGHV 462

Query: 468 LLIDKLATVFPLPLFVVP 485
            L + L   F +P +VVP
Sbjct: 463 KLPNFLMRHFWVPTYVVP 480

>KLLA0E15642g 1393066..1395366 weakly similar to sp|P50089
           Saccharomyces cerevisiae YGR237c singleton, start by
           similarity
          Length = 766

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 28/38 (73%)

Query: 292 RVVLCHISGKRHTWVGLDWTIKRLSNDGDHIVVLAHIP 329
           R V+C ++G+RHTW  +DW IK  + DGDH+VV  ++P
Sbjct: 328 RTVVCFLNGRRHTWATVDWFIKEAARDGDHLVVATNLP 365

>ADL147W [1594] [Homologous to ScYGR237C - SH]
           complement(431887..433767) [1881 bp, 626 aa]
          Length = 626

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 27/39 (69%)

Query: 291 PRVVLCHISGKRHTWVGLDWTIKRLSNDGDHIVVLAHIP 329
           PR V C++SG+RH+W  +D  I   +  GDH+V+ A++P
Sbjct: 245 PRTVACYLSGRRHSWSAVDAYINMFARSGDHLVIWAYLP 283

>AFR071W [3263] [Homologous to ScYKR031C (SPO14) - SH]
           complement(547832..552565) [4734 bp, 1577 aa]
          Length = 1577

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 58/130 (44%), Gaps = 20/130 (15%)

Query: 682 VITGGAVLNPQSGSKKS-----MLSVLDNPKTTRK-----KKSLSATTSGVSGNRVPRSS 731
           +  G   L  + G +++     MLSV  +P T        ++  SATTS  + + V    
Sbjct: 195 LFAGSGFLRDEHGVRRAPLLLAMLSVRVSPVTNSDTLLSLQRVSSATTSTTNASSV---- 250

Query: 732 QIKFASSVKHKDGNNALGNSVVHTKPQIQVHAASEDSSPKLTPIRSYNTGSSNQAGLKTM 791
                S V+ +DG  A+ +   HTK ++++     D+  K   +RSY   +S    LK +
Sbjct: 251 -----SHVEKQDGGIAIVDQGYHTKYKLELEYGVGDNRLKWIILRSYKDLASLHGKLKLV 305

Query: 792 K-SNNSLRRV 800
               N+L ++
Sbjct: 306 SFQQNTLNKL 315

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.129    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 24,525,674
Number of extensions: 1000260
Number of successful extensions: 2752
Number of sequences better than 10.0: 41
Number of HSP's gapped: 2806
Number of HSP's successfully gapped: 54
Length of query: 838
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 728
Effective length of database: 12,788,129
Effective search space: 9309757912
Effective search space used: 9309757912
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 66 (30.0 bits)