Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M08712g76375137100.0
YDR264C (AKR1)76474321200.0
Scas_538.875257515060.0
KLLA0E16764g75269414860.0
AER388C72474814710.0
YOR034C (AKR2)74969712061e-155
Kwal_55.199873433228591e-109
Scas_699.365112583543e-35
CAGL0L06622g11372001616e-11
KLLA0E15796g2302131492e-10
KLLA0F03619g9602661562e-10
Scas_595.911481351517e-10
YIL112W (HOS4)1083981501e-09
Kwal_23.491410431061501e-09
CAGL0C01309g1110981472e-09
Scas_595.82352021342e-08
Scas_671.301054981392e-08
ADL244W10891021365e-08
AGL125C3671641311e-07
YGR232W (NAS6)2281431243e-07
Kwal_27.127502332091182e-06
Scas_716.483271911192e-06
ADL143W11021271194e-06
YNL326C3361841157e-06
Sklu_2319.53331701159e-06
Scas_679.73741081113e-05
Kwal_23.33023531501095e-05
KLLA0D18370g3551131051e-04
CAGL0L06600g2311591022e-04
ADL142C2291611022e-04
Scas_415.14521701042e-04
YKL020C (SPT23)1082731053e-04
CAGL0E02497g3761081033e-04
KLLA0E18029g11511471043e-04
CAGL0F06831g1092721043e-04
Kwal_55.22126360621023e-04
YPL110C12232001034e-04
YIR033W (MGA2)1113621025e-04
YLR246W (ERF2)3591021015e-04
CAGL0G08217g326771005e-04
Kwal_27.1275110931071016e-04
CAGL0D02508g332153997e-04
ADL197C39050997e-04
Scas_700.131133701017e-04
KLLA0E02068g32574998e-04
ACR165W1139821008e-04
YOL003C37854999e-04
CAGL0B01991g330102989e-04
CAGL0H00935g19363950.001
Sklu_1541.237960980.001
CAGL0J07040g1245171990.001
Scas_392.2376151970.001
Scas_628.4105779980.002
ADR151W420160960.002
Scas_693.32329136940.003
Kwal_47.1836635690940.003
ACL003C37571940.003
YDR126W (SWF1)336179930.004
Sklu_2202.81367155930.005
Kwal_14.8891094121930.006
YGR233C (PHO81)1178218930.006
CAGL0K06347g35239910.007
KLLA0E15774g1148197920.007
KLLA0C09108g20884880.009
Kwal_56.2245938352890.014
KLLA0C06204g37798880.016
KLLA0F26004g336125880.017
Sklu_2436.436437870.024
Scas_649.8373178870.024
YDR459C37465850.037
CAGL0F06655g40888850.042
KLLA0D06149g34946840.049
AGR223W132167840.072
CAGL0D01012g802183830.093
AGR065W32661810.10
YPL239W (YAR1)20061780.16
AFR600C815163810.16
Sklu_2055.3743160800.17
Scas_717.6237438800.17
ABR203W35955790.20
YMR068W (AVO2)426170780.27
Scas_713.9120840780.36
YDL056W (MBP1)833153770.41
Scas_683.37820161760.52
Sklu_2237.519860730.68
YLR182W (SWI6)80344750.74
KLLA0F00660g137470750.83
Scas_587.475160740.93
CAGL0B01166g80844741.0
Kwal_14.982416196721.5
KLLA0E05357g75443721.8
KLLA0D08910g20663701.9
YER111C (SWI4)109340712.0
Scas_685.12113162712.6
KLLA0F19690g32456702.6
CAGL0G05786g21197683.0
CAGL0C03003g20667673.5
Scas_458.319823673.7
Scas_510.2104332694.2
CAGL0A04565g104140684.6
Kwal_26.9359742174676.1
YGR216C (GPI1)60985676.7
Scas_578.1163161659.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M08712g
         (751 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M08712g 866454..868745 similar to sp|P39010 Saccharomyces c...  1433   0.0  
YDR264C (AKR1) [1097] chr4 complement(996021..998315) Protein wi...   821   0.0  
Scas_538.8                                                            584   0.0  
KLLA0E16764g 1484752..1487010 gi|28565052|gb|AAO32609.1 Kluyvero...   577   0.0  
AER388C [2888] [Homologous to ScYDR264C (AKR1) - SH; ScYOR034C (...   571   0.0  
YOR034C (AKR2) [4846] chr15 complement(394836..397085) Protein i...   469   e-155
Kwal_55.19987                                                         335   e-109
Scas_699.36                                                           140   3e-35
CAGL0L06622g complement(743602..747015) similar to sp|P17442 Sac...    67   6e-11
KLLA0E15796g complement(1406502..1407194) similar to sp|P50086 S...    62   2e-10
KLLA0F03619g 342770..345652 weakly similar to sp|P40480 Saccharo...    65   2e-10
Scas_595.9                                                             63   7e-10
YIL112W (HOS4) [2564] chr9 (151592..154843) Component of Set3p c...    62   1e-09
Kwal_23.4914                                                           62   1e-09
CAGL0C01309g 136270..139602 similar to sp|P40480 Saccharomyces c...    61   2e-09
Scas_595.8                                                             56   2e-08
Scas_671.30                                                            58   2e-08
ADL244W [1497] [Homologous to ScYIL112W - SH] complement(273379....    57   5e-08
AGL125C [4187] [Homologous to ScYLR246W (ERF2) - SH] (473496..47...    55   1e-07
YGR232W (NAS6) [2180] chr7 (953961..954647) Protein interacting ...    52   3e-07
Kwal_27.12750                                                          50   2e-06
Scas_716.48                                                            50   2e-06
ADL143W [1598] [Homologous to ScYGR233C (PHO81) - SH] complement...    50   4e-06
YNL326C (YNL326C) [4289] chr14 complement(27336..28346) Protein ...    49   7e-06
Sklu_2319.5 YNL326C, Contig c2319 9193-10194                           49   9e-06
Scas_679.7                                                             47   3e-05
Kwal_23.3302                                                           47   5e-05
KLLA0D18370g complement(1549382..1550449) similar to sgd|S000423...    45   1e-04
CAGL0L06600g 742803..743498 similar to sp|P50086 Saccharomyces c...    44   2e-04
ADL142C [1599] [Homologous to ScYGR232W (NAS6) - SH] (443625..44...    44   2e-04
Scas_415.1                                                             45   2e-04
YKL020C (SPT23) [3235] chr11 complement(398475..401723) Transcri...    45   3e-04
CAGL0E02497g complement(241118..242248) similar to tr|Q12006 Sac...    44   3e-04
KLLA0E18029g complement(1600015..1603470) weakly similar to sp|P...    45   3e-04
CAGL0F06831g 668173..671451 similar to sp|P40578 Saccharomyces c...    45   3e-04
Kwal_55.22126                                                          44   3e-04
YPL110C (YPL110C) [5334] chr16 complement(341067..344738) Member...    44   4e-04
YIR033W (MGA2) [2697] chr9 (416121..419462) Transcription factor...    44   5e-04
YLR246W (ERF2) [3642] chr12 (627120..628199) Protein that, in a ...    44   5e-04
CAGL0G08217g complement(778823..779803) similar to tr|Q06551 Sac...    43   5e-04
Kwal_27.12751                                                          44   6e-04
CAGL0D02508g 256760..257758 similar to sp|P42836 Saccharomyces c...    43   7e-04
ADL197C [1544] [Homologous to ScYNL326C - SH] (350993..352165) [...    43   7e-04
Scas_700.13                                                            44   7e-04
KLLA0E02068g complement(195185..196162) weakly similar to sp|P42...    43   8e-04
ACR165W [1212] [Homologous to ScYKL020C (SPT23) - SH; ScYIR033W ...    43   8e-04
YOL003C (YOL003C) [4813] chr15 complement(321858..322994) Nuclea...    43   9e-04
CAGL0B01991g 182894..183886 similar to sp|Q04629 Saccharomyces c...    42   9e-04
CAGL0H00935g 91979..92560 highly similar to sp|P46683 Saccharomy...    41   0.001
Sklu_1541.2 YOL003C, Contig c1541 950-2089 reverse complement          42   0.001
CAGL0J07040g 675389..679126 similar to tr|Q02979 Saccharomyces c...    43   0.001
Scas_392.2                                                             42   0.001
Scas_628.4                                                             42   0.002
ADR151W [1892] [Homologous to ScYMR068W - SH] complement(971060....    42   0.002
Scas_693.32                                                            41   0.003
Kwal_47.18366                                                          41   0.003
ACL003C [1046] [Homologous to ScYOL003C - SH] (352024..353151) [...    41   0.003
YDR126W (SWF1) [973] chr4 (703228..704238) Protein involved in v...    40   0.004
Sklu_2202.8 YPL110C, Contig c2202 8829-12932                           40   0.005
Kwal_14.889                                                            40   0.006
YGR233C (PHO81) [2181] chr7 complement(954675..958211) Cyclin-de...    40   0.006
CAGL0K06347g complement(623217..624275) similar to tr|Q03289 Sac...    40   0.007
KLLA0E15774g 1402940..1406386 similar to sp|P17442 Saccharomyces...    40   0.007
KLLA0C09108g complement(795433..796059) similar to sp|P25631 Sac...    39   0.009
Kwal_56.22459                                                          39   0.014
KLLA0C06204g complement(548912..550045) similar to sgd|S0005363 ...    39   0.016
KLLA0F26004g complement(2411261..2412271) some similarities with...    39   0.017
Sklu_2436.4 YDR459C, Contig c2436 10516-11610 reverse complement       38   0.024
Scas_649.8                                                             38   0.024
YDR459C (YDR459C) [1277] chr4 complement(1382307..1383431) Prote...    37   0.037
CAGL0F06655g 654908..656134 similar to sp|Q04749 Saccharomyces c...    37   0.042
KLLA0D06149g 527705..528754 similar to sgd|S0002867 Saccharomyce...    37   0.049
AGR223W [4534] [Homologous to ScYPL110C - SH] complement(1167870...    37   0.072
CAGL0D01012g 118878..121286 similar to sp|P39678 Saccharomyces c...    37   0.093
AGR065W [4375] [Homologous to ScYDR126W (PSL10) - SH] complement...    36   0.10 
YPL239W (YAR1) [5211] chr16 (99484..100086) Protein with 2 ankyr...    35   0.16 
AFR600C [3792] [Homologous to ScYDL056W (MBP1) - SH] (1517341..1...    36   0.16 
Sklu_2055.3 YDL056W, Contig c2055 5141-7372                            35   0.17 
Scas_717.62                                                            35   0.17 
ABR203W [797] [Homologous to ScYDR459C - SH] complement(782702.....    35   0.20 
YMR068W (AVO2) [4027] chr13 (406303..407583) Component of the TO...    35   0.27 
Scas_713.9                                                             35   0.36 
YDL056W (MBP1) [809] chr4 (352877..355378) Transcription factor ...    34   0.41 
Scas_683.37                                                            34   0.52 
Sklu_2237.5 YPL239W, Contig c2237 9761-10357                           33   0.68 
YLR182W (SWI6) [3586] chr12 (517942..520353) Transcription facto...    33   0.74 
KLLA0F00660g 54232..58356 similar to sgd|S0006031 Saccharomyces ...    33   0.83 
Scas_587.4                                                             33   0.93 
CAGL0B01166g 103561..105987 similar to sp|P09959 Saccharomyces c...    33   1.0  
Kwal_14.982                                                            32   1.5  
KLLA0E05357g 485919..488183 gi|729994|sp|P39679|MBP1_KLULA Kluyv...    32   1.8  
KLLA0D08910g 750828..751448 similar to sp|P46683 Saccharomyces c...    32   1.9  
YER111C (SWI4) [1542] chr5 complement(382591..385872) Transcript...    32   2.0  
Scas_685.12                                                            32   2.6  
KLLA0F19690g 1820355..1821329 weakly similar to sp|Q04629 Saccha...    32   2.6  
CAGL0G05786g 557656..558291 similar to sp|Q02774 Saccharomyces c...    31   3.0  
CAGL0C03003g 297244..297864 similar to sp|P25631 Saccharomyces c...    30   3.5  
Scas_458.3                                                             30   3.7  
Scas_510.2                                                             31   4.2  
CAGL0A04565g 445883..449008 similar to sp|P25302 Saccharomyces c...    31   4.6  
Kwal_26.9359                                                           30   6.1  
YGR216C (GPI1) [2166] chr7 complement(922636..924465) Protein in...    30   6.7  
Scas_578.11                                                            30   9.9  

>CAGL0M08712g 866454..868745 similar to sp|P39010 Saccharomyces
           cerevisiae YDR264c ankyrin repeat-containing protein,
           hypothetical start
          Length = 763

 Score = 1433 bits (3710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 709/751 (94%), Positives = 709/751 (94%)

Query: 1   MEDNSEQASVSSQASMRPLVSDNGDREAGAGVEVNIANDNDTSXXXXXXXXXXXXXPILS 60
           MEDNSEQASVSSQASMRPLVSDNGDREAGAGVEVNIANDNDTS             PILS
Sbjct: 1   MEDNSEQASVSSQASMRPLVSDNGDREAGAGVEVNIANDNDTSVGVDGENGNEDDDPILS 60

Query: 61  KYHNACQRGDLEVVREMIHGGQVNVSSDADREGVTGLHWAAINNRLNVVDFLVREGANVE 120
           KYHNACQRGDLEVVREMIHGGQVNVSSDADREGVTGLHWAAINNRLNVVDFLVREGANVE
Sbjct: 61  KYHNACQRGDLEVVREMIHGGQVNVSSDADREGVTGLHWAAINNRLNVVDFLVREGANVE 120

Query: 121 SKAGALEATPLHWAARYGFVYVVDYLLQHGASATTTDKQGFNLLHLSVNSSNIMLVVYVL 180
           SKAGALEATPLHWAARYGFVYVVDYLLQHGASATTTDKQGFNLLHLSVNSSNIMLVVYVL
Sbjct: 121 SKAGALEATPLHWAARYGFVYVVDYLLQHGASATTTDKQGFNLLHLSVNSSNIMLVVYVL 180

Query: 181 FFVVSKGIIDIDYVDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGFTPLHWGTV 240
           FFVVSKGIIDIDYVDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGFTPLHWGTV
Sbjct: 181 FFVVSKGIIDIDYVDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGFTPLHWGTV 240

Query: 241 KGQPHVLKYLIQDGADFFQKTNDNKDCFVIAEEMSNTHSFQEALRHNNFDKNGYPINKLV 300
           KGQPHVLKYLIQDGADFFQKTNDNKDCFVIAEEMSNTHSFQEALRHNNFDKNGYPINKLV
Sbjct: 241 KGQPHVLKYLIQDGADFFQKTNDNKDCFVIAEEMSNTHSFQEALRHNNFDKNGYPINKLV 300

Query: 301 KRDDHAKIITFLIPLLVLGFAFFGFSHLHXXXXXXXXXXXXXASNKFIKSFLLPSYETKG 360
           KRDDHAKIITFLIPLLVLGFAFFGFSHLH             ASNKFIKSFLLPSYETKG
Sbjct: 301 KRDDHAKIITFLIPLLVLGFAFFGFSHLHILFALPVIILLLLASNKFIKSFLLPSYETKG 360

Query: 361 TNSASLLKSPLIAGILFGSIFWLAFVWILRILPYTFTKRPLGNLTFCAILCFVCYSLFLL 420
           TNSASLLKSPLIAGILFGSIFWLAFVWILRILPYTFTKRPLGNLTFCAILCFVCYSLFLL
Sbjct: 361 TNSASLLKSPLIAGILFGSIFWLAFVWILRILPYTFTKRPLGNLTFCAILCFVCYSLFLL 420

Query: 421 AFSDPGHIGSENDHEKIRETISNLLKEGKFDTRSFCLETWVRKPLRSKYSYLNDALILRF 480
           AFSDPGHIGSENDHEKIRETISNLLKEGKFDTRSFCLETWVRKPLRSKYSYLNDALILRF
Sbjct: 421 AFSDPGHIGSENDHEKIRETISNLLKEGKFDTRSFCLETWVRKPLRSKYSYLNDALILRF 480

Query: 481 DHYCPWIYNDVGLKNHKLFIFFILALELGIFSFVKVCLKYFDELDMDGDCFILGDDDLCS 540
           DHYCPWIYNDVGLKNHKLFIFFILALELGIFSFVKVCLKYFDELDMDGDCFILGDDDLCS
Sbjct: 481 DHYCPWIYNDVGLKNHKLFIFFILALELGIFSFVKVCLKYFDELDMDGDCFILGDDDLCS 540

Query: 541 GLIGDRFTFLIMTWACIQAVWIFSLVIVQLFQITKGLTNSELNALIREGRRVDIDSQTHN 600
           GLIGDRFTFLIMTWACIQAVWIFSLVIVQLFQITKGLTNSELNALIREGRRVDIDSQTHN
Sbjct: 541 GLIGDRFTFLIMTWACIQAVWIFSLVIVQLFQITKGLTNSELNALIREGRRVDIDSQTHN 600

Query: 601 EFFNTVPEGFINNKDTEEEAAPPVRNNTNERISTTFSGNLPKPRTCMGMICAVTGLHQCV 660
           EFFNTVPEGFINNKDTEEEAAPPVRNNTNERISTTFSGNLPKPRTCMGMICAVTGLHQCV
Sbjct: 601 EFFNTVPEGFINNKDTEEEAAPPVRNNTNERISTTFSGNLPKPRTCMGMICAVTGLHQCV 660

Query: 661 AIIKDTFGIARHGXXXXXXXXXXXXXXXXDYGWRRNWCDFWLLSDTNTPLWKRIFFSPPS 720
           AIIKDTFGIARHG                DYGWRRNWCDFWLLSDTNTPLWKRIFFSPPS
Sbjct: 661 AIIKDTFGIARHGSSRSTNTRSLLSSISTDYGWRRNWCDFWLLSDTNTPLWKRIFFSPPS 720

Query: 721 TKALLNGKEADYATLYEVPNKNHGSVSQLQE 751
           TKALLNGKEADYATLYEVPNKNHGSVSQLQE
Sbjct: 721 TKALLNGKEADYATLYEVPNKNHGSVSQLQE 751

>YDR264C (AKR1) [1097] chr4 complement(996021..998315) Protein with
           palmitoyl transferase activity, has an inhibitory effect
           on signaling in the pheromone pathway, contains ankyrin
           repeats [2295 bp, 764 aa]
          Length = 764

 Score =  821 bits (2120), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/743 (54%), Positives = 516/743 (69%), Gaps = 36/743 (4%)

Query: 10  VSSQASMRPLVSDNGDREAGAGVEVNIANDNDTSXXXXXXXXXXXXXPILSKYHNACQRG 69
           ++S AS++ + S N +      V  N   + D               P+L++YH ACQRG
Sbjct: 40  ITSLASLKAIRSGNEEESGNEQVNHNDEAEED---------------PLLTRYHTACQRG 84

Query: 70  DLEVVREMIHGGQVNVSSDADR-EGVTGLHWAAINNRLNVVDFLVREGANVESKAGALEA 128
           DL  V+EMIHG  + V++D D  E +TGLHWA+INNRL+VVDFLV +GA+V ++AGAL A
Sbjct: 85  DLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHA 144

Query: 129 TPLHWAARYGFVYVVDYLLQHGASATTTDKQGFNLLHLSVNSSNIMLVVYVLFFVVSKGI 188
           TPLHWAARYG+VY+VD+LL+HGA  T TD QGFNLLHLSVNSSNIMLV+YVLF VVSKG+
Sbjct: 145 TPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGL 204

Query: 189 IDIDYVDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGFTPLHWGTVKGQPHVLK 248
           +DID  DPKGRT+LLWAAYQGDSLTVA L+KF AS+KIAD  GFTPLHWGTVKGQPHVLK
Sbjct: 205 LDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLK 264

Query: 249 YLIQDGADFFQKTNDNKDCFVIAEEMSNTHSFQEALRHNNFDKNGYPINKLVKRDDHAKI 308
           YLIQDGADFFQKT+  KDCF IA+EM+  +S +EAL H+ FD +GYPI K  K+  HAK+
Sbjct: 265 YLIQDGADFFQKTDTGKDCFAIAQEMNTVYSLREALTHSGFDYHGYPIKKWFKKSQHAKL 324

Query: 309 ITFLIPLLVLGFAFFGFSHLHXXXXXXXXXXXXXASNKFIKSFLLPSYETKGTNSASLLK 368
           +TF+ P L LG AF  FSH++             A+NK +  F+LPSY   G ++ +LL+
Sbjct: 325 VTFITPFLFLGIAFALFSHINPLFVIIVLFLLAIATNKGLNKFVLPSYGRMGVHNVTLLR 384

Query: 369 SPLIAGILFGSIFWLAFVWILRILPYTFTKRPLGNLTFCAILCFVCYSLFLLAFSDPGHI 428
           SPL++G+ FG++ W+  VW  +++P TF+     N+    IL  V Y    L   DPG +
Sbjct: 385 SPLLSGVFFGTLLWVTIVWFFKVMPRTFSDEQYTNILMLVILVSVFYLFGQLVIMDPGCL 444

Query: 429 GSENDHEKIRETISNLLKEGKFDTRSFCLETWVRKPLRSKYSYLNDALILRFDHYCPWIY 488
             E DHE +R+TISNLL+ GKFDT++FC+ETW+RKPLRSK+S LN+A++ RFDHYCPWI+
Sbjct: 445 PEETDHENVRQTISNLLEIGKFDTKNFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIF 504

Query: 489 NDVGLKNHKLFIFFILALELGIFSFVKVCLKYFDELD--------MDGDCFILGDDDLCS 540
           NDVGLKNHK FIFFI  +E GIF+F+ +CL+YFDEL+         +G CFILG  DLCS
Sbjct: 505 NDVGLKNHKAFIFFITLMESGIFTFLALCLEYFDELEDAHEDTSQKNGKCFILGASDLCS 564

Query: 541 GLIGDRFTFLIMTWACIQAVWIFSLVIVQLFQITKGLTNSELNALIREGRRVDIDSQTHN 600
           GLI DRF FLI+ WA +Q++W+ SL+ VQ FQI KG+TN+E N L++E + +  D  + N
Sbjct: 565 GLIYDRFVFLILLWALLQSIWVASLIFVQAFQICKGMTNTEFNVLMKESKSIGPDGLSFN 624

Query: 601 EFFNTVPEGFINNKDTEEEAAPPVRNNTNERISTTFSGN-LPKPRTCMGMICAVTGLHQC 659
           E FNT PEGF  + D  EE        +N+ +     G+ + KPRTC G+  AVTG+ Q 
Sbjct: 625 ENFNTTPEGFAPSIDPGEE--------SNDTVLAPVPGSTIRKPRTCFGVCYAVTGMDQW 676

Query: 660 VAIIKDTFGIARHGXXXXXXXXXXXXXXXXDYGWRRNWCDFWLLSDTNTPLWKRIFFSPP 719
           +A+IK+T GI                    +YGW+RN  DFWL SD N PLW+RI + P 
Sbjct: 677 LAVIKETIGIKD---STGHNVYSITSRIPTNYGWKRNVKDFWLTSDINAPLWRRILYPPS 733

Query: 720 STKALLNGKEADYATLYEVPNKN 742
            +KALLNG E DY  LY++PNK+
Sbjct: 734 GSKALLNGIEVDYFKLYKLPNKD 756

>Scas_538.8
          Length = 752

 Score =  584 bits (1506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/575 (51%), Positives = 373/575 (64%), Gaps = 15/575 (2%)

Query: 179 VLFFVVSKGIIDIDYVDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGFTPLHWG 238
           VLFFVV+KGIIDID  DPKGRT LLWAAYQGDSL+V  L+KF AS KI DEGGFTPLHW 
Sbjct: 4   VLFFVVAKGIIDIDCQDPKGRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPLHWA 63

Query: 239 TVKGQPHVLKYLIQDGADFFQKTNDNKDCFVIAEEMSNTHSFQEALRHNNFDKNGYPINK 298
           TVKGQP+VL +LI+DGADFF KTND KDCF IA+EM+ +HSF++AL    F+++GYP  K
Sbjct: 64  TVKGQPYVLTHLIRDGADFFLKTNDGKDCFTIAQEMNTSHSFKDALSICGFNQDGYPKRK 123

Query: 299 LVKRDDHAKIITFLIPLLVLGFAFFGFSHLHXXXXXXXXXXXXXASNKFIKSFLLPSYET 358
           L K+ DHAK+ITF +PL+ L   F  F+HLH             A NK +K  +LPSY  
Sbjct: 124 LFKKSDHAKVITFFVPLVALSIIFILFTHLHPLFALLISLIFGLAVNKALKELILPSYSN 183

Query: 359 KGTNSASLLKSPLIAGILFGSIFWLAFVWILRILPYT-FTKRPLGNLTFCAILCFVCYSL 417
            G +S SLLKSP ++G  FGS+  L  VWI +I P+T F  R L N     IL  + Y  
Sbjct: 184 YGLHSTSLLKSPFLSGTFFGSLLLLTIVWIFKIAPFTIFKSRLLTNFFMFLILMQIYYLF 243

Query: 418 FLLAFSDPGHIGSENDHEKIRETISNLLKEGKFDTRSFCLETWVRKPLRSKYSYLNDALI 477
             L FSDPG +  E DHE +R TI  LL  GKFD ++FCLETW+RKPLRS +S LN   +
Sbjct: 244 IKLIFSDPGCVPIETDHENVRGTIKELLDTGKFDIKNFCLETWIRKPLRSHFSTLNTHNV 303

Query: 478 LRFDHYCPWIYNDVGLKNHKLFIFFILALELGIFSFVKVCLKYFDELD---MDGDCFILG 534
            RFDH+CPWIYND+GLKNHK F++FIL  E+GI+ F+ + +KYFD L+    D  CF+LG
Sbjct: 304 ARFDHFCPWIYNDIGLKNHKNFMWFILLTEVGIWFFISLTMKYFDILEDTNEDVACFLLG 363

Query: 535 DDDLCSGLIGDRFTFLIMTWACIQAVWIFSLVIVQLFQITKGLTNSELNALIREGR-RVD 593
           DD+LC+G + DRFTFLI  WA IQ+VW+  L++VQ+FQ   G+TN E N  ++E + +  
Sbjct: 364 DDELCAGFVYDRFTFLIALWALIQSVWVGFLIVVQVFQTFTGVTNKEFNKYVKEKKNQHA 423

Query: 594 IDSQTHNEFFNTVPEGFINNKDTEEEAAPPVRNNTNERISTTFSG-----NLPKPRTCMG 648
            D    N+ FNT PE   N+ D  + AA    NN N    TT        N  KPRTC  
Sbjct: 424 FDPIFFNDTFNTTPEELRNDDD--DTAASRTGNNPNHSNGTTIPSEGSRINTRKPRTCFN 481

Query: 649 MICAVTGLHQCVAIIKDTFGIARHGXXXXXXXXXXXXXXXXDYGWRRNWCDFWLLSDTNT 708
           +  A+TGL Q   I+++T GI   G                +YGW+RN  DFWL SD   
Sbjct: 482 LCFAITGLDQVRTIVRETLGI---GGANEMSRMQLLSSIPTNYGWKRNLADFWLTSDVMA 538

Query: 709 PLWKRIFFSPPSTKALLNGKEADYATLYEVPNKNH 743
           P+W+R+F+SP  ++ALLNG E DY  LY+ P K +
Sbjct: 539 PIWRRLFYSPVESRALLNGVEVDYFKLYDFPEKTY 573

 Score =  123 bits (308), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 77/98 (78%), Gaps = 1/98 (1%)

Query: 57  PILSKYHNACQRGDLEVVREMIHGGQVNVSSDADREGVTGLHWAAINNRLNVVDFLVREG 116
           P+L +YH ACQ+GDL  V++++  G +++++D   + +TGLHWA+INNRL+VV +L+ +G
Sbjct: 654 PVLGQYHQACQKGDLATVKQLLDSGVLDLNTDLTGD-ITGLHWASINNRLSVVKYLISQG 712

Query: 117 ANVESKAGALEATPLHWAARYGFVYVVDYLLQHGASAT 154
            +V +KAG LEATPLHWAARYG+V++VD LL  GA  T
Sbjct: 713 IDVNAKAGDLEATPLHWAARYGYVHIVDCLLNKGADPT 750

 Score = 37.0 bits (84), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 42/82 (51%), Gaps = 4/82 (4%)

Query: 71  LEVVREMIHGGQVNVSSDADREGVTGLHWAAINNRLNVVDFLVREGANVE-SKAGALEAT 129
           L V+  ++  G +++    D +G T L WAA       V  L++ GA+ +    G    T
Sbjct: 2   LPVLFFVVAKGIIDIDCQ-DPKGRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGF--T 58

Query: 130 PLHWAARYGFVYVVDYLLQHGA 151
           PLHWA   G  YV+ +L++ GA
Sbjct: 59  PLHWATVKGQPYVLTHLIRDGA 80

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 27/60 (45%), Gaps = 1/60 (1%)

Query: 205 AAYQGDSLTVAALIKFNASVKIAD-EGGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTND 263
           A  +GD  TV  L+         D  G  T LHW ++  +  V+KYLI  G D   K  D
Sbjct: 662 ACQKGDLATVKQLLDSGVLDLNTDLTGDITGLHWASINNRLSVVKYLISQGIDVNAKAGD 721

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 34/76 (44%), Gaps = 3/76 (3%)

Query: 183 VVSKGIIDIDYVDPKGRTALLWAAYQGDSLTVAALIK--FNASVKIADEGGFTPLHWGTV 240
           ++  G++D++       T L WA+       V  LI    + + K  D    TPLHW   
Sbjct: 674 LLDSGVLDLNTDLTGDITGLHWASINNRLSVVKYLISQGIDVNAKAGDLEA-TPLHWAAR 732

Query: 241 KGQPHVLKYLIQDGAD 256
            G  H++  L+  GAD
Sbjct: 733 YGYVHIVDCLLNKGAD 748

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 4/55 (7%)

Query: 65  ACQRGD-LEVVREMIHGGQVNVSSDADREGVTGLHWAAINNRLNVVDFLVREGAN 118
           A  +GD L V+  +  G    +    D  G T LHWA +  +  V+  L+R+GA+
Sbjct: 30  AAYQGDSLSVMLLLKFGASTKI---VDEGGFTPLHWATVKGQPYVLTHLIRDGAD 81

>KLLA0E16764g 1484752..1487010 gi|28565052|gb|AAO32609.1
           Kluyveromyces lactis AKR1, hypothetical start
          Length = 752

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/694 (42%), Positives = 412/694 (59%), Gaps = 29/694 (4%)

Query: 57  PILSKYHNACQRGDLEVVREMIHGGQVNVSSDAD-REGVTGLHWAAINNRLNVVDFLVRE 115
           PIL +YH AC++GD++ +REM+    +++S+D D +E V+GLHWA INNRL+ V +L   
Sbjct: 72  PILERYHAACKQGDMKTLREMVESKVIDLSNDYDPKERVSGLHWACINNRLSAVKYLAGA 131

Query: 116 GANVESKAGALEATPLHWAARYGFVYVVDYLLQHGASATTTDKQGFNLLHLSVNSSNIML 175
           GA V  K G L+ATPLHWA++ G VY+VD LL+ GA    TD QG+NLLH SV SSNIML
Sbjct: 132 GAEVNFKGGELDATPLHWASKSGLVYIVDELLKAGADPNITDSQGYNLLHTSVFSSNIML 191

Query: 176 VVYVLFFVVSKGIIDIDYVDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGFTPL 235
           V+YVLFFVV  G  D+D  DP  RTAL WA YQ D+LTV  L+KFNA VK AD+ GFT L
Sbjct: 192 VIYVLFFVVD-GKEDVDQPDPHQRTALQWATYQADALTVENLLKFNADVKNADDAGFTAL 250

Query: 236 HWGTVKGQPHVLKYLIQDGADFFQKTNDNKDCFVIAEEMSNTHSFQEALRHNNFDKNGYP 295
           HWGTVKG   V+  LI+ G+DFFQ TND K+CF I +E+ +  S + +L  N FDKNG+P
Sbjct: 251 HWGTVKGSIPVMDLLIKHGSDFFQTTNDGKNCFTIGKELYSIGSLEASLYKNGFDKNGFP 310

Query: 296 INKLVKRDDHAKIITFLIPLLVLGFAFFGFSHLHXXXXXXXXXXXXXASNKFIKSFLLPS 355
           + +        K++TF +P +++   F+ FS +               S   +   ++PS
Sbjct: 311 LPQYFSAST-GKMLTFFLPWVLIPLVFYIFSKITFFIALLINTIVLVISGLVLSRLVVPS 369

Query: 356 YETKGTNSASLLKSPLIAGILFGSIFWLAFVWILRILPYTFTKRPLGNLTFCAILCFVCY 415
           Y    +    +L SPL+AGIL G+I    F+W  +I   TFT++P+GN+        +  
Sbjct: 370 YLL--SKRHPILNSPLLAGILSGTIAIAFFIWFTKISILTFTEKPVGNIIMLGFFIGLIT 427

Query: 416 SLFLLAFSDPGHIGSENDHEKIRETISNLLKEGKFDTRSFCLETWVRKPLRSKYSYLNDA 475
               L  SDPG+I    DH+K+RETI  LL  GKFD + FC+ TW+R PLRSKY   +  
Sbjct: 428 LFIGLMKSDPGYIPGTVDHDKVRETIKELLSLGKFDAKHFCVHTWIRIPLRSKYDRDSAC 487

Query: 476 LILRFDHYCPWIYNDVGLKNHKLFIFFILALELGIFSFVKVCLKYFDELD---------M 526
           LI  FDH+CPW+YN +GL NHKLF  F++ LE+ ++ F+ + ++YFDEL+          
Sbjct: 488 LISAFDHFCPWVYNQIGLLNHKLFYMFVVLLEISVWWFLPLMMEYFDELEDYLENRKGKH 547

Query: 527 DGDCFILGDDDLCSGLIGDRFTFLIMTWACIQAVWIFSLVIVQLFQITKGLTNSELNALI 586
            GDC  LGD+DLC GL  D F FL++ W   QA W+  L+ VQ  Q+ KG+T+ E    +
Sbjct: 548 FGDCHFLGDEDLCFGLHHDTFNFLLLCWVIFQAFWVLCLIAVQTVQMLKGVTDYE---FV 604

Query: 587 REGRRVDIDSQTHNEFFNTVPEGFINNKDTEEEAAPPVRNNTNERISTTFSGNLPKPRTC 646
           +  +++  +  T  + F++ P   ++ +   E  AP +               +P+ RTC
Sbjct: 605 QINKKLKSNGTTTEDIFSSTPPELMSEELIAELDAPALDPR-----------QVPQ-RTC 652

Query: 647 MGMICAVTGLHQCVAIIKDTFGIARHGXXXXXXXXXXXXXXXXDYGWRRNWCDFWLLSDT 706
             + C + GL + V +IK    +                    DYGW++N  DFWLL DT
Sbjct: 653 FTVCCTLLGLDKLVTMIKSVLRLKSDEPSSRSSHLSALARIPTDYGWKQNLKDFWLLPDT 712

Query: 707 NTPLWKRIFFSPPSTKALLNGKEADYATLYEVPN 740
           ++PLW+RI   P  + ALLNG E DY TLY +PN
Sbjct: 713 SSPLWRRILLPPKDSHALLNGMEVDYYTLYTLPN 746

>AER388C [2888] [Homologous to ScYDR264C (AKR1) - SH; ScYOR034C
           (AKR2) - SH] (1365604..1367778) [2175 bp, 724 aa]
          Length = 724

 Score =  571 bits (1471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/748 (42%), Positives = 427/748 (57%), Gaps = 55/748 (7%)

Query: 3   DNSEQASVSSQASMRPLVSDNGDRE--AGAGVEVNIANDNDTSXXXXXXXXXXXXXPILS 60
           D+   +S+    S  P   D GD +  +GA +  N   D                 P L 
Sbjct: 15  DDISISSIQPIVSDVPAAEDVGDEDHISGASIAENRPKD-----------------PTLV 57

Query: 61  KYHNACQRGDLEVVREMIHGGQVNVSSDADRE-GVTGLHWAAINNRLNVVDFLVREGANV 119
           KYH ACQRGDL+ V++MI  G ++V +D D E  V+GLHWA+ NNRLN+V +L+ +GA+V
Sbjct: 58  KYHAACQRGDLKTVKDMIEAGVIDVKADWDEEEQVSGLHWASANNRLNLVRYLIAQGADV 117

Query: 120 ESKAGALEATPLHWAARYGFVYVVDYLLQHGASATTTDKQGFNLLHLSVNSSNIMLVVYV 179
             K G LEATPLHWA++ G+VY+V  LL+HGA    TD+QG+NLLH S  SS +ML+ YV
Sbjct: 118 NIKGGDLEATPLHWASKSGYVYIVHCLLEHGADPLITDRQGYNLLHTSTFSSEVMLITYV 177

Query: 180 LFFVVSKGIIDIDYVDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGFTPLHWGT 239
           LF     G I +D  DP G+TAL WAAYQGD  TV AL+KF+A V++ D GGFTPLHW T
Sbjct: 178 LF----TGQIPVDSPDPTGKTALHWAAYQGDPNTVEALLKFDADVRVVDTGGFTPLHWAT 233

Query: 240 VKGQPHVLKYLIQDGADFFQKTNDNKDCFVIAEEMSNTHSFQEALRHNNFDKNGYPINKL 299
           VKG PHVLK LI+ G+D F K ND K+  +IA+EM+   + Q AL    F+K+G+ I K 
Sbjct: 234 VKGHPHVLKALIEHGSDVFLKNNDGKNALMIAQEMNTQKALQNALYECGFNKDGFAIRKY 293

Query: 300 VKRDDHAKIITFLIPLLVLGFAFFGFSHLHXXXXXXXXXXXXXASNKFIKSFLLPSYETK 359
            K   HAK++TF  P L+LG     F++               A+   + +F+ PS+   
Sbjct: 294 FKNPMHAKMVTFFTPWLILGLILSFFAYFSILLAILGCLLTVLAAGYGLYNFVFPSFIL- 352

Query: 360 GTNSASLLKSPLIAGILFGSIFWLAFVWILRILPYTFTKRPLGNLTFCAILCFVCYSLFL 419
                 + K+PL+AGIL G+IFWL +VW+ ++LP TF   P+ NLT  A+   V + L  
Sbjct: 353 -MKRIVIFKTPLLAGILSGTIFWLLYVWLFKMLPATFDDEPILNLTVFALFAGVVFLLTK 411

Query: 420 LAFSDPGHIGSENDHEKIRETISNLLKEGKFDTRSFCLETWVRKPLRSKYSYLNDALILR 479
           L  SDPG+I    DH +IR TI  LL+ GK+D++ FC+ +W+R PLR+KY     ++ILR
Sbjct: 412 LLQSDPGYIVPATDHNQIRATIIELLRVGKYDSKHFCIHSWIRLPLRAKYKRFVHSVILR 471

Query: 480 FDHYCPWIYNDVGLKNHKLFIFFILALELGIFSFVKVCLKYFDELDMDG------DCFIL 533
           +DHYCPWIYN +G +NHK+FI+FIL L+LGI +  K+CL+YFDEL           C IL
Sbjct: 472 YDHYCPWIYNYIGFRNHKIFIYFILLLDLGILALAKLCLEYFDELKDHAKNKDALKCSIL 531

Query: 534 GDDDLCSGLIGDRFTFLIMTWACIQAVWIFSLVIVQLFQITKGLTNSELNALIREGRRVD 593
              DLC+G   D FT  ++ W C+Q +WI +L  VQ F+  KG+T  E     R  R V 
Sbjct: 532 S-KDLCAGFTYDPFTLFLLEWVCVQGMWILALSFVQFFECLKGVTEHEFAHWQRRNRGV- 589

Query: 594 IDSQTHNEFFNTVPEGFINNKDTEEEAAPPVRNNTNERISTTFSGNLPKPRTCMGMICAV 653
                    FNT PE  +     EE          N+  S   +G     R C   +   
Sbjct: 590 ---VGREHVFNTAPEELMEEDPEEER---------NKLRSLGAAGQ----RHCCSTLTTA 633

Query: 654 TGLHQCVAIIKDTFGIARHGXXXXXXXXXXXXXXXXDYGWRRNWCDFWLLSDTNTPLWKR 713
           TG  + +++I  +      G                DYGW++N  DFWL SD + P+W+R
Sbjct: 634 TGFDRFLSVIGSSL-----GRQPRTTHNPINYPIETDYGWKQNLKDFWLTSDISAPMWRR 688

Query: 714 IFFSPPSTKALLNGKEADYATLYEVPNK 741
           I   P  T+ LLNG+E DY  LY +P +
Sbjct: 689 ILLPPVGTRGLLNGQEVDYQKLYNLPER 716

>YOR034C (AKR2) [4846] chr15 complement(394836..397085) Protein
           involved in constitutive endocytosis of Ste3p [2250 bp,
           749 aa]
          Length = 749

 Score =  469 bits (1206), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 270/697 (38%), Positives = 393/697 (56%), Gaps = 32/697 (4%)

Query: 65  ACQRGDLEVVREMIHGGQVNVSSDADREGVTGLHWAAINNRLNVVDFLVREGANVESKAG 124
           A + GDL+VV++++  G V++++D   E ++GLHWA INNR +V  FL+  GAN    AG
Sbjct: 57  AAKDGDLKVVKDVVESGAVDINNDRIDE-LSGLHWACINNRFSVAKFLLLRGANPNQAAG 115

Query: 125 ALEATPLHWAARYGFVYVVDYLLQHGASATTTDKQGFNLLHLSVNSSNIMLVVYVLFFVV 184
              AT LHWAARYG +Y+VD LL+HGA  T  D+QG N++H SV SSNI+LVVYVL+FVV
Sbjct: 116 PGGATALHWAARYGNIYIVDLLLKHGADPTLKDEQGLNIMHFSVYSSNILLVVYVLYFVV 175

Query: 185 SKGI-IDIDYVDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGFTPLHWGTVKGQ 243
           +    +DID  D   RT LLWAAYQGD LTV  L+KF ++V   D  GF  LH   V G 
Sbjct: 176 NNNDNVDIDSKDNNNRTPLLWAAYQGDFLTVELLLKFGSTVAWTDNRGFNALHCALVGGD 235

Query: 244 PHVLKYLIQDGADFFQKTNDNKDCFVIAEEMSNTHSFQEALRHNNFDKNGYPINKLVKRD 303
             V+  LI  GA+F+++ N  +DCF +AE M     F++AL+H+ +D+ G   +KL K+ 
Sbjct: 236 QRVICDLILSGANFYERNNQKQDCFDLAEGMGTKSLFEQALQHHGYDRLGNQKDKLFKKS 295

Query: 304 DHAKIITFLIPLLVLGFAFFGFSHLHXXXXXXXXXXXXXASNKFIKSFLLPSYETKGTNS 363
            HA+   FL P L++ + +     L                   +K F+LP    K T  
Sbjct: 296 SHAQFTIFLSPFLLMVYIYLISLVLSPVLAIMLSLLVTVVMVNTLKKFVLPCLPRKNTYK 355

Query: 364 ASLLKSPLIAGILFGSIFWLAFVWILRILPYTFTKRPLGNLTFCAILCFVCYSLFL-LAF 422
            SL ++P  +G+   +  +L ++W  ++ PY+ +   + N+ F  +  F+   LFL L  
Sbjct: 356 VSLTRTPFFSGLFLSTFCFLIYIWTKKLYPYSVSDYTMKNVQFL-VTSFLTVVLFLRLVR 414

Query: 423 SDPGHIGSENDHEKIRETISNLLKEGKFDTRSFCLETWVRKPLRSKYSYLNDALILRFDH 482
           SDPG + +++    I+ETI  L+  GKFD  +FC+ET  RKPLRSKYS+ + AL+ R+DH
Sbjct: 415 SDPGCLKTDDSLTSIQETIKQLIDLGKFDRENFCVETLERKPLRSKYSFFSGALVARYDH 474

Query: 483 YCPWIYNDVGLKNHKLFIFFILALELGIFSFVKVCLKYF-------DELDMDGDCFILGD 535
           YCPWIYNDVGLKNHKLF+FF + ++  +F F+ +CL YF       ++++    C +L +
Sbjct: 475 YCPWIYNDVGLKNHKLFVFFAVTVQYHMFLFMWLCLAYFKKTNYIYEQVEEYARCALLKN 534

Query: 536 DDLCSGLIGDRFTFLIMTWACIQAVWIFSLVIVQLFQITKGLTNSELNALIREGRRVDID 595
           + LC G   D  TF +  W  +  +W+ +++IVQ FQI KG+T  EL  LI+E  +    
Sbjct: 535 ETLCKGSNYDPSTFFLFIWISVNFIWLGAMLIVQFFQILKGITTPELFILIKEEHKA--- 591

Query: 596 SQTHNEFFNTVPEGFINNKDTEE-------EAAPPVRNNTNERISTTFSGNLP--KPRTC 646
                +F N +P  F N+  T E       +  P   + T    + +  G  P  + R  
Sbjct: 592 -----KFINLIP--FENSIYTSESKGVEDSDMIPEGPSATTITHTISIDGLEPRNRRRAI 644

Query: 647 MGMICAVTGLHQCVAIIKDTFGIAR--HGXXXXXXXXXXXXXXXXDYGWRRNWCDFWLLS 704
           +    ++ G++Q +  IK+  GI    HG                   W+ N  DFWL S
Sbjct: 645 LSACFSMMGINQWLVTIKEIVGITHILHGQVPQQHHSSLLRSFLVTNHWKTNLTDFWLNS 704

Query: 705 DTNTPLWKRIFFSPPSTKALLNGKEADYATLYEVPNK 741
           D   PLW+R F+S  ++KA+L G E DY  LYE P +
Sbjct: 705 DVTAPLWQRFFYSSDTSKAMLGGTEVDYYELYEYPAR 741

>Kwal_55.19987
          Length = 343

 Score =  335 bits (859), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 170/322 (52%), Positives = 227/322 (70%), Gaps = 22/322 (6%)

Query: 1   MEDNSEQASVS-------SQASMRPLVSDNGDREAGAGVEVNIANDNDTSXXXXXXXXXX 53
           +ED++E+  +S       S AS+ P+ S+    EA A    +I+  N++           
Sbjct: 35  IEDHAEEGLLSAAADTQVSIASIEPIASE---IEASAPSAEDISLGNES----------Y 81

Query: 54  XXXPILSKYHNACQRGDLEVVREMIHGGQVNVSSDAD-REGVTGLHWAAINNRLNVVDFL 112
              P+L +Y  ACQ GDL  V+E+I  G++++S D D +E ++GLHWA+INNRL +V +L
Sbjct: 82  HIDPVLQEYREACQTGDLTKVKELIESGRIDISHDYDEKERISGLHWASINNRLGIVRYL 141

Query: 113 VREGANVESKAGALEATPLHWAARYGFVYVVDYLLQHGASATTTDKQGFNLLHLSVNSSN 172
           + +GANV+ + G L ATPLHWAARYG+VY+VD LL+ GA A+ TD QGFNLLHLS+NSSN
Sbjct: 142 IGKGANVDFQGGDLNATPLHWAARYGYVYIVDSLLESGADASLTDHQGFNLLHLSINSSN 201

Query: 173 IMLVVYVLFFVVSKGIIDIDYVDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGF 232
           IMLV+YVL+FVV   +  +D +DP  RT LLWAAYQGDSL+V AL++FNA++ IAD GGF
Sbjct: 202 IMLVLYVLYFVVGDKL-SVDCLDPNNRTPLLWAAYQGDSLSVKALLEFNANLNIADSGGF 260

Query: 233 TPLHWGTVKGQPHVLKYLIQDGADFFQKTNDNKDCFVIAEEMSNTHSFQEALRHNNFDKN 292
            P HW TVKGQP VLKYL++ G+DFFQKT DNKDCFVI++EM    S   +L+ + F K+
Sbjct: 261 LPPHWATVKGQPTVLKYLLEGGSDFFQKTADNKDCFVISQEMHTQESLTNSLQESGFKKD 320

Query: 293 GYPINKLVKRDDHAKIITFLIP 314
           G PI KL +   HAK+ITF+IP
Sbjct: 321 GTPIMKLFRNPRHAKLITFIIP 342

>Scas_699.36
          Length = 511

 Score =  140 bits (354), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 81/258 (31%), Positives = 143/258 (55%), Gaps = 12/258 (4%)

Query: 65  ACQRGDLEVVREM-----IHGGQVNVSSDADREGVTGLHWAAINNRLNVVDFLVREGANV 119
           +C+ G+++ V+++     I G  +N   D + +G+  L WA IN+R+ V+++L+ +GA+ 
Sbjct: 13  SCELGNIDTVKQLVSSNVIEGNYINEIRD-NCQGLNALQWACINDRIEVIEYLISQGADT 71

Query: 120 ESKAGALEATPLHWAARYGFVYVVDYLLQHGASATTTDKQGFNLLHLSVNSSNIMLVVYV 179
             + G    TPL  A ++G +Y +D LL++ A     D++   LL  +V +S+ +LV+Y+
Sbjct: 72  NIQCGL--HTPLQLAVQFGHIYTIDLLLKNDAKWKHYDRES--LLIAAVKNSSPLLVLYI 127

Query: 180 LFFVVSKGIIDIDYVDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGFTPLHWGT 239
           L FVVS  + DI+  D  GR+ L+ A+  GD L +  L+KF ++V + D  G+   H+  
Sbjct: 128 LLFVVSLELEDINMCDENGRSPLMLASAHGDLLIIKLLLKFGSNVNLVDNDGYNAAHFAI 187

Query: 240 VKGQPHVLKYLIQDGADFFQKTNDNKDCFVIAEEMSNTHSFQEALRHNNFDKNGYPINK- 298
           + G+  +   LI++G D   KT + K C  +A EM+     Q   R++  + +G    K 
Sbjct: 188 IGGEFRIFDILIENGTDVLSKTKNGKSCLQLATEMNTVTRLQNIFRNHCLNDDGVKDYKI 247

Query: 299 -LVKRDDHAKIITFLIPL 315
            L+ R     + + LIPL
Sbjct: 248 YLINRKFWVSLTSMLIPL 265

>CAGL0L06622g complement(743602..747015) similar to sp|P17442
           Saccharomyces cerevisiae YGR233c PHO81 cyclin-dependent
           kinase inhibitor, start by similarity
          Length = 1137

 Score = 66.6 bits (161), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 90/200 (45%), Gaps = 6/200 (3%)

Query: 63  HNACQRGDLEVVREMIHGGQVNVSSDADREGVTGLHWAAINNRLNVVDFLVREGANVESK 122
           H+A ++G  E V  ++    V++    D++  T L  A  +N +  V  L++ G+N    
Sbjct: 417 HHAAEQGKTEFVELILESNLVDMLDIPDQDRKTPLILALESNDIKAVKLLLQHGSNAYPN 476

Query: 123 AGALEATPLHWAARYGFVYVVDYLLQH-GASATTTDKQGFNLLHLSVNSSNIMLVVYVLF 181
           A      PL  A + G    V  +L   G            LLH+   +SN   +  +L 
Sbjct: 477 AQDKVLDPLSVACKKGNFEAVKLILDFLGDKIEGPSLDKMELLHIVSKNSNSSALAELL- 535

Query: 182 FVVSKGIIDIDYVDP-KGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGFTPLHWGTV 240
             +SKG  +++Y D   GRT L +A   G    V+ L++ NAS+ + D+ G+TPL +   
Sbjct: 536 --ISKGA-NVNYGDKFLGRTPLFYAVMNGKDNIVSLLLRCNASIDVMDDEGYTPLFYTIW 592

Query: 241 KGQPHVLKYLIQDGADFFQK 260
           +    VL  ++       QK
Sbjct: 593 ESDVKVLNAMLPSIKSIKQK 612

>KLLA0E15796g complement(1406502..1407194) similar to sp|P50086
           Saccharomyces cerevisiae YGR232w NAS6 possible homolog
           of human 26S proteasome regulatory subunit p28
           singleton, start by similarity
          Length = 230

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 93/213 (43%), Gaps = 14/213 (6%)

Query: 63  HNACQRGDLEVVREMIHG--GQVNVSSDADREGVTGLHWAAINNRLNVVDFLVREGANVE 120
           H AC  GD E V++++    G V V  D   +G   LHWA    + N++D L+     ++
Sbjct: 8   HAACMNGDTEKVQQILSEFPGAVKVKDD---DGRYPLHWAVSFQQDNIIDILLSYMKKID 64

Query: 121 SKAGALEA--TPLHWAARYGFVYVVDYLLQHGASATT--TDKQGFNLLHLSVNSSNIMLV 176
                 E+  +P+H A+  G V +++ LL H            G   LHL+ +  ++   
Sbjct: 65  LDTILDESGWSPVHIASSIGSVTILEKLLNHTVEPNLDLQANNGITALHLACSKKHL--- 121

Query: 177 VYVLFFVVSKGIIDIDYVDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGFTPLH 236
             V+  +V +G   +   D  G+  L  AA  G    V+ L   N+ V I D+ G++PL 
Sbjct: 122 -NVVQLLVERGA-SVRIKDGLGQLPLHRAAASGSVGIVSILCDKNSPVNIKDKNGWSPLF 179

Query: 237 WGTVKGQPHVLKYLIQDGADFFQKTNDNKDCFV 269
               +G   V   L+      ++   DN D  +
Sbjct: 180 HALAEGHGDVAVTLVNKYHALWEGETDNDDLSI 212

 Score = 50.8 bits (120), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 52/106 (49%), Gaps = 3/106 (2%)

Query: 60  SKYHNACQRGDLEVVREMI-HGGQVNVSSDADREGVTGLHWAAINNRLNVVDFLVREGAN 118
           S  H A   G + ++ +++ H  + N+   A+  G+T LH A     LNVV  LV  GA+
Sbjct: 75  SPVHIASSIGSVTILEKLLNHTVEPNLDLQANN-GITALHLACSKKHLNVVQLLVERGAS 133

Query: 119 VESKAGALEATPLHWAARYGFVYVVDYLLQHGASATTTDKQGFNLL 164
           V  K G L   PLH AA  G V +V  L    +     DK G++ L
Sbjct: 134 VRIKDG-LGQLPLHRAAASGSVGIVSILCDKNSPVNIKDKNGWSPL 178

>KLLA0F03619g 342770..345652 weakly similar to sp|P40480
           Saccharomyces cerevisiae YIL112w singleton, start by
           similarity
          Length = 960

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 69/266 (25%), Positives = 111/266 (41%), Gaps = 67/266 (25%)

Query: 65  ACQRGDLEVVREMIHGGQVNVSSDADREGVTGLHWAAINNRLNVVDFLVREGANVESKA- 123
           AC +G  ++ +++I     +V+ D D  G T LH AA+N    +V+ LVR GANV  ++ 
Sbjct: 266 ACDKGKYDLAKKLIEEDGYDVN-DQDNAGNTPLHEAALNGHSAIVELLVRNGANVNIQSY 324

Query: 124 GALEATPLHWAARYGFVYVVDYLLQHGASATTTDKQGFNLLHLSVNSSNI---------- 173
                TPL  A+  G + VV YLL HGA  T  + +G + +      S++          
Sbjct: 325 DMFLDTPLIDASANGHINVVKYLLDHGADPTMVNAKGLSAIESIEEESDMDNDDRRIVHD 384

Query: 174 ---MLVVYVLFFV-----------VSKGIIDIDY------------VDPK-GRTALLWAA 206
              ML      ++           +S+   DID             +  K G+  LL A+
Sbjct: 385 MKDMLKRATRKYIKHSHRTLQSSSMSRHSDDIDKQLNHDDDFYWTDISSKLGKNKLLKAS 444

Query: 207 YQGDSLTVAALIK---------------------------FNASVKIADEGGFTPLHWGT 239
            +G    V + ++                           F A V ++++ G TPL    
Sbjct: 445 KEGKLAYVGSYLENGGRPDFRCFLESCIYGHDDVVSLFLAFGAQVNMSNKEGQTPLMLSV 504

Query: 240 VKGQPHVLKYLIQDGADFFQKTNDNK 265
            +G  +V+K L++ GAD  QKT+  K
Sbjct: 505 GRGHVNVVKLLLEAGAD-PQKTDKRK 529

 Score = 37.4 bits (85), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 11/104 (10%)

Query: 190 DIDYVDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGF--TPLHWGTVKGQPHVL 247
           D++  D  G T L  AA  G S  V  L++  A+V I     F  TPL   +  G  +V+
Sbjct: 285 DVNDQDNAGNTPLHEAALNGHSAIVELLVRNGANVNIQSYDMFLDTPLIDASANGHINVV 344

Query: 248 KYLIQDGADFFQKTNDNKDCFVIAEEMSNTHSFQEALRHNNFDK 291
           KYL+  GAD            V A+ +S   S +E    +N D+
Sbjct: 345 KYLLDHGAD---------PTMVNAKGLSAIESIEEESDMDNDDR 379

 Score = 33.1 bits (74), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 34/67 (50%), Gaps = 5/67 (7%)

Query: 107 NVVDFLVREGA--NVESKAGALEATPLHWAARYGFVYVVDYLLQHGASATTTDKQGFNLL 164
           +VV   +  GA  N+ +K G    TPL  +   G V VV  LL+ GA    TDK+    L
Sbjct: 477 DVVSLFLAFGAQVNMSNKEGQ---TPLMLSVGRGHVNVVKLLLEAGADPQKTDKRKKTAL 533

Query: 165 HLSVNSS 171
           H + +SS
Sbjct: 534 HYANHSS 540

 Score = 33.1 bits (74), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 1/65 (1%)

Query: 193 YVDPKGRTALLWAAYQGDSLTVAALIKFNA-SVKIADEGGFTPLHWGTVKGQPHVLKYLI 251
           + D  GRT L  A  +G       LI+ +   V   D  G TPLH   + G   +++ L+
Sbjct: 254 HRDAGGRTKLQIACDKGKYDLAKKLIEEDGYDVNDQDNAGNTPLHEAALNGHSAIVELLV 313

Query: 252 QDGAD 256
           ++GA+
Sbjct: 314 RNGAN 318

>Scas_595.9
          Length = 1148

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 72/135 (53%), Gaps = 6/135 (4%)

Query: 65  ACQRGDLEVVREMIHGGQVNVSSDADREGVTGLHWAAIN-----NRLNVVDFLVREGANV 119
           ACQ  + E   E++    +N+ + +D +G+T LH  A N     N   +V  L+++GAN 
Sbjct: 490 ACQYNNFEAA-ELLLAADINLLNVSDTKGLTPLHIVAKNGTNETNSRKLVQLLIQKGANP 548

Query: 120 ESKAGALEATPLHWAARYGFVYVVDYLLQHGASATTTDKQGFNLLHLSVNSSNIMLVVYV 179
            +     + TP+ +A + G   +VD LL++GA     D +  + LHL++  SNI ++  +
Sbjct: 549 NALDTFNKWTPIFYAIQRGQREIVDELLKNGADLAIKDDENRSPLHLTIWESNIQVLNTL 608

Query: 180 LFFVVSKGIIDIDYV 194
           L ++  + +  ID V
Sbjct: 609 LPYLKKQSVPRIDTV 623

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 47/216 (21%), Positives = 80/216 (37%), Gaps = 41/216 (18%)

Query: 63  HNACQRGDLEVVREMIHGGQVNVSSDADREGVTGLHWAAINNRLNVVD------------ 110
           H AC+ G L+ V+ ++    +N  +  D    T L  A INN L ++             
Sbjct: 408 HYACEGGKLDFVQLLLQTKLMNSVNTPDNVMQTPLLLALINNHLEIMKLLLQEEQLTLES 467

Query: 111 -------------FLVREGANVESKAGALEATPLHWAARYGFVYVVDYLLQHGASATTTD 157
                               NV  +    EA  L  AA    + V             +D
Sbjct: 468 LPSSSSSSSSSSSLKYLSPLNVACQYNNFEAAELLLAADINLLNV-------------SD 514

Query: 158 KQGFNLLHL-SVNSSNIMLVVYVLFFVVSKGIIDIDYVDPKGR-TALLWAAYQGDSLTVA 215
            +G   LH+ + N +N      ++  ++ KG  + + +D   + T + +A  +G    V 
Sbjct: 515 TKGLTPLHIVAKNGTNETNSRKLVQLLIQKG-ANPNALDTFNKWTPIFYAIQRGQREIVD 573

Query: 216 ALIKFNASVKIADEGGFTPLHWGTVKGQPHVLKYLI 251
            L+K  A + I D+   +PLH    +    VL  L+
Sbjct: 574 ELLKNGADLAIKDDENRSPLHLTIWESNIQVLNTLL 609

>YIL112W (HOS4) [2564] chr9 (151592..154843) Component of Set3p
           complex that has histone deacetylase activity and a role
           in repression of meiotic-specific sporulation gene
           expression, contains ankyrin repeats [3252 bp, 1083 aa]
          Length = 1083

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/98 (36%), Positives = 57/98 (58%), Gaps = 2/98 (2%)

Query: 65  ACQRGDLEVVREMIHGGQVNVSSDADREGVTGLHWAAINNRLNVVDFLVREGANVESKAG 124
           AC +G  +VV++MI  G  +++ D D  G T LH AA+   + +V+ L+  GA+V  K+ 
Sbjct: 337 ACDKGKYDVVKKMIEEGGYDIN-DQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSI 395

Query: 125 AL-EATPLHWAARYGFVYVVDYLLQHGASATTTDKQGF 161
            +   TPL  A+  G + VV YLL++GA  T  + +G 
Sbjct: 396 EMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNAKGL 433

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 43/80 (53%), Gaps = 2/80 (2%)

Query: 179 VLFFVVSKGIIDIDYVDPKGRTALLWAAYQGDSLTVAALIKFNASVKIA--DEGGFTPLH 236
           V+  ++ +G  DI+  D  G TAL  AA QG    V  LI+  A V I   +  G TPL 
Sbjct: 345 VVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLI 404

Query: 237 WGTVKGQPHVLKYLIQDGAD 256
             +  G   V+KYL+++GAD
Sbjct: 405 DASANGHLDVVKYLLKNGAD 424

 Score = 33.5 bits (75), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 6/65 (9%)

Query: 90  DREGVTGLHWAAINNRLNVVDFLVREGA---NVESKAGALEATPLHWAARYGFVYVVDYL 146
           D  G T L  A    + +VV  ++ EG    N +  AG    T LH AA  G + +V+ L
Sbjct: 327 DSGGRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGN---TALHEAALQGHIEIVELL 383

Query: 147 LQHGA 151
           +++GA
Sbjct: 384 IENGA 388

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 63  HNACQRGDLEVVREMI-HGGQVNVSSDADREGVTGLHWAAINNRLNVVDFLVREGAN 118
           H A  +G +E+V  +I +G  VN+ S  +  G T L  A+ N  L+VV +L++ GA+
Sbjct: 369 HEAALQGHIEIVELLIENGADVNIKS-IEMFGDTPLIDASANGHLDVVKYLLKNGAD 424

>Kwal_23.4914
          Length = 1043

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 59/106 (55%), Gaps = 3/106 (2%)

Query: 60  SKYHNACQRGDLEVVREMIHGGQVNVSSDADREGVTGLHWAAINNRLNVVDFLVREGANV 119
           +K   AC +G+ EV + +I  G  NV  D D  G + LH AA+N  L++V+ L+  GA+V
Sbjct: 324 TKLQIACDKGNYEVAKRLIQEG-YNVD-DQDNAGNSSLHEAALNGHLDIVELLLESGASV 381

Query: 120 ESKA-GALEATPLHWAARYGFVYVVDYLLQHGASATTTDKQGFNLL 164
             ++   +  TPL  AA  G + VV  LL+H A  T T+ +G   +
Sbjct: 382 NVQSHEPIRDTPLIDAAANGHLDVVKVLLRHRADPTITNSKGLTAI 427

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 50/111 (45%), Gaps = 9/111 (8%)

Query: 93  GVTGLHWAAINNRLNVVDFLVREGANVESKAGALEATPLHWAARYGFVYVVDYLLQHGAS 152
           G T L  A       V   L++EG NV+ +  A  ++ LH AA  G + +V+ LL+ GAS
Sbjct: 322 GRTKLQIACDKGNYEVAKRLIQEGYNVDDQDNAGNSS-LHEAALNGHLDIVELLLESGAS 380

Query: 153 ATTTDKQGFNLLHLSVNSSNIML-VVYVLF-------FVVSKGIIDIDYVD 195
                 +      L   ++N  L VV VL           SKG+  I+ ++
Sbjct: 381 VNVQSHEPIRDTPLIDAAANGHLDVVKVLLRHRADPTITNSKGLTAIESIE 431

 Score = 30.4 bits (67), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 30/63 (47%)

Query: 193 YVDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGFTPLHWGTVKGQPHVLKYLIQ 252
           + D  GRT L  A  +G+      LI+   +V   D  G + LH   + G   +++ L++
Sbjct: 317 HRDAGGRTKLQIACDKGNYEVAKRLIQEGYNVDDQDNAGNSSLHEAALNGHLDIVELLLE 376

Query: 253 DGA 255
            GA
Sbjct: 377 SGA 379

>CAGL0C01309g 136270..139602 similar to sp|P40480 Saccharomyces
           cerevisiae YIL112w, hypothetical start
          Length = 1110

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 56/98 (57%), Gaps = 2/98 (2%)

Query: 65  ACQRGDLEVVREMIHGGQVNVSSDADREGVTGLHWAAINNRLNVVDFLVREGANVESKAG 124
           AC +G  +V + +I     +V+ D D  G + LH AA+N  L++V  L+  GANV  ++ 
Sbjct: 368 ACDKGKYDVAKRLIEEEDYDVN-DQDNAGNSALHEAALNGHLSIVKLLISHGANVNIQSY 426

Query: 125 AL-EATPLHWAARYGFVYVVDYLLQHGASATTTDKQGF 161
            + + TPL  A+  G + +V YLL+HGA  T  + +G 
Sbjct: 427 EMFKDTPLVDASANGHLDIVRYLLRHGADPTIPNAKGL 464

 Score = 33.1 bits (74), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 40/82 (48%), Gaps = 7/82 (8%)

Query: 182 FVVSKGII-----DIDYVDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGF--TP 234
           + V+K +I     D++  D  G +AL  AA  G    V  LI   A+V I     F  TP
Sbjct: 374 YDVAKRLIEEEDYDVNDQDNAGNSALHEAALNGHLSIVKLLISHGANVNIQSYEMFKDTP 433

Query: 235 LHWGTVKGQPHVLKYLIQDGAD 256
           L   +  G   +++YL++ GAD
Sbjct: 434 LVDASANGHLDIVRYLLRHGAD 455

>Scas_595.8
          Length = 235

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 91/202 (45%), Gaps = 17/202 (8%)

Query: 59  LSKYHNACQRGDLEVVREMIHGGQVNVSSDA---DREGVTGLHWAAINNRLNVVDFLVR- 114
           L   H AC  G+L  V+E++   ++    D    D +  T LHWA    R  +V +L+  
Sbjct: 7   LYPLHQACMDGNLAKVQELVE--ELATPDDIVALDSDNRTPLHWAVSFQREEIVTYLLSF 64

Query: 115 -EGANVESKAGALEATPLHWAARYGFVYVVDYLLQH--GASATTTDKQGFNLLHLSVNSS 171
            +  +++      E TP+H AA  G ++++  L             KQG   LHLSV   
Sbjct: 65  MKEIDLDKLKDDSEWTPVHIAASVGNLFILTQLYDREIKPDLNLQTKQGTTALHLSVAKK 124

Query: 172 NIMLVVYVLFFVVSKGIIDIDYVDPKGRTALLWAAYQGDSLTVAALI--KFNASVKIADE 229
           ++     V  F++  G   +   D KG+  L  AA  G S+T+  L+  +  + V + D+
Sbjct: 125 HL----SVCKFLIDNG-ASVRLKDQKGQLPLHRAASIG-SMTLVELLCTQGKSPVNVRDK 178

Query: 230 GGFTPLHWGTVKGQPHVLKYLI 251
            G+TPL     +G   +   L+
Sbjct: 179 QGWTPLFHALAEGHGDIALLLV 200

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 74/170 (43%), Gaps = 12/170 (7%)

Query: 92  EGVTGLHWAAINNRLNVVDFLVREGANVESKAGALEA---TPLHWAARYGFVYVVDYLLQ 148
           E +  LH A ++  L  V  LV E A  +    AL++   TPLHWA  +    +V YLL 
Sbjct: 5   EKLYPLHQACMDGNLAKVQELVEELATPDDIV-ALDSDNRTPLHWAVSFQREEIVTYLLS 63

Query: 149 HGASA---TTTDKQGFNLLHLSVNSSNIMLVVYVLFFVVSKGI-IDIDYVDPKGRTALLW 204
                      D   +  +H++ +  N+    ++L  +  + I  D++    +G TAL  
Sbjct: 64  FMKEIDLDKLKDDSEWTPVHIAASVGNL----FILTQLYDREIKPDLNLQTKQGTTALHL 119

Query: 205 AAYQGDSLTVAALIKFNASVKIADEGGFTPLHWGTVKGQPHVLKYLIQDG 254
           +  +        LI   ASV++ D+ G  PLH     G   +++ L   G
Sbjct: 120 SVAKKHLSVCKFLIDNGASVRLKDQKGQLPLHRAASIGSMTLVELLCTQG 169

 Score = 33.1 bits (74), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 56/132 (42%), Gaps = 9/132 (6%)

Query: 130 PLHWAARYGFVYVVDYLLQHGASA---TTTDKQGFNLLHLSVNSSNIMLVVYVLFFVVSK 186
           PLH A   G +  V  L++  A+       D      LH +V+     +V Y+L F+   
Sbjct: 9   PLHQACMDGNLAKVQELVEELATPDDIVALDSDNRTPLHWAVSFQREEIVTYLLSFMKE- 67

Query: 187 GIIDIDYV-DPKGRTALLWAAYQGDSLTVAALI--KFNASVKIADEGGFTPLHWGTVKGQ 243
             ID+D + D    T +  AA  G+   +  L   +    + +  + G T LH    K  
Sbjct: 68  --IDLDKLKDDSEWTPVHIAASVGNLFILTQLYDREIKPDLNLQTKQGTTALHLSVAKKH 125

Query: 244 PHVLKYLIQDGA 255
             V K+LI +GA
Sbjct: 126 LSVCKFLIDNGA 137

>Scas_671.30
          Length = 1054

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 56/98 (57%), Gaps = 2/98 (2%)

Query: 65  ACQRGDLEVVREMIHGGQVNVSSDADREGVTGLHWAAINNRLNVVDFLVREGANVESKAG 124
           AC +G  +V + +I     +V+ D D  G + LH AA+N  +++V  L+  GANV  ++ 
Sbjct: 311 ACDKGKYDVAKRLIEEEGYDVN-DQDNAGNSALHEAALNGHISIVKLLIDNGANVNIQSY 369

Query: 125 AL-EATPLHWAARYGFVYVVDYLLQHGASATTTDKQGF 161
            + + TPL  A+  G + VV  LL++GA  T T+ +G 
Sbjct: 370 EMFQDTPLVDASANGHLDVVQLLLENGADPTITNAKGI 407

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 48/106 (45%), Gaps = 7/106 (6%)

Query: 158 KQGFNLLHLSVNSSNIMLVVYVLFFVVSKGII-----DIDYVDPKGRTALLWAAYQGDSL 212
           KQ  N+   S   + + +      + V+K +I     D++  D  G +AL  AA  G   
Sbjct: 293 KQKKNVYRDSGGRNRLQIACDKGKYDVAKRLIEEEGYDVNDQDNAGNSALHEAALNGHIS 352

Query: 213 TVAALIKFNASVKIADEGGF--TPLHWGTVKGQPHVLKYLIQDGAD 256
            V  LI   A+V I     F  TPL   +  G   V++ L+++GAD
Sbjct: 353 IVKLLIDNGANVNIQSYEMFQDTPLVDASANGHLDVVQLLLENGAD 398

>ADL244W [1497] [Homologous to ScYIL112W - SH]
           complement(273379..276648) [3270 bp, 1089 aa]
          Length = 1089

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 57/102 (55%), Gaps = 5/102 (4%)

Query: 65  ACQRGDLEVVREMIHGG-QVNVSSDADREGVTGLHWAAINNRLNVVDFLVREGANVESKA 123
           AC +G  ++ R++I  G  VN   D D  G + LH AA+N  L VV  L+R GANV  ++
Sbjct: 348 ACDKGKYDLARKLIEEGYDVN---DQDNAGNSPLHEAALNGHLEVVKLLIRHGANVNIQS 404

Query: 124 GAL-EATPLHWAARYGFVYVVDYLLQHGASATTTDKQGFNLL 164
             + + TPL  A+  G + ++  LLQ+GA  T  + +G   +
Sbjct: 405 YEMFKDTPLIDASANGHLDILRELLQNGADPTIVNAKGLTAI 446

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 30/65 (46%)

Query: 193 YVDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGFTPLHWGTVKGQPHVLKYLIQ 252
           Y D  GRT L  A  +G       LI+    V   D  G +PLH   + G   V+K LI+
Sbjct: 336 YRDAGGRTRLQVACDKGKYDLARKLIEEGYDVNDQDNAGNSPLHEAALNGHLEVVKLLIR 395

Query: 253 DGADF 257
            GA+ 
Sbjct: 396 HGANV 400

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 34/69 (49%), Gaps = 2/69 (2%)

Query: 190 DIDYVDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGF--TPLHWGTVKGQPHVL 247
           D++  D  G + L  AA  G    V  LI+  A+V I     F  TPL   +  G   +L
Sbjct: 366 DVNDQDNAGNSPLHEAALNGHLEVVKLLIRHGANVNIQSYEMFKDTPLIDASANGHLDIL 425

Query: 248 KYLIQDGAD 256
           + L+Q+GAD
Sbjct: 426 RELLQNGAD 434

>AGL125C [4187] [Homologous to ScYLR246W (ERF2) - SH]
           (473496..474599) [1104 bp, 367 aa]
          Length = 367

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 72/164 (43%), Gaps = 29/164 (17%)

Query: 371 LIAGILFGSIFWLAFVWILRILPYTFTKRPLGNLTFCAILCFVCYSLFLLAF-----SDP 425
           LIA I+  S+F   ++W           + +     C +LC+  ++L   +F     +DP
Sbjct: 97  LIAPIVLFSVFETGYLW-----------KHVAGAKPCVVLCYYFWTLCFASFISTGATDP 145

Query: 426 G------HIGSENDHEKIRE------TISNLLKEGKFDTRSFCLETWVRKPLRSKYSYLN 473
           G      H+    D  K+        T+ + +       + +C    + +P R+ +  + 
Sbjct: 146 GTLPRNIHLAQLQDDYKLPLEYYSIITLPSPVANAPVRLK-YCTTCRIWRPPRASHCAVC 204

Query: 474 DALILRFDHYCPWIYNDVGLKNHKLFIFFILALELGIFSFVKVC 517
           D+ IL FDH+C W+ N +G +NH+ F+ F+ +  L     +  C
Sbjct: 205 DSCILSFDHHCDWLNNCIGQRNHRYFLAFLFSSVLSSIWLLTCC 248

>YGR232W (NAS6) [2180] chr7 (953961..954647) Protein interacting
           with regulatory particle of the 26S proteasome [687 bp,
           228 aa]
          Length = 228

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 64/143 (44%), Gaps = 6/143 (4%)

Query: 60  SKYHNACQRGDLEVVREMIHGGQVNVSSDADREGVTGLHWAAINNRLNVVDFLVREGANV 119
           + +H AC  G+LEVV+ +         +    +GVT LH A       V  FL+  GA+V
Sbjct: 74  TPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASV 133

Query: 120 ESKAGALEATPLHWAARYGFVYVVDYLLQHGASATT-TDKQGFNLLHLSVNSSNIMLVVY 178
             K       PLH AA  G + +++ L   G SA    DKQG+  L  ++   +    V 
Sbjct: 134 RIK-DKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAV- 191

Query: 179 VLFFVVSKGIIDIDYVDPKGRTA 201
               +V K   + D VD KG  A
Sbjct: 192 ---LLVEKYGAEYDLVDNKGAKA 211

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 80/205 (39%), Gaps = 20/205 (9%)

Query: 63  HNACQRGDLEVVREMIHGGQVNVSSDADREGVTGLHWAAINNRLNVVDFLVR--EGANVE 120
           H AC   +   V+E++H  + ++    D++G   LHW+       +  FL+   E  N++
Sbjct: 7   HQACMENEFFKVQELLHS-KPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLD 65

Query: 121 SKAGALEATPLHWAARYGFVYVVDYLLQH--GASATTTDKQGFNLLHLSVNSSNIMLVVY 178
                   TP H A   G + VV  L              QG   LHL+V          
Sbjct: 66  DYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKK------- 118

Query: 179 VLFFVVSKGIID----IDYVDPKGRTALLWAAYQGDSLTVAALIKFNAS-VKIADEGGFT 233
             +F VS+ +I+    +   D   +  L  AA  G    +  L     S V   D+ G+T
Sbjct: 119 --WFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWT 176

Query: 234 PLHWGTVKGQPHVLKYLIQD-GADF 257
           PL     +G       L++  GA++
Sbjct: 177 PLFHALAEGHGDAAVLLVEKYGAEY 201

>Kwal_27.12750
          Length = 233

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 87/209 (41%), Gaps = 12/209 (5%)

Query: 63  HNACQRGDLEVVREMIHGGQ-VNVSSDADREGVTGLHWAAINNRLNVVDFLVREGANVES 121
           H AC+ G    VRE+++    + +S D D      +HWA       VVD L+    NV+ 
Sbjct: 11  HEACREGQEGKVRELLNEDPGLCLSKDLDSR--YPIHWAVSYQHEKVVDLLLSHMRNVDL 68

Query: 122 KAGALEA--TPLHWAARYGFVYVVDYLLQHGASATT--TDKQGFNLLHLSVNSSNIMLVV 177
                E+  +PLH A+  G + +V  LL             QG   LHL+ +  ++    
Sbjct: 69  DDLVDESGWSPLHIASSVGNLNIVKSLLSLSIKPDLDLATSQGVTALHLACSKQHLP--- 125

Query: 178 YVLFFVVSKGIIDIDYVDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGFTPLHW 237
            V   ++ +G   +   D + + AL  AA  G+   V  L    + V   D  G+TPL  
Sbjct: 126 -VASLLIEEGA-SVRKKDTRNQLALHRAASVGNIPLVKLLCDQKSPVNSKDTQGWTPLFH 183

Query: 238 GTVKGQPHVLKYLIQDGADFFQKTNDNKD 266
              +G   V   L+ +    ++   DN D
Sbjct: 184 ALSEGHGDVAVLLVLEYNAEYRDLRDNND 212

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 49/108 (45%), Gaps = 7/108 (6%)

Query: 60  SKYHNACQRGDLEVVREMIHGGQVNVSSDAD---REGVTGLHWAAINNRLNVVDFLVREG 116
           S  H A   G+L +V+ ++    +++  D D    +GVT LH A     L V   L+ EG
Sbjct: 78  SPLHIASSVGNLNIVKSLL---SLSIKPDLDLATSQGVTALHLACSKQHLPVASLLIEEG 134

Query: 117 ANVESKAGALEATPLHWAARYGFVYVVDYLLQHGASATTTDKQGFNLL 164
           A+V  K        LH AA  G + +V  L    +   + D QG+  L
Sbjct: 135 ASVRKK-DTRNQLALHRAASVGNIPLVKLLCDQKSPVNSKDTQGWTPL 181

>Scas_716.48
          Length = 327

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 81/191 (42%), Gaps = 41/191 (21%)

Query: 429 GSENDHEKIRETISNLLKEGKFDTRSFCLETWVRKPLRSKYSYLNDALILRFDHYCPWIY 488
           G E   E I +    L K+G++     C    V KP R  +    D  IL+ DH+CPW  
Sbjct: 77  GIELPPEYIAKRSFTLKKDGRY---RLCQTCQVWKPDRCHHCSTCDKCILKMDHHCPWFA 133

Query: 489 NDVGLKNHKLFIFFIL---ALELGIFSFVKVCLKYFDELDMDGDCFILGDDDLCSGLIGD 545
             +G +N K F+ F++   A  + +  F    L Y+      G  +   +D+L       
Sbjct: 134 ECIGFENQKYFVQFLIYCTAYSIVVLFFTSCELHYW----FSGKQY---EDEL------- 179

Query: 546 RFTFLIMTWACIQAVWIFSLVIV---------QLFQITKGLTNSELNALIREGRRVDI-- 594
               +++T      VWI ++VI           ++Q+ K  T  E+  + RE R +++  
Sbjct: 180 -IDLMLLT------VWILAIVITVSLIFFSSFSIYQLLKNQTTIEMYGMKREKRDLELLR 232

Query: 595 ---DSQTHNEF 602
              D++  N F
Sbjct: 233 GLEDAEVDNIF 243

>ADL143W [1598] [Homologous to ScYGR233C (PHO81) - SH]
           complement(440265..443573) [3309 bp, 1102 aa]
          Length = 1102

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 59/127 (46%), Gaps = 10/127 (7%)

Query: 57  PILSKYHNACQRGDLEVVREMIHGGQVNVSSDADREGVTGLHWAAINN-RLNVVDFLVRE 115
           P  S    AC   +L   R ++  G +N++   D +G+  LH  A N   + +++ LV  
Sbjct: 474 PQFSPLSVACANKNLTAARMILEIGNINLNDVCDSQGLQPLHIVAKNGGDVELIELLVSH 533

Query: 116 GANVESKAGALEATPLHWAARYGFVYVVDYLLQHGASATTTDKQGFNLL-------HLSV 168
           GAN  +  G  + TP+ +A + G+   V  LL +GA     D    + L       HLSV
Sbjct: 534 GANPNAVDGFNKWTPIFYAVQEGYGSTVQNLLSNGAKLDVVDGDNLSPLFYALWEGHLSV 593

Query: 169 NSSNIML 175
              NI+L
Sbjct: 594 --LNILL 598

>YNL326C (YNL326C) [4289] chr14 complement(27336..28346) Protein
           with similarity to Akr1p and Swf1p [1011 bp, 336 aa]
          Length = 336

 Score = 48.9 bits (115), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 73/184 (39%), Gaps = 22/184 (11%)

Query: 429 GSENDHEKIRETISNLLKEGKFDTRSFCLETWVRKPLRSKYSYLNDALILRFDHYCPWIY 488
           G E   E + +    L  +G+F     C   W  KP R  +    D  IL+ DH+CPW  
Sbjct: 82  GLELPPEYMSKRCLTLKHDGRFRVCQVC-HVW--KPDRCHHCSSCDVCILKMDHHCPWFA 138

Query: 489 NDVGLKNHKLFIFFILALELGIFSFVKVCLKYFDELDMDGDCFILGDDDLCSGLIGDRFT 548
              G +N K FI F++   L  F            L +   C+ LG     SG       
Sbjct: 139 ECTGFRNQKFFIQFLMYTTLYAF------------LVLIYTCYELG-TWFNSGSFNRELI 185

Query: 549 FLIMTWACIQAVWIFSLVIV----QLFQITKGLTNSELNALIREGRRVDI--DSQTHNEF 602
              +    + AV +F  V+      ++Q+ K  T  E++ + R  R ++I  DS   NE 
Sbjct: 186 DFHLLGVALLAVAVFISVLAFTCFSIYQVCKNQTTIEVHGMRRYRRDLEILNDSYGTNEH 245

Query: 603 FNTV 606
              +
Sbjct: 246 LENI 249

>Sklu_2319.5 YNL326C, Contig c2319 9193-10194
          Length = 333

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 71/170 (41%), Gaps = 18/170 (10%)

Query: 430 SENDHEKIRETISN----LLKEGKFDTRSFCLETWVRKPLRSKYSYLNDALILRFDHYCP 485
           +E  H    E +SN    L   G+F     C    V KP RS +    +   L+ DH+CP
Sbjct: 78  AEEGHVFPPEFLSNRSVTLKHNGRF---RICRNCKVWKPDRSHHCSSCNKCFLKMDHHCP 134

Query: 486 WIYNDVGLKNHKLFIFFILALE-LGIFSFVKVCLKYFDELDMDGDCFILGDDDLCSGLIG 544
           W  + +G KN KLFI F+L      +F F+   L+ +  L          D+ +    + 
Sbjct: 135 WFASCIGFKNQKLFIQFLLYTTWYAVFVFMTTGLQLWKWL----------DNKMYEKELI 184

Query: 545 DRFTFLIMTWACIQAVWIFSLVIVQLFQITKGLTNSELNALIREGRRVDI 594
           D     +   + I  + +F+     ++ +TK  T  E+        +++I
Sbjct: 185 DLSLMTVWLLSIISCISMFAFTSYSIYLVTKNTTTIEMYGWTHYKSQLEI 234

>Scas_679.7
          Length = 374

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 52/108 (48%), Gaps = 12/108 (11%)

Query: 413 VCYSLFL-LAFSDPG------HIGSENDHEKIRETISNLLKEGKFDTR-----SFCLETW 460
           +C   F+  A SDPG      H+GS   + +I +   N +    F T       +C    
Sbjct: 129 ICLGSFIKTATSDPGVLPRNVHLGSVQRNFQIPQEYYNQITLPTFHTDCNIVLKYCKTCR 188

Query: 461 VRKPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFILALEL 508
           + +P RS +  + +  +L  DH+C W+ N VG +N++ F+ F+ +  L
Sbjct: 189 IWRPPRSSHCSICETCVLMHDHHCVWVNNCVGQRNYRYFLTFLTSSTL 236

>Kwal_23.3302
          Length = 353

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 69/150 (46%), Gaps = 25/150 (16%)

Query: 379 SIFWLAFVWILRILPYTFTKRPLGNLT----FCAILCFVCYSLFLLAF-----SDPGHIG 429
           SIF LA + IL +L   F  RP+  L        +L +  ++  L AF     SDPG + 
Sbjct: 75  SIFVLAILVILIVLYSVFEARPVWRLGRGHGVLVVLFYYFWTTCLAAFFRTATSDPG-VL 133

Query: 430 SENDHEKIRETISNLLKEGKFDTRS--------------FCLETWVRKPLRSKYSYLNDA 475
             N H  I  +   L  +G ++  S              +C    + +P R+ +  +  A
Sbjct: 134 PRNVHVPIVSSEFEL-PQGYYNIISLPSANSNGLTVDVKYCPTCRIWRPPRASHCSVCGA 192

Query: 476 LILRFDHYCPWIYNDVGLKNHKLFIFFILA 505
            IL  DH+C W+ N +G +N++ F+ F+++
Sbjct: 193 CILNHDHHCKWVNNCIGQRNYRYFLTFLVS 222

>KLLA0D18370g complement(1549382..1550449) similar to sgd|S0004236
           Saccharomyces cerevisiae YLR246w ERF2 protein involved
           in palmitoylation and localization of RAS2P,
           hypothetical start
          Length = 355

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 49/113 (43%), Gaps = 19/113 (16%)

Query: 404 LTFCAILCFVCYSLFLLAFSDPG------HIGSENDHEKIRETISNLL-----KEGKFDT 452
           LT C+ L   C        SDPG      HI   N   KI +   N             +
Sbjct: 119 LTICSFLRAAC--------SDPGIVPRNVHIPDLNASYKIPQEYYNYAILPTKNPNASVS 170

Query: 453 RSFCLETWVRKPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFILA 505
             +C    + +P RS +  + D  +L  DH+C W+ N +G +N++ F+ F++A
Sbjct: 171 MKYCQTCRIWRPPRSAHCSVCDVCVLSHDHHCKWLNNCIGKRNYRFFLEFLMA 223

>CAGL0L06600g 742803..743498 similar to sp|P50086 Saccharomyces
           cerevisiae YGR232w, start by similarity
          Length = 231

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 68/159 (42%), Gaps = 6/159 (3%)

Query: 97  LHWAAINNRLNVVDFLVREGANVESKAGALE--ATPLHWAARYGFVYVVDYLLQHGASA- 153
           LH A +NN    V  L+      ++     +    PLHWA       ++  LL +  S  
Sbjct: 5   LHKACLNNEPRKVQELLESSDPFKAVVQRDDDGRVPLHWAVSIQSDAIIKLLLPYMKSVD 64

Query: 154 --TTTDKQGFNLLHLSVNSSNIMLVVYVLFFVVSKGIIDIDYVDPKGRTALLWAAYQGDS 211
             T TD+ G+   H+S +  ++  +V  L+        ++D    +G TAL  A  +   
Sbjct: 65  IDTLTDEAGWTPFHISCSIGHLD-IVDQLYNNNPDARPNLDLQTSQGVTALHLAVAKKHL 123

Query: 212 LTVAALIKFNASVKIADEGGFTPLHWGTVKGQPHVLKYL 250
                LIK  ASV+I D+ G   LH     G   V+++L
Sbjct: 124 EVCKYLIKLGASVRIKDKKGQIALHRAAAVGSIGVVEFL 162

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 68/149 (45%), Gaps = 14/149 (9%)

Query: 60  SKYHNACQRGDLEVVREMIHGGQVNVSSDAD---REGVTGLHWAAINNRLNVVDFLVREG 116
           + +H +C  G L++V + ++    +   + D    +GVT LH A     L V  +L++ G
Sbjct: 75  TPFHISCSIGHLDIV-DQLYNNNPDARPNLDLQTSQGVTALHLAVAKKHLEVCKYLIKLG 133

Query: 117 ANV--ESKAGALEATPLHWAARYGFVYVVDYLLQHGASATT-TDKQGFNLLHLSVNSSNI 173
           A+V  + K G +    LH AA  G + VV++L     S     D  G+  L  ++   + 
Sbjct: 134 ASVRIKDKKGQIA---LHRAAAVGSIGVVEFLCSTAKSPVNWKDASGWTPLFHAIAEGHA 190

Query: 174 MLVVYVLFFVVSKGIIDIDYVDPKGRTAL 202
            + V     +V+K   D +  D  G+  +
Sbjct: 191 DIAV----LLVNKFSADYEVEDSDGKKPI 215

 Score = 30.0 bits (66), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 26/65 (40%), Gaps = 3/65 (4%)

Query: 195 DPKGRTALLWAAYQGDSLTVAALIKFNASVKI---ADEGGFTPLHWGTVKGQPHVLKYLI 251
           D  GR  L WA        +  L+ +  SV I    DE G+TP H     G   ++  L 
Sbjct: 34  DDDGRVPLHWAVSIQSDAIIKLLLPYMKSVDIDTLTDEAGWTPFHISCSIGHLDIVDQLY 93

Query: 252 QDGAD 256
            +  D
Sbjct: 94  NNNPD 98

>ADL142C [1599] [Homologous to ScYGR232W (NAS6) - SH]
           (443625..444314) [690 bp, 229 aa]
          Length = 229

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 43/161 (26%), Positives = 63/161 (39%), Gaps = 6/161 (3%)

Query: 93  GVTGLHWAAINNRLNVVDFLVREGANVESKAGALEATPLHWAARYGFVYVVDYLLQHGAS 152
           G   LH A +N        L+ +   +     A    PLHWA  Y  V +V+ LL +   
Sbjct: 2   GDNSLHEACMNGDYARAVALLSDNPGLVRSKDADSRYPLHWAVSYQHVKIVELLLSYMLQ 61

Query: 153 A---TTTDKQGFNLLHLSVNSSNIMLVVYVLFFVVSKGIIDIDYVDPKGRTALLWAAYQG 209
               T  D   ++ +H++    N  L   +L   V      +D    +G TAL  A  + 
Sbjct: 62  VDLDTLVDDALWSPVHVAAVVGNRELFGKLLAHAVQP---SLDAATSQGTTALHLACSKQ 118

Query: 210 DSLTVAALIKFNASVKIADEGGFTPLHWGTVKGQPHVLKYL 250
               V  LI   ASV+  D+    PLH     G   ++K L
Sbjct: 119 HYAVVEDLITHGASVRKKDKKQQLPLHRACAIGSARLVKLL 159

 Score = 35.0 bits (79), Expect = 0.15,   Method: Composition-based stats.
 Identities = 35/121 (28%), Positives = 55/121 (45%), Gaps = 5/121 (4%)

Query: 60  SKYHNACQRGDLEVVREMI-HGGQVNVSSDADREGVTGLHWAAINNRLNVVDFLVREGAN 118
           S  H A   G+ E+  +++ H  Q ++ + A  +G T LH A       VV+ L+  GA+
Sbjct: 74  SPVHVAAVVGNRELFGKLLAHAVQPSLDA-ATSQGTTALHLACSKQHYAVVEDLITHGAS 132

Query: 119 VESKAGALEATPLHWAARYGFVYVVDYLLQHGASATTTDKQGF-NLLH-LSVNSSNIMLV 176
           V  K    +  PLH A   G   +V  L    +     D  G+  L H LS   ++I L+
Sbjct: 133 VRKKDKK-QQLPLHRACAIGSARLVKLLCDARSPVNAKDANGWPPLFHALSEGHADIALL 191

Query: 177 V 177
           +
Sbjct: 192 L 192

>Scas_415.1
          Length = 452

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 73/170 (42%), Gaps = 15/170 (8%)

Query: 92  EGVTGLHWAAINNRLNVVDFLVREGANVESKAGALEA-TPLHWAARYGFVYVVDYLLQHG 150
           E  T L  A I   L +V  L+R    + +        + LH+AA +G   +  +L+Q G
Sbjct: 215 EPSTRLRDAIIEGNLLIVKRLLRRHPELLTNINPANGWSSLHYAAYHGRYLICVHLIQLG 274

Query: 151 ASATTTDK--QGFNLLHLSV----NSSNIMLVVYVLFFVVSKGIIDIDYVDPKGRTALLW 204
                  K  +G   +HL++      +  +L+ +   F+  KG          GRT + +
Sbjct: 275 HDKHEIIKTFKGNTCVHLALINGHEQTTHLLLQHFPRFINEKG--------EHGRTPVHF 326

Query: 205 AAYQGDSLTVAALIKFNASVKIADEGGFTPLHWGTVKGQPHVLKYLIQDG 254
           A        ++ LI   A++ I DE G TPLH      + H +K L+ +G
Sbjct: 327 ACMYDHFQCLSLLIGVGANLTIKDEDGETPLHICLEYSRIHCMKILLSEG 376

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 46/99 (46%), Gaps = 4/99 (4%)

Query: 92  EGVTGLHWAAINNRLNVVDFLVREGANVESKAGALEATPLHWAARYGFVYVVDYLLQHGA 151
           +G T +H A IN        L++      ++ G    TP+H+A  Y     +  L+  GA
Sbjct: 285 KGNTCVHLALINGHEQTTHLLLQHFPRFINEKGEHGRTPVHFACMYDHFQCLSLLIGVGA 344

Query: 152 SATTTDKQGFNLLHLSVNSSNIMLVVYVLFFVVSKGIID 190
           + T  D+ G   LH+ +  S I    + +  ++S+G +D
Sbjct: 345 NLTIKDEDGETPLHICLEYSRI----HCMKILLSEGQLD 379

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 50/127 (39%), Gaps = 7/127 (5%)

Query: 93  GVTGLHWAAINNRLNVVDFLVREGANVESKAGALEATPLHWAARYGFVYVVDYLLQHGAS 152
           G T +H+A + +    +  L+  GAN+  K    E TPLH    Y  ++ +  LL  G  
Sbjct: 320 GRTPVHFACMYDHFQCLSLLIGVGANLTIKDEDGE-TPLHICLEYSRIHCMKILLSEGQL 378

Query: 153 ATTTDKQGFNLLHLSVNSSNIMLVVYVLFFVVSKGIIDIDYVDPKGRTALLWAAYQGDSL 212
            +   K G N   + V  S  M  +Y       K + +    DP  +  L     +  S 
Sbjct: 379 DSANIKDGNNFKPIDVIESFEMGKIY------PKTLKEEKETDPSKKNTLRALQNRNKSS 432

Query: 213 TVAALIK 219
               L++
Sbjct: 433 MPGPLMR 439

 Score = 33.1 bits (74), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 64/169 (37%), Gaps = 6/169 (3%)

Query: 125 ALEATPLHWAARYGFVYVVDYLLQHGASATTT--DKQGFNLLHLSVNSSNIMLVVYVLFF 182
           A  +T L  A   G + +V  LL+      T      G++ LH +      ++ V+++  
Sbjct: 214 AEPSTRLRDAIIEGNLLIVKRLLRRHPELLTNINPANGWSSLHYAAYHGRYLICVHLIQL 273

Query: 183 VVSKGIIDIDYVDPKGRTALLWAAYQGDSLTVAALIK-FNASVKIADEGGFTPLHWGTVK 241
              K  I   +   KG T +  A   G   T   L++ F   +    E G TP+H+  + 
Sbjct: 274 GHDKHEIIKTF---KGNTCVHLALINGHEQTTHLLLQHFPRFINEKGEHGRTPVHFACMY 330

Query: 242 GQPHVLKYLIQDGADFFQKTNDNKDCFVIAEEMSNTHSFQEALRHNNFD 290
                L  LI  GA+   K  D +    I  E S  H  +  L     D
Sbjct: 331 DHFQCLSLLIGVGANLTIKDEDGETPLHICLEYSRIHCMKILLSEGQLD 379

>YKL020C (SPT23) [3235] chr11 complement(398475..401723)
           Transcription factor required for transcription of a
           subset of genes; functionally redundant with Mga2p [3249
           bp, 1082 aa]
          Length = 1082

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 39/73 (53%)

Query: 189 IDIDYVDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGFTPLHWGTVKGQPHVLK 248
           +++   D +GRT L  AA+      V+ LIK+ + +   D  GFTPLH   + G   +++
Sbjct: 701 VNLSMCDVRGRTLLHLAAFNNWYSLVSLLIKYGSHLNDQDLFGFTPLHMACINGDLRIIR 760

Query: 249 YLIQDGADFFQKT 261
            L++   +  +KT
Sbjct: 761 LLLECNVNIMKKT 773

 Score = 37.0 bits (84), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 52/110 (47%), Gaps = 8/110 (7%)

Query: 59  LSKYHNACQR-GDLEVVREMIHGGQVNVS------SDADREGVTGLHWAAINNRLNVVDF 111
           L+ Y N  +   D +++ E+I   + N +      S  D  G T LH AA NN  ++V  
Sbjct: 669 LNSYTNMMRNINDEQLITEVIKSFKRNNNLSTVNLSMCDVRGRTLLHLAAFNNWYSLVSL 728

Query: 112 LVREGANVESKAGALEATPLHWAARYGFVYVVDYLLQHGASATTTDKQGF 161
           L++ G+++  +      TPLH A   G + ++  LL+   +     + GF
Sbjct: 729 LIKYGSHLNDQ-DLFGFTPLHMACINGDLRIIRLLLECNVNIMKKTRNGF 777

>CAGL0E02497g complement(241118..242248) similar to tr|Q12006
           Saccharomyces cerevisiae YOL003c, start by similarity
          Length = 376

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 46/108 (42%), Gaps = 15/108 (13%)

Query: 406 FCAILCFVCYSLFLLAFSDPGHIGSENDHEKIRETISNLLKEGKFDTRSFCLETWVRKPL 465
           FC  + ++ Y  +L  ++ PG   +               K  K + + +C +    KP 
Sbjct: 45  FCQTMIWLSY--YLAIYTPPGKPPTN-------------FKPSKNEWKVYCKKCKCYKPE 89

Query: 466 RSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFILALELGIFSF 513
           RS +    +  +L  DH+CPW  N VG  N   FI F+  + +G  S 
Sbjct: 90  RSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSL 137

>KLLA0E18029g complement(1600015..1603470) weakly similar to
           sp|P40578 Saccharomyces cerevisiae YIR033w MGA2 may be
           involved in the remodeling chromatin structure, start by
           similarity
          Length = 1151

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 69/147 (46%), Gaps = 16/147 (10%)

Query: 152 SATTTDKQGFNLLHLSVNSSNI------MLVVYVLFFVVSKGIIDIDYVDPKGRTALLWA 205
           S+  +    +N    + NSSN       ML++ V+  +      ++   +  G+T L  A
Sbjct: 719 SSNISPSTNYNADSYATNSSNQVYYSDEMLILKVVKLLNPGS--NLSMCNSDGQTMLHLA 776

Query: 206 AYQGDSLTVAALIKFNASVKIADEGGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTNDNK 265
             +G    V+AL+K  A V + D  GFTPLH+  + G    ++ L++  A+   + ++  
Sbjct: 777 CLKGYFHLVSALVKKGARVDVTDSFGFTPLHFACINGDVKAIQLLVECKANVTARADNGV 836

Query: 266 DCF-------VIAEEMSNTHSFQEALR 285
           D         V A E +N++  ++ALR
Sbjct: 837 DALDLYKSQHVSAAEKNNSY-IEDALR 862

 Score = 37.4 bits (85), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 49/96 (51%), Gaps = 4/96 (4%)

Query: 71  LEVVREMIHGGQVNVSSDADREGVTGLHWAAINNRLNVVDFLVREGANVESKAGALEATP 130
           L+VV+ +  G  +++    + +G T LH A +    ++V  LV++GA V+    +   TP
Sbjct: 750 LKVVKLLNPGSNLSM---CNSDGQTMLHLACLKGYFHLVSALVKKGARVDV-TDSFGFTP 805

Query: 131 LHWAARYGFVYVVDYLLQHGASATTTDKQGFNLLHL 166
           LH+A   G V  +  L++  A+ T     G + L L
Sbjct: 806 LHFACINGDVKAIQLLVECKANVTARADNGVDALDL 841

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 4/62 (6%)

Query: 63  HNACQRGDLEVVREMIH-GGQVNVSSDADREGVTGLHWAAINNRLNVVDFLVREGANVES 121
           H AC +G   +V  ++  G +V+V+   D  G T LH+A IN  +  +  LV   ANV +
Sbjct: 774 HLACLKGYFHLVSALVKKGARVDVT---DSFGFTPLHFACINGDVKAIQLLVECKANVTA 830

Query: 122 KA 123
           +A
Sbjct: 831 RA 832

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 41/87 (47%), Gaps = 4/87 (4%)

Query: 112 LVREGANVESKAGALEATPLHWAARYGFVYVVDYLLQHGASATTTDKQGFNLLHLSV--- 168
           L+  G+N+ S   +   T LH A   G+ ++V  L++ GA    TD  GF  LH +    
Sbjct: 755 LLNPGSNL-SMCNSDGQTMLHLACLKGYFHLVSALVKKGARVDVTDSFGFTPLHFACING 813

Query: 169 NSSNIMLVVYVLFFVVSKGIIDIDYVD 195
           +   I L+V     V ++    +D +D
Sbjct: 814 DVKAIQLLVECKANVTARADNGVDALD 840

>CAGL0F06831g 668173..671451 similar to sp|P40578 Saccharomyces
           cerevisiae YIR033w MGA2 or sp|P35210 Saccharomyces
           cerevisiae YKL020c SPT23, hypothetical start
          Length = 1092

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 38/72 (52%)

Query: 190 DIDYVDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGFTPLHWGTVKGQPHVLKY 249
           ++   D  GRT L  A+ +G    V+ LIK  A +   D   FTPLH+  V G   +++ 
Sbjct: 723 NLSMCDNLGRTLLHLASLKGYFKLVSTLIKKGARIDDKDSFDFTPLHFACVSGDVKIIRI 782

Query: 250 LIQDGADFFQKT 261
           L+  GAD  +KT
Sbjct: 783 LLDCGADKNRKT 794

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 39/77 (50%), Gaps = 1/77 (1%)

Query: 90  DREGVTGLHWAAINNRLNVVDFLVREGANVESKAGALEATPLHWAARYGFVYVVDYLLQH 149
           D  G T LH A++     +V  L+++GA ++ K  + + TPLH+A   G V ++  LL  
Sbjct: 728 DNLGRTLLHLASLKGYFKLVSTLIKKGARIDDK-DSFDFTPLHFACVSGDVKIIRILLDC 786

Query: 150 GASATTTDKQGFNLLHL 166
           GA      K G   L L
Sbjct: 787 GADKNRKTKHGLLPLEL 803

>Kwal_55.22126
          Length = 360

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 443 NLLKEGKFDTRSFCLETWVRKPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFF 502
            L + G+F    FC    V KP R  +    +   L+ DH+CPW  + VG +N K FI F
Sbjct: 123 TLKRNGRF---RFCRTCVVWKPDRCHHCSGCNKCYLKMDHHCPWFASCVGYRNQKYFIHF 179

Query: 503 IL 504
           +L
Sbjct: 180 LL 181

>YPL110C (YPL110C) [5334] chr16 complement(341067..344738) Member of
           the glycerophosphoryl diester phosphodiesterase family,
           contains six ankyrin (Ank) repeats and a SYG1, Pho81 and
           XPR1 (SPX) N-terminal domain, has weak similarity to S.
           cerevisiae Pho81p, which is a cyclin-dependent kinase
           (CDK) inhibitor [3672 bp, 1223 aa]
          Length = 1223

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 89/200 (44%), Gaps = 27/200 (13%)

Query: 63  HNACQRGDLEVVREMIHGGQV----------NVSSDADREGVTGLHWAAINNRLNVVDFL 112
           H +CQ G  EV + +I   +           +VS+  D E +T LH   +       + L
Sbjct: 433 HYSCQYGLSEVTKLIIKLMKEWNIWNEIPIDDVSAFGDAESLTPLHLCVLGAHPKTTEVL 492

Query: 113 VRE-GANVESKAGALEATPLHWAARYGFVYVVDYLLQHGASATTTDKQGFNLLHLSVNSS 171
           ++    NV+ K+ +L    LH A  +    ++  LL       ++ +   N     ++ +
Sbjct: 493 LQSLDPNVKLKSSSL----LHLATEWNNYPLLHVLL-------SSKRFDINYQDNELHET 541

Query: 172 NIMLVVYVLFFVVSKGII----DIDYVDPK-GRTALLWAAYQGDSLTVAALIKFNASVKI 226
            + L   + FF  +  ++    D++  +   G TA+  AA +G +  V  LI  NA+  I
Sbjct: 542 PLYLACRLNFFEAAVCLLYNGADLEIREKLFGWTAIFVAAAEGFTDIVKLLIANNANFDI 601

Query: 227 ADEGGFTPLHWGTVKGQPHV 246
            DEGG+TP+    ++G  H+
Sbjct: 602 EDEGGWTPMEHAVLRGHLHI 621

>YIR033W (MGA2) [2697] chr9 (416121..419462) Transcription factor
           involved in the response to hypoxia and biosynthesis of
           unsaturated fatty acids, may be involved in the
           remodeling of chromatin structure [3342 bp, 1113 aa]
          Length = 1113

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 31/62 (50%)

Query: 190 DIDYVDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGFTPLHWGTVKGQPHVLKY 249
           +I   D  GRT L  A  +  S  V  LIK  A V   D  G TPLH+  + G P ++K 
Sbjct: 712 NISICDSLGRTLLHLACLKNYSSLVYTLIKKGARVNDIDSFGLTPLHFACISGDPKIIKM 771

Query: 250 LI 251
           L+
Sbjct: 772 LL 773

>YLR246W (ERF2) [3642] chr12 (627120..628199) Protein that, in a
           complex with Shr5p, acts as a palmitoyltransferase for
           Ras2p [1080 bp, 359 aa]
          Length = 359

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 47/102 (46%), Gaps = 12/102 (11%)

Query: 416 SLFLLAFSDPG------HIGSENDHEKIRETISNLL------KEGKFDTRSFCLETWVRK 463
           S    A SDPG      H+    ++ +I +   NL+         K  T  +C    + +
Sbjct: 123 SFIRTATSDPGVLPRNIHLSQLRNNYQIPQEYYNLITLPTHSSISKDITIKYCPSCRIWR 182

Query: 464 PLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFILA 505
           P RS +    +  ++  DH+C W+ N +G +N++ F+ F+L 
Sbjct: 183 PPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLIFLLG 224

>CAGL0G08217g complement(778823..779803) similar to tr|Q06551
           Saccharomyces cerevisiae YLR246w ERF2, hypothetical
           start
          Length = 326

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 38/77 (49%)

Query: 452 TRSFCLETWVRKPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFILALELGIF 511
           T  +C    + +P R+ +  + +  +L  DH+C W+ N VG +N++ F+ F+L+  L   
Sbjct: 156 TLKYCHTCKIWRPPRASHCSVCECCVLTHDHHCIWVNNCVGQRNYRYFLAFLLSSTLACA 215

Query: 512 SFVKVCLKYFDELDMDG 528
             +  C  +      +G
Sbjct: 216 LLIANCALHLHRALHEG 232

>Kwal_27.12751
          Length = 1093

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 51/107 (47%), Gaps = 1/107 (0%)

Query: 57  PILSKYHNACQRGDLEVVREMIHGGQVNVSSDADREGVTGLHWAAINN-RLNVVDFLVRE 115
           P  S  + AC   + E  + ++    +++SS  D  G+  LH  A N     +++ L++ 
Sbjct: 472 PQFSPLNVACAHKNYEAAQLVLKYSNIDLSSVRDSHGLCPLHIVAKNGGDAKMIELLIKH 531

Query: 116 GANVESKAGALEATPLHWAARYGFVYVVDYLLQHGASATTTDKQGFN 162
           GA+     G    TP+ +A + G    V+ LL++GA    TD+   +
Sbjct: 532 GADPNGVDGFNGWTPVFYAVQEGHRNTVEELLKNGARLDITDEDNLS 578

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 41/195 (21%), Positives = 77/195 (39%), Gaps = 11/195 (5%)

Query: 63  HNACQRGDLEVVREMIHGGQVNVSSDADREGVTGLHWAAINNRLNVVDFLVREGANVESK 122
           H AC  G  E V+ ++    ++     D +  T L  A   +   + + L+       S 
Sbjct: 405 HYACDLGKTEFVKLLVSSQLLDSVDVLDNDSRTPLVLAVSKDCSKITETLLLNAHANPSP 464

Query: 123 AGALEA----TPLHWAARYGFVYVVDYLLQHGAS--ATTTDKQGFNLLHLSVNSSNIMLV 176
           +  + +    +PL+ A  +        +L++     ++  D  G   LH+   +     +
Sbjct: 465 SLEVSSRPQFSPLNVACAHKNYEAAQLVLKYSNIDLSSVRDSHGLCPLHIVAKNGGDAKM 524

Query: 177 VYVLFFVVSKGIIDIDYVDP-KGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGFTPL 235
           + +L     K   D + VD   G T + +A  +G   TV  L+K  A + I DE   +P 
Sbjct: 525 IELLI----KHGADPNGVDGFNGWTPVFYAVQEGHRNTVEELLKNGARLDITDEDNLSPY 580

Query: 236 HWGTVKGQPHVLKYL 250
            +   +G   V+  L
Sbjct: 581 FYAPWEGHLSVVNLL 595

>CAGL0D02508g 256760..257758 similar to sp|P42836 Saccharomyces
           cerevisiae YNL326c, start by similarity
          Length = 332

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 67/153 (43%), Gaps = 14/153 (9%)

Query: 362 NSASLLKSPLIAGILFGSIFWLAF-VWILR---ILPYTFTKRPLGNLTFCAILCFVC--- 414
           N + L    L  G+   S++ +   + ++R   +LP  FT   +   T+ A L +V    
Sbjct: 6   NFSKLFPRCLTTGLYLWSLYAIVVCIHVIRARVVLPLVFTIAMVALYTY-AKLIYVGPGT 64

Query: 415 ---YSLFLLAFSDPGHIGSENDHEKIRETISNLLKEGKFDTRSFCLETWVRKPLRSKYSY 471
              YS+  +   +    G E   E + +      + G+F     C  +W  KP R  +  
Sbjct: 65  TKEYSILRVYDLNAAESGFELPPEMLVKRSYTQKRNGRFRVCKSC-SSW--KPDRCHHCS 121

Query: 472 LNDALILRFDHYCPWIYNDVGLKNHKLFIFFIL 504
             +  +L+ DH+CPW    VG +N K FI F++
Sbjct: 122 TCNVCVLKMDHHCPWFAGCVGYRNQKFFIQFLI 154

>ADL197C [1544] [Homologous to ScYNL326C - SH] (350993..352165)
           [1173 bp, 390 aa]
          Length = 390

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%)

Query: 455 FCLETWVRKPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFIL 504
           +C++  V KP R  +    D   LR DH+C W    +G  NHK F+ F+L
Sbjct: 170 YCVKCKVWKPDRCHHCSACDKCYLRRDHHCVWFPGCIGYNNHKFFLHFLL 219

>Scas_700.13
          Length = 1133

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 32/70 (45%)

Query: 91  REGVTGLHWAAINNRLNVVDFLVREGANVESKAGALEATPLHWAARYGFVYVVDYLLQHG 150
           R G T LH A   N   +V  L+  GAN E     L  TPL  AA  G+  V+  LLQ+G
Sbjct: 483 RSGETALHIACKYNSPEIVACLLAHGANSEVVENKLGWTPLFIAAAKGYNEVLQILLQYG 542

Query: 151 ASATTTDKQG 160
                 D  G
Sbjct: 543 CDVNLKDNAG 552

 Score = 33.5 bits (75), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 31/66 (46%), Gaps = 1/66 (1%)

Query: 198 GRTALLWAAYQGDSLTVAALIKFNASVKIADEG-GFTPLHWGTVKGQPHVLKYLIQDGAD 256
           G TAL  A        VA L+   A+ ++ +   G+TPL     KG   VL+ L+Q G D
Sbjct: 485 GETALHIACKYNSPEIVACLLAHGANSEVVENKLGWTPLFIAAAKGYNEVLQILLQYGCD 544

Query: 257 FFQKTN 262
              K N
Sbjct: 545 VNLKDN 550

>KLLA0E02068g complement(195185..196162) weakly similar to sp|P42836
           Saccharomyces cerevisiae YNL326c, hypothetical start
          Length = 325

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 3/74 (4%)

Query: 430 SENDHEKIRETISNLLKEGKFDTRSFCLETWVRKPLRSKYSYLNDALILRFDHYCPWIYN 489
           +E   + I++    + ++G F    FC    + KP R  +    +   L+ DH+CPW  +
Sbjct: 82  TEQPPDIIKDNCIFVKRDGSF---RFCQTCEIWKPDRCHHCSKCNKCFLKMDHHCPWFAS 138

Query: 490 DVGLKNHKLFIFFI 503
            VG +N K F+ F+
Sbjct: 139 CVGFRNQKFFVQFL 152

>ACR165W [1212] [Homologous to ScYKL020C (SPT23) - SH; ScYIR033W
           (MGA2) - SH] complement(644229..647648) [3420 bp, 1139
           aa]
          Length = 1139

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 41/82 (50%), Gaps = 2/82 (2%)

Query: 171 SNIMLVVYVLFFVVSKGIIDIDYVDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEG 230
           S+  L++ V+  +      +I     +G T L  A  +G    V+ L+K  A V++ D  
Sbjct: 726 SDEALLIKVIKLLTPSS--NISMCTEEGHTLLHLACLKGYYQLVSLLVKKGAHVEVTDRF 783

Query: 231 GFTPLHWGTVKGQPHVLKYLIQ 252
           GFTPLH+  V G   + + LIQ
Sbjct: 784 GFTPLHFACVNGDTRITRLLIQ 805

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 31/63 (49%), Gaps = 1/63 (1%)

Query: 92  EGVTGLHWAAINNRLNVVDFLVREGANVESKAGALEATPLHWAARYGFVYVVDYLLQHGA 151
           EG T LH A +     +V  LV++GA+VE        TPLH+A   G   +   L+Q  A
Sbjct: 750 EGHTLLHLACLKGYYQLVSLLVKKGAHVEV-TDRFGFTPLHFACVNGDTRITRLLIQCKA 808

Query: 152 SAT 154
             +
Sbjct: 809 QVS 811

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%)

Query: 129 TPLHWAARYGFVYVVDYLLQHGASATTTDKQGFNLLHLS 167
           T LH A   G+  +V  L++ GA    TD+ GF  LH +
Sbjct: 753 TLLHLACLKGYYQLVSLLVKKGAHVEVTDRFGFTPLHFA 791

>YOL003C (YOL003C) [4813] chr15 complement(321858..322994) Nuclear
           protein of unknown function [1137 bp, 378 aa]
          Length = 378

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%)

Query: 453 RSFCLETWVRKPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFILAL 506
           R+FC +    KP RS +    +  +L  DH+CPW  N VG  N+  F+ F+  +
Sbjct: 77  RNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWI 130

>CAGL0B01991g 182894..183886 similar to sp|Q04629 Saccharomyces
           cerevisiae YDR126w, hypothetical start
          Length = 330

 Score = 42.4 bits (98), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 53/102 (51%), Gaps = 10/102 (9%)

Query: 423 SDPGHIGSENDHEKIRETISNLLKEGKFDTRSFCLETWVRKPLRSKYSYLNDALILRFDH 482
           S+   IGSE      R    NLL   + + R+ C +    KP RSK+  + ++ I   DH
Sbjct: 112 SNAHQIGSEK-----RYPYDNLLYFPQHECRT-CKQV---KPARSKHCTVCNSCIYLADH 162

Query: 483 YCPWIYNDVGLKNHKLFIFFILA-LELGIFSFVKVCLKYFDE 523
           +C WI N VG+ N+  F  F+ + L L  +SF+++    F++
Sbjct: 163 HCVWINNCVGMGNYMYFYSFLCSNLLLLSYSFIRLIFIQFNK 204

>CAGL0H00935g 91979..92560 highly similar to sp|P46683 Saccharomyces
           cerevisiae YPL239w YAR1 ankyrin repeat-containing
           protein, start by similarity
          Length = 193

 Score = 41.2 bits (95), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/63 (38%), Positives = 34/63 (53%), Gaps = 12/63 (19%)

Query: 63  HNACQRGDLEVVREMIHGGQVNVSSDA----------DREGVTGLHWAAINNRLNVVDFL 112
           H A   G LEVV+ ++   QV  S+DA          ++ G T LHWA +N +L+VV +L
Sbjct: 55  HMAAANGHLEVVKYIME--QVKQSADAGAVGRYVNLQNKTGNTALHWATLNGKLDVVQYL 112

Query: 113 VRE 115
             E
Sbjct: 113 CDE 115

 Score = 40.0 bits (92), Expect = 0.002,   Method: Composition-based stats.
 Identities = 33/94 (35%), Positives = 46/94 (48%), Gaps = 20/94 (21%)

Query: 69  GDLEVVRE----MIHGGQVNVSSDADREGVTGLHWAAINNRLNVVDFLVRE-------GA 117
           GDLE ++E    +IH   +     +D  G T LH AA N  L VV +++ +       GA
Sbjct: 23  GDLESLQEIFTTLIHPKLLATCVSSD-NGSTALHMAAANGHLEVVKYIMEQVKQSADAGA 81

Query: 118 -----NVESKAGALEATPLHWAARYGFVYVVDYL 146
                N+++K G    T LHWA   G + VV YL
Sbjct: 82  VGRYVNLQNKTGN---TALHWATLNGKLDVVQYL 112

 Score = 30.8 bits (68), Expect = 3.0,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 224 VKIADEGGFTPLHWGTVKGQPHVLKYLIQD-GADFFQKTNDNKDCFVIAE 272
           V + ++ G T LHW T+ G+  V++YL  +  AD F K     D    AE
Sbjct: 86  VNLQNKTGNTALHWATLNGKLDVVQYLCDECDADPFVKNEFGHDPIFEAE 135

>Sklu_1541.2 YOL003C, Contig c1541 950-2089 reverse complement
          Length = 379

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 31/60 (51%)

Query: 445 LKEGKFDTRSFCLETWVRKPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFIL 504
            +  KF+  +FC +    KP R+ +    +  +L  DH+CPW  N VG +N   FI F+ 
Sbjct: 69  FRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLF 128

>CAGL0J07040g 675389..679126 similar to tr|Q02979 Saccharomyces
           cerevisiae YPL110c, start by similarity
          Length = 1245

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/171 (22%), Positives = 76/171 (44%), Gaps = 42/171 (24%)

Query: 129 TPLHWAARYGFVYVVDYLLQHGAS-------ATTTDK------QGFNLLHLSV------- 168
           TPLH+AA++GF  +   +++   +        +  DK      +G + +HL+V       
Sbjct: 443 TPLHYAAKFGFTGIAAEIIEMLKAWGYWKDDISLDDKDFWGDSEGLSPVHLAVLGRNTDT 502

Query: 169 -------NSSNIMLVVYVLFF-------------VVSKGIIDIDYVDPKGRTALLWAAYQ 208
                   ++N++L    L F             ++S   IDI++ D + +   L+ A  
Sbjct: 503 LKMLLDSMNNNLLLTSPTLLFLAIQTNEFDLINTILSSSRIDINFQDEQTKETALYQAVA 562

Query: 209 GDSLTVAALIKFN-ASVKIADE-GGFTPLHWGTVKGQPHVLKYLIQDGADF 257
            +     A +  N AS +I ++  G+TPL  G  +G   +++ L+ +GA+ 
Sbjct: 563 ANLFEATACLLINGASTEIKEKLFGWTPLFIGAAEGYSDIVRLLVNNGANI 613

 Score = 36.6 bits (83), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 23/104 (22%), Positives = 47/104 (45%)

Query: 65  ACQRGDLEVVREMIHGGQVNVSSDADREGVTGLHWAAINNRLNVVDFLVREGANVESKAG 124
           A Q  + +++  ++   +++++   ++   T L+ A   N       L+  GA+ E K  
Sbjct: 525 AIQTNEFDLINTILSSSRIDINFQDEQTKETALYQAVAANLFEATACLLINGASTEIKEK 584

Query: 125 ALEATPLHWAARYGFVYVVDYLLQHGASATTTDKQGFNLLHLSV 168
               TPL   A  G+  +V  L+ +GA+    D  G+  +  +V
Sbjct: 585 LFGWTPLFIGAAEGYSDIVRLLVNNGANINILDDGGWTPMEHAV 628

 Score = 34.3 bits (77), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%)

Query: 198 GRTALLWAAYQGDSLTVAALIKFNASVKIADEGGFTPLHWGTVKGQPHVLK 248
           G T L   A +G S  V  L+   A++ I D+GG+TP+    ++G   V K
Sbjct: 587 GWTPLFIGAAEGYSDIVRLLVNNGANINILDDGGWTPMEHAVLRGHLEVAK 637

>Scas_392.2
          Length = 376

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 59/151 (39%), Gaps = 22/151 (14%)

Query: 403 NLTFCAILCFVCYSLFLLAFSDPGHIGSENDHEKIRETISNLLKEGKFDTRSFCLETWVR 462
            L F + L  +  S  L  F++PG                   K  K +   FC +  + 
Sbjct: 40  QLWFQSSLTMLWISYALAIFTNPGRPAKS-------------FKPLKKEWTHFCKKCQLF 86

Query: 463 KPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFILALELGIFSFVKVCLKYFD 522
           KP R+ +    +  +L  DH+CPW  N VG KN   F+ F+         +V V   +  
Sbjct: 87  KPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLF--------WVVVTTGFLL 138

Query: 523 ELDMDGDCFILGDDDLCSGLI-GDRFTFLIM 552
              +    ++ G  DL S L      TFLI+
Sbjct: 139 YQLLKRTIYLWGVKDLPSYLFEKTEITFLII 169

>Scas_628.4
          Length = 1057

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 38/79 (48%)

Query: 186 KGIIDIDYVDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGFTPLHWGTVKGQPH 245
           K   +I   D  GRT L  A  +G S   + LI+  A + + D  G+TPLH+  V G   
Sbjct: 709 KSSSNISMCDNLGRTLLHLAVLKGYSHLTSQLIQSGARIAVKDIFGYTPLHFACVNGSIE 768

Query: 246 VLKYLIQDGADFFQKTNDN 264
           ++K L+   A     T +N
Sbjct: 769 MIKLLLSCEASVNDVTKNN 787

 Score = 30.0 bits (66), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 45/104 (43%), Gaps = 14/104 (13%)

Query: 126 LEATPLHWAARYGFVYVVDYLLQHGASATTTDKQGFNLLHLSVNSSNIMLVVYVLFFVVS 185
           L  T LH A   G+ ++   L+Q GA     D  G+  LH +  + +I ++  +L    S
Sbjct: 720 LGRTLLHLAVLKGYSHLTSQLIQSGARIAVKDIFGYTPLHFACVNGSIEMIKLLLSCEAS 779

Query: 186 KGIIDIDYVDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADE 229
              +  + + PK    +L+ + +G           NA  K+ D+
Sbjct: 780 VNDVTKNNLTPK----MLFLSNRGS----------NADAKMTDD 809

>ADR151W [1892] [Homologous to ScYMR068W - SH]
           complement(971060..972322) [1263 bp, 420 aa]
          Length = 420

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 65/160 (40%), Gaps = 9/160 (5%)

Query: 131 LHWAARYGFVYVVDYLLQHGASATTTDKQ--GFNLLHLSVNSSNIMLVVYVLFFVVSKGI 188
           LH+AA YG   +   L+Q G     T +   G   +HL++ + +     +VL     + +
Sbjct: 44  LHYAAYYGRYLICVQLIQQGHDRQGTLRTFTGSTSVHLALKNGHEQ-TTHVLLQSFPQTL 102

Query: 189 IDIDYVDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGFTPLHWGTVKGQPHVLK 248
              D     GRT    A  Q     ++ L    A + + D  G TPLH   +    + ++
Sbjct: 103 ASKDV---GGRTPAHIACMQDYHTCLSLLSSAGADLSLTDNDGNTPLHIAMMYNSVNCIR 159

Query: 249 YLIQDG---ADFFQKTNDNKDCFVIAEEMSNTHSFQEALR 285
            L+       D+ +K NDN     +A  M     FQ  ++
Sbjct: 160 LLVLGSLSEEDYLRKNNDNWKPEQLAGTMETQRVFQNLVK 199

>Scas_693.32
          Length = 329

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 59/136 (43%), Gaps = 6/136 (4%)

Query: 422 FSDPGHIGSENDHEKIRETISNLLKEGKFDTRSFCLETWVRKPLRSKYSYLNDALILRFD 481
           F+ P +    +D         NL+    F  +  C      KP RSK+  + D  +L  D
Sbjct: 107 FTKPTYTKKYSDEIDNEYAFDNLI----FYPQILCRTCQSYKPARSKHCSICDRCVLVAD 162

Query: 482 HYCPWIYNDVGLKNHKLFIFFILALELGI-FSFVK-VCLKYFDELDMDGDCFILGDDDLC 539
           H+C W+ N VG  N+  F  F++     + ++F++ + + Y   + +  +   L     C
Sbjct: 163 HHCIWVNNCVGKGNYTYFYMFLITNTFSLTYAFIRLLTIFYTTNVYLPKNTLTLTILCGC 222

Query: 540 SGLIGDRFTFLIMTWA 555
             +I   FTFL +  A
Sbjct: 223 FSVICGIFTFLQLNLA 238

>Kwal_47.18366
          Length = 356

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 44/90 (48%), Gaps = 6/90 (6%)

Query: 419 LLAFSDPGHIGSENDHEKIRETISNLLKEGKF---DTRSFCLETWVRKPLRSKYSYLNDA 475
           LL F       SE+D +   E  +  +K  +    D + + +     + L+S  ++ +  
Sbjct: 82  LLPFRIVADSESESDEKDGSEAATRSIKPPRIYQCDPQGYPIWCTACQSLKSNRTHHSST 141

Query: 476 L---ILRFDHYCPWIYNDVGLKNHKLFIFF 502
           L   I RFDHYC WI   VG KN++LF+ F
Sbjct: 142 LGYCIPRFDHYCVWIGTIVGRKNYRLFVQF 171

>ACL003C [1046] [Homologous to ScYOL003C - SH] (352024..353151)
           [1128 bp, 375 aa]
          Length = 375

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 37/71 (52%), Gaps = 4/71 (5%)

Query: 449 KFDTRSFCLETWVRKPLRSKYSYLNDALILRFDHYCPWIYNDVGLK----NHKLFIFFIL 504
           +++ +++C +    KP R+ +    +  +L  DH+CPW  N +GL+     H +F + I 
Sbjct: 73  RYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWIIA 132

Query: 505 ALELGIFSFVK 515
              + +  FVK
Sbjct: 133 TTGILLHYFVK 143

>YDR126W (SWF1) [973] chr4 (703228..704238) Protein involved in
           vacuolar trafficking and secretion, required to maintain
           wild-type abundance of polarized actin cables, possibly
           required for full induction of IME1 during early meiosis
           [1011 bp, 336 aa]
          Length = 336

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 78/179 (43%), Gaps = 31/179 (17%)

Query: 456 CLETWVRKPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFILALELGIFSFVK 515
           C    + KP RSK+  + +  +L  DH+C WI N +G  N+  F  F+++    IFS   
Sbjct: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLIS---NIFSMCY 192

Query: 516 VCLK-YFDELDMDGDCFILGDDDLCSGLIGDRFTFLIMTWACIQAVWIFSLVIVQLFQIT 574
             L+ ++  L+            L   ++    T L   +  I A++ +    +QL  + 
Sbjct: 193 AFLRLWYISLN--------STSTLPRAVLT--LTILCGCFTIICAIFTY----LQLAIVK 238

Query: 575 KGLTNSE------LNALIREGRRVDIDSQTHNEFFNTVPEGFINNKDTEEEAAPPVRNN 627
           +G+T +E      +   +REG+ V           +  P  F    + +++AA P+++ 
Sbjct: 239 EGMTTNEQDKWYTIQEYMREGKLV-------RSLDDDCPSWFFKCTEQKDDAAEPLQDQ 290

>Sklu_2202.8 YPL110C, Contig c2202 8829-12932
          Length = 1367

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 64/155 (41%), Gaps = 5/155 (3%)

Query: 89  ADREGVTGLHWAAINNRLNVVDFLVREGANVESKAGALEATPLHWAARYGFVYVVDYLLQ 148
            D EG+T LH A I      V  L    + +        +  LH A R     ++D LL 
Sbjct: 502 GDSEGLTPLHLAVIGTHPMTVKVL---NSFINPNKALHSSHLLHLATRLNSPELIDALL- 557

Query: 149 HGASATTTDKQGFNLLHLSVNSSNIMLVVYVLFFVVSKGIIDIDYVDPKGRTALLWAAYQ 208
              +    D Q       ++  ++ + +V    F++ KG          G T +  AA +
Sbjct: 558 -SVNGFEIDYQDEETRETALYIASKLNLVEATTFLLEKGASTELGEKFFGWTPMFAAATE 616

Query: 209 GDSLTVAALIKFNASVKIADEGGFTPLHWGTVKGQ 243
           G +  V  L+K+ A   I+DE G+TP+    ++G 
Sbjct: 617 GYADIVRLLLKYGAKYDISDESGWTPMEHAALRGH 651

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 44/84 (52%), Gaps = 2/84 (2%)

Query: 78  IHGGQVNVSSDADREGVTGLHWAAINNRLNVVDFLVREGANVESKAGALEATPLHWAARY 137
           ++G +++   +  RE  T L+ A+  N +    FL+ +GA+ E        TP+  AA  
Sbjct: 559 VNGFEIDYQDEETRE--TALYIASKLNLVEATTFLLEKGASTELGEKFFGWTPMFAAATE 616

Query: 138 GFVYVVDYLLQHGASATTTDKQGF 161
           G+  +V  LL++GA    +D+ G+
Sbjct: 617 GYADIVRLLLKYGAKYDISDESGW 640

>Kwal_14.889
          Length = 1094

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 56/121 (46%), Gaps = 5/121 (4%)

Query: 152 SATTTDKQGFNLLHLSVNSSNIMLVVYVLFFVVSKGIIDIDYVDPKGRTALLWAAYQGDS 211
           SA    + G++     V  S+  L++ V+  + S    ++   D  G+T L  A  +G  
Sbjct: 690 SANGAPQNGYSKGSGQVMFSDESLLLKVIKLLNSSS--NLSMCDEDGQTMLHLACLKGYY 747

Query: 212 LTVAALIKFNASVKIADEGGFTPLHWGTVKGQPHVLKYLIQDGADFFQKT---NDNKDCF 268
             V+AL++  A V   D  GF PLH+  + G   ++  L+Q  A    +T   +  +D F
Sbjct: 748 NLVSALVRKGARVDAKDSFGFLPLHFACLNGDARIISLLVQCKATIHAETINGSTPRDLF 807

Query: 269 V 269
           V
Sbjct: 808 V 808

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 1/63 (1%)

Query: 90  DREGVTGLHWAAINNRLNVVDFLVREGANVESKAGALEATPLHWAARYGFVYVVDYLLQH 149
           D +G T LH A +    N+V  LVR+GA V++K  +    PLH+A   G   ++  L+Q 
Sbjct: 731 DEDGQTMLHLACLKGYYNLVSALVRKGARVDAK-DSFGFLPLHFACLNGDARIISLLVQC 789

Query: 150 GAS 152
            A+
Sbjct: 790 KAT 792

>YGR233C (PHO81) [2181] chr7 complement(954675..958211)
           Cyclin-dependent kinase (CDK) inhibitor for
           Pho80p-Pho85p cyclin-dependent protein kinase complex,
           positive regulator of phosphate pathway [3537 bp, 1178
           aa]
          Length = 1178

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 86/218 (39%), Gaps = 28/218 (12%)

Query: 63  HNACQRGDLEVVREMIHGGQVNVSSDADREGVTGLHWAAINNRLNVV-DFLVREGANVES 121
           H A + G LE V  ++    +      D +  T L  A  NN ++VV D L   GAN   
Sbjct: 429 HYAAELGKLEFVHSLLITNLLEDVDPIDSDSKTPLVLAITNNHIDVVRDLLTIGGANASP 488

Query: 122 -------------KAGALEATPLHWAARYGFVYVVDYLLQHGASATTTDKQGFNLLHL-- 166
                         +  ++  PL+ A ++        LL+  +     + +  +  HL  
Sbjct: 489 IEKPILDYSKNVISSTKVQFDPLNVACKFNNHDAAKLLLEIRSKQNADNAKNKSSQHLCQ 548

Query: 167 ---SVNSSNIMLVVYV--------LFFVVSKGIIDIDYVDPKGR-TALLWAAYQGDSLTV 214
                NS+ +  +  V        L  ++ +   D + +D   + T + +A   G S  +
Sbjct: 549 PLFKKNSTGLCTLHIVAKIGGDPQLIQLLIRYGADPNEIDGFNKWTPIFYAVRSGHSEVI 608

Query: 215 AALIKFNASVKIADEGGFTPLHWGTVKGQPHVLKYLIQ 252
             L+K NA + I D+ G +PL +   +    VL  L+Q
Sbjct: 609 TELLKHNARLDIEDDNGHSPLFYALWESHVDVLNALLQ 646

>CAGL0K06347g complement(623217..624275) similar to tr|Q03289
           Saccharomyces cerevisiae YDR459c, hypothetical start
          Length = 352

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 25/39 (64%)

Query: 466 RSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFIL 504
           R+K+S      + RFDHYC W+   +G KN++LF+ F+ 
Sbjct: 126 RTKHSSHQGHCVPRFDHYCVWLGAVIGFKNYRLFVQFVF 164

>KLLA0E15774g 1402940..1406386 similar to sp|P17442 Saccharomyces
           cerevisiae YGR233c PHO81 cyclin-dependent kinase
           inhibitor singleton, start by similarity
          Length = 1148

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 80/197 (40%), Gaps = 13/197 (6%)

Query: 63  HNACQRGDLEVVREMIHGGQVNVSSDADREGVTGLHWAAINNRLNVVDFLVREGANVESK 122
           H AC+ G    V  +I+   ++     D    T L  + INN + V   L+ +G NV   
Sbjct: 433 HYACELGKTNFVSLLINTELIDNIDLLDNTSKTPLVLSIINNHIEVTKILIAQG-NVNLS 491

Query: 123 AGALEAT-----PLHWAARYGFVYVVDYLLQHGAS--ATTTDKQGFNLLHLSVNSSNIML 175
               E T     PL+ A           +L+ G    +   D QG   LH+         
Sbjct: 492 PSLCEGTKPQFHPLNVACSNKNYEAAKVILEKGDINLSRLRDSQGLCPLHIVAKMGGGSE 551

Query: 176 VVYVLFFVVSKGIIDIDYVDPKGR-TALLWAAYQGDSLTVAALIKFNASVKIADEGGFTP 234
           ++ +L   VS G  D D +D   +   + +A  +G + TV  L++  A V + D+   + 
Sbjct: 552 LIKLL---VSYG-ADPDEIDGFNKWPPIFYAIQEGHATTVQVLLELGADVFMKDQQNLSQ 607

Query: 235 LHWGTVKGQPHVLKYLI 251
           + +   +G   VL  L+
Sbjct: 608 VFYALWEGHLSVLNVLL 624

>KLLA0C09108g complement(795433..796059) similar to sp|P25631
           Saccharomyces cerevisiae YCR051w singleton, start by
           similarity
          Length = 208

 Score = 38.5 bits (88), Expect = 0.009,   Method: Composition-based stats.
 Identities = 26/84 (30%), Positives = 38/84 (45%), Gaps = 2/84 (2%)

Query: 203 LW-AAYQGDSLTVAALIKFNASVKIADEGGFTPLHWGTVKGQPHVLKYLIQD-GADFFQK 260
           +W AA  G++  V   IK   +    DE G+TP+H     G   +LK L+Q+   D   K
Sbjct: 3   IWIAASNGETELVEKFIKQGQTANDKDENGYTPIHAAAAYGHIDLLKKLVQEHNGDVNIK 62

Query: 261 TNDNKDCFVIAEEMSNTHSFQEAL 284
            +DN       E+ +   S  E L
Sbjct: 63  DSDNDTPLHHCEDATTARSLIEQL 86

>Kwal_56.22459
          Length = 383

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%)

Query: 453 RSFCLETWVRKPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFIL 504
           ++ C +    KP R+ +    D  +L  DH+CPW  N VG  N   F+ F++
Sbjct: 77  KNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLV 128

>KLLA0C06204g complement(548912..550045) similar to sgd|S0005363
           Saccharomyces cerevisiae YOL003c, start by similarity
          Length = 377

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 42/98 (42%), Gaps = 15/98 (15%)

Query: 407 CAILCFVCYSLFLLAFSDPGHIGSENDHEKIRETISNLLKEGKFDTRSFCLETWVRKPLR 466
           C  + +V Y  +L  +++PG    +              K    +  ++C +  V KP R
Sbjct: 46  CQTMIWVSY--YLAIYTNPGIPPKD-------------FKPSAEEWHNYCKKCRVYKPER 90

Query: 467 SKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFIL 504
           + +    +  +L  DH+CPW  N VG  N   F+ F+ 
Sbjct: 91  AHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLF 128

>KLLA0F26004g complement(2411261..2412271) some similarities with
           sp|Q04749 Saccharomyces cerevisiae YMR068w singleton,
           hypothetical start
          Length = 336

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 52/125 (41%), Gaps = 5/125 (4%)

Query: 60  SKYHNACQRGDLEVVREMIHGGQVNVSSDADREGVTGLHWAAINNRLNVVDFLVR----E 115
           S  H A   G   + R +I  G    +     +G T +H A        V  L++    E
Sbjct: 42  SSLHYAAFYGRYLICRHLIQLGHDATAMLKTYDGDTCIHLAITKGDEQTVHLLLQHFLEE 101

Query: 116 GANVESKAGALEATPLHWAARYGFVYVVDYLLQHGASATTTDKQGFNLLHLSVNSSNIML 175
           G N+ S + A    P+H A R      +  LLQ GA  T  D++G   LH+++    I  
Sbjct: 102 GLNLRSSS-ARRWAPIHIACRSNHSRCLALLLQCGADVTLEDEEGNTGLHVAMEYGAIQC 160

Query: 176 VVYVL 180
           +  +L
Sbjct: 161 LPILL 165

 Score = 30.0 bits (66), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 48/102 (47%), Gaps = 10/102 (9%)

Query: 63  HNACQRGDLEVVREMIH---GGQVNVSSDADREGVTGLHWAAINNRLNVVDFLVREGANV 119
           H A  +GD + V  ++       +N+ S + R     +H A  +N    +  L++ GA+V
Sbjct: 80  HLAITKGDEQTVHLLLQHFLEEGLNLRSSSARRWAP-IHIACRSNHSRCLALLLQCGADV 138

Query: 120 --ESKAGALEATPLHWAARYGFVYVVDYLLQHGASATTTDKQ 159
             E + G    T LH A  YG +  +  LLQ G  AT  D+Q
Sbjct: 139 TLEDEEGN---TGLHVAMEYGAIQCLPILLQCGG-ATLADEQ 176

>Sklu_2436.4 YDR459C, Contig c2436 10516-11610 reverse complement
          Length = 364

 Score = 38.1 bits (87), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 23/37 (62%)

Query: 466 RSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFF 502
           R+ +S      + RFDHYC WI   VG KN++LFI F
Sbjct: 137 RTHHSATLGYCVPRFDHYCVWIGTVVGRKNYRLFIQF 173

>Scas_649.8
          Length = 373

 Score = 38.1 bits (87), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 40/178 (22%), Positives = 73/178 (41%), Gaps = 16/178 (8%)

Query: 95  TGLHWAAINNRLNVVDFLVREGANVESKAGALEA-TPLHWAARYGFVYVVDYLLQHGASA 153
           T L  A I  +L +V  L+R   N+          + LH+A+ +G   +  +L+Q G   
Sbjct: 7   TRLREAIIEGKLLIVKRLLRRYPNILHNIDCRNGWSSLHYASFHGRYLICVHLIQLGHEC 66

Query: 154 TTTDKQGFNLLHLSV----NSSNIMLVVYVLFFVVSKGIIDIDYVDPKGRTALLWAAYQG 209
           T    +G + +HL++      +  +L+ Y   F+  KG         +G++ L  A    
Sbjct: 67  TIRTFKGNSCIHLALLNGHEQTTHLLLQYFPQFINDKG--------ERGKSPLHIACMFD 118

Query: 210 DSLTVAALIKFNASVKIADEGGFTPLHWGTVKGQPHVLKYLIQDGA---DFFQKTNDN 264
               +  LI   A + + D+ G   +H          +  LI++G    D  ++  DN
Sbjct: 119 YDRCLNLLIGLGADINVIDDNGDGVMHLCLQYSSLKCMHVLIKEGKLINDDQERDKDN 176

 Score = 32.7 bits (73), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 32/148 (21%), Positives = 63/148 (42%), Gaps = 8/148 (5%)

Query: 92  EGVTGLHWAAINNRLNVVDFLVREGANVESKAGALEATPLHWAARYGFVYVVDYLLQHGA 151
           +G + +H A +N        L++      +  G    +PLH A  + +   ++ L+  GA
Sbjct: 72  KGNSCIHLALLNGHEQTTHLLLQYFPQFINDKGERGKSPLHIACMFDYDRCLNLLIGLGA 131

Query: 152 SATTTDKQGFNLLHLSVNSSNIMLVVYVLFFVVSKG-IIDIDYVDPKG--RTALLWAAYQ 208
                D  G  ++HL +  S++      +  ++ +G +I+ D    K   R + + + ++
Sbjct: 132 DINVIDDNGDGVMHLCLQYSSLK----CMHVLIKEGKLINDDQERDKDNWRPSDVISTFE 187

Query: 209 GDSLTVAALIKFNASVKIADEGGF-TPL 235
              +   AL K    VK    G F TP+
Sbjct: 188 MGIIYKKALTKRKLQVKSKTNGPFSTPV 215

>YDR459C (YDR459C) [1277] chr4 complement(1382307..1383431) Protein
           of unknown function, has similarity to Erf2p [1125 bp,
           374 aa]
          Length = 374

 Score = 37.4 bits (85), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 1/65 (1%)

Query: 455 FCLETWVRKPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFILALE-LGIFSF 513
           +C E    K  R+ +S      I RFDHYC WI   +G  N++LF+ F      L +  +
Sbjct: 130 WCSECQSLKMERTHHSSELGHCIPRFDHYCMWIGTVIGRDNYRLFVQFAAYFSTLLLIMW 189

Query: 514 VKVCL 518
           V +C+
Sbjct: 190 VSICV 194

>CAGL0F06655g 654908..656134 similar to sp|Q04749 Saccharomyces
           cerevisiae YMR068w, start by similarity
          Length = 408

 Score = 37.4 bits (85), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 41/88 (46%), Gaps = 2/88 (2%)

Query: 92  EGVTGLHWAAINNRLNVVDFLVREGANVESKAGALEATPLHWAARYGFVYVVDYLLQHGA 151
           +G T +H A +N        L++      +KAG L  TP H A  + +   +  L+  GA
Sbjct: 74  KGNTCVHLALMNGHEQTTHLLLQHFPRFINKAGELGRTPTHIACIHDYYQCLSLLIGVGA 133

Query: 152 SATTTDKQGFNLLHLSVN--SSNIMLVV 177
           +    D +G   LHL +   S+N M ++
Sbjct: 134 NLMMKDDKGNTPLHLCLEFGSTNCMKML 161

 Score = 34.3 bits (77), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 62/142 (43%), Gaps = 16/142 (11%)

Query: 131 LHWAARYGFVYVVDYLLQHGASATTTDK--QGFNLLHLSV----NSSNIMLVVYVLFFVV 184
           LH+A+ +G   +   L+Q G   T   K  +G   +HL++      +  +L+ +   F+ 
Sbjct: 44  LHYASYHGRYLICVLLIQLGHDKTEVLKTFKGNTCVHLALMNGHEQTTHLLLQHFPRFIN 103

Query: 185 SKGIIDIDYVDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGFTPLHWGTVKGQP 244
             G +        GRT    A        ++ LI   A++ + D+ G TPLH     G  
Sbjct: 104 KAGEL--------GRTPTHIACIHDYYQCLSLLIGVGANLMMKDDKGNTPLHLCLEFGST 155

Query: 245 HVLKYLIQD--GADFFQKTNDN 264
           + +K L+ +   +D   + NDN
Sbjct: 156 NCMKMLVNEIQISDDSIRNNDN 177

>KLLA0D06149g 527705..528754 similar to sgd|S0002867 Saccharomyces
           cerevisiae YDR459c, start by similarity
          Length = 349

 Score = 37.0 bits (84), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%)

Query: 466 RSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFILALELGIF 511
           R+ +S      + RFDHYC WI   +G  N+KLF+ F   L+L + 
Sbjct: 138 RTHHSTKVGYCVPRFDHYCVWIGTVLGRLNYKLFVQFTFYLDLVVL 183

>AGR223W [4534] [Homologous to ScYPL110C - SH]
           complement(1167870..1171835) [3966 bp, 1321 aa]
          Length = 1321

 Score = 37.0 bits (84), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 34/67 (50%)

Query: 95  TGLHWAAINNRLNVVDFLVREGANVESKAGALEATPLHWAARYGFVYVVDYLLQHGASAT 154
           T L+ A   +     ++LV++GAN+E        TP+  AA  G+  +V  L+ HGA   
Sbjct: 532 TALYVACKLDIYEAAEYLVKQGANMELGEKLFGWTPIFAAATEGYARIVQLLVDHGAKYD 591

Query: 155 TTDKQGF 161
             D+ G+
Sbjct: 592 LFDESGW 598

>CAGL0D01012g 118878..121286 similar to sp|P39678 Saccharomyces
           cerevisiae YDL056w MBP1 transcription factor, start by
           similarity
          Length = 802

 Score = 36.6 bits (83), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 75/183 (40%), Gaps = 26/183 (14%)

Query: 73  VVREMIHGGQVN---VSSDADREGVTGLHWAAINNRLNVVDFLVREGANVESKAGALEAT 129
           V +E++H    +   + +  D E  T  HWA     L +V+ L   G N+ + A A   T
Sbjct: 361 VPQELLHPPTQSAPFIDAPIDPELHTAFHWACSMGNLPIVEALYETGTNIRA-ANANGQT 419

Query: 130 PLHWAA-------RYGFVYVVDYLLQHGASATTTDKQGFNLLHLSVN-SSNIMLVVYVLF 181
           PL  +A       R  F  + + L +   +    D  G  +LH  V   S+    +Y + 
Sbjct: 420 PLMRSAMFHNSYTRRSFPRIFELLSE---TVFDIDSMGQTVLHHIVKRKSSTPSAIYYVN 476

Query: 182 FVVSKGIIDI----------DYVDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGG 231
            ++SK I DI          +  D  G TAL  AA   D      LIK  +   I++  G
Sbjct: 477 VLLSK-IKDISPKYRIELLLNTKDANGDTALHIAARNNDREFFDILIKNGSLSTISNNDG 535

Query: 232 FTP 234
            TP
Sbjct: 536 QTP 538

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 23/42 (54%)

Query: 194 VDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGFTPL 235
           +DP+  TA  WA   G+   V AL +   +++ A+  G TPL
Sbjct: 380 IDPELHTAFHWACSMGNLPIVEALYETGTNIRAANANGQTPL 421

>AGR065W [4375] [Homologous to ScYDR126W (PSL10) - SH]
           complement(835877..836857) [981 bp, 326 aa]
          Length = 326

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 1/61 (1%)

Query: 456 CLETWVRKPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFILALELGIFSFVK 515
           C    VRKP RS++  +    +   DH+C W+ N VG  N+ LF +  L     + ++  
Sbjct: 126 CRTCRVRKPARSRHCGVCGRCVPLADHHCVWLNNCVGRGNYGLF-YLALGAHCALLTYGA 184

Query: 516 V 516
           V
Sbjct: 185 V 185

>YPL239W (YAR1) [5211] chr16 (99484..100086) Protein with 2 ankyrin
           repeats [603 bp, 200 aa]
          Length = 200

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 8/61 (13%)

Query: 63  HNACQRGDLEVVREMIHG-GQVNVSSD-------ADREGVTGLHWAAINNRLNVVDFLVR 114
           H A   G +E VR ++    + N + D        ++ G T LHWA++N +L+VV  L  
Sbjct: 55  HMAAANGHIETVRYILETVSRANSAEDLKAFVNEVNKTGNTALHWASLNGKLDVVKLLCD 114

Query: 115 E 115
           E
Sbjct: 115 E 115

>AFR600C [3792] [Homologous to ScYDL056W (MBP1) - SH]
           (1517341..1519788) [2448 bp, 815 aa]
          Length = 815

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 68/163 (41%), Gaps = 20/163 (12%)

Query: 129 TPLHWAARYGFVYVVDYLLQHGASATTTDKQGFNLLHLS--VNSSNIMLVVYVLFFVVSK 186
           T  HWA   G + +V+ LLQ GAS    ++ G   L  +  V++S        +F ++  
Sbjct: 366 TAFHWACAMGTLPIVEALLQAGASPRALNQAGETPLMRASLVHNSYTKRTYPRIFQLLQD 425

Query: 187 GIIDIDYVDP-------KGRTALLWAAYQGDSLTVAALIKFNASVKI------ADEGGFT 233
            + D+D           K ++    A Y  D L ++ L  F+   +I       D  G T
Sbjct: 426 TVFDVDSRSQTVVHHIVKRKSNTPSALYYLDVL-LSKLKDFSPQYRIETLINAQDCKGST 484

Query: 234 PLHWGTVKGQPHVLKYLIQDGADFFQKTNDNKDCFVIAEEMSN 276
           PLH   +       + L+ +GA    K +D     V A+E+ N
Sbjct: 485 PLHIAAMNRDKKFFQTLVGNGALSTIKNHDG----VTADELIN 523

 Score = 30.0 bits (66), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 23/43 (53%)

Query: 193 YVDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGFTPL 235
           ++D +  TA  WA   G    V AL++  AS +  ++ G TPL
Sbjct: 359 WIDSEHHTAFHWACAMGTLPIVEALLQAGASPRALNQAGETPL 401

>Sklu_2055.3 YDL056W, Contig c2055 5141-7372
          Length = 743

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 65/160 (40%), Gaps = 19/160 (11%)

Query: 90  DREGVTGLHWAAINNRLNVVDFLVREGANVESKAGALEATPLHWAARYGFVYV------V 143
           D EG T  HWA     + + + L   GA+  S    L  TPL  ++ +   Y       +
Sbjct: 353 DPEGHTAFHWACAMGNIAIAEALYNVGASTRS-VNTLGETPLMRSSIFHNSYTKRTYPKI 411

Query: 144 DYLLQHGASATTTDKQGFNLLHLSVNSSNIMLVVYVLFFVVSKGIID----------IDY 193
            +LLQ       +  Q   + H+    S+    VY L  ++SK I D          I+ 
Sbjct: 412 CHLLQDTTYDVDSQLQTV-IHHIVRRKSSTPSAVYYLDVLLSK-IKDFSPQYRIESLINA 469

Query: 194 VDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGFT 233
            D +G TAL  AA+  D +    L++  A   I +  G T
Sbjct: 470 QDQRGNTALHVAAFNDDRIFFNTLLEHGALSTIKNNEGTT 509

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 1/51 (1%)

Query: 191 IDY-VDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGFTPLHWGTV 240
           IDY +DP+G TA  WA   G+     AL    AS +  +  G TPL   ++
Sbjct: 348 IDYSIDPEGHTAFHWACAMGNIAIAEALYNVGASTRSVNTLGETPLMRSSI 398

>Scas_717.62
          Length = 374

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%)

Query: 466 RSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFI 503
           RS +S      ILRFDHYC WI   +   N++LF+ ++
Sbjct: 128 RSHHSKQVGRCILRFDHYCAWIGCVIARNNYRLFLQYV 165

>ABR203W [797] [Homologous to ScYDR459C - SH]
           complement(782702..783781) [1080 bp, 359 aa]
          Length = 359

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 463 KPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFILALEL-GIFSFVKV 516
           K LR+ +S      + R DHYC W+   +G +N++LF  F++   +  +  FV V
Sbjct: 129 KGLRTHHSVHLGFCVPRLDHYCVWLGTVIGRRNYRLFNQFLMCFLMHALIIFVSV 183

>YMR068W (AVO2) [4027] chr13 (406303..407583) Component of the TOR
           complex 2 (Tor2p-Lst8p-Kog1p-Avo1p-Avo2p-Tsc11p), which
           is involved in signaling to the actin cytoskeleton [1281
           bp, 426 aa]
          Length = 426

 Score = 34.7 bits (78), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 71/170 (41%), Gaps = 13/170 (7%)

Query: 91  REGVTGLHWAAINNRLNVVDFLVREG----ANVESKAGALEATPLHWAARYGFVYVVDYL 146
           +E    L  A I   L +V  L+R       N++S+ G    + LH+A+ +G   +  YL
Sbjct: 3   KEPSVRLREAIIEGNLLIVKRLLRRNPDLLTNIDSENGW---SSLHYASYHGRYLICVYL 59

Query: 147 LQHGASATTTDK--QGFNLLHLSVNSSNIMLVVYVLFFVVSKGIIDIDYVDPKGRTALLW 204
           +Q G       K  +G   +HL++   +       L  ++ +    I++    GR  +  
Sbjct: 60  IQLGHDKHELIKTFKGNTCVHLALMKGH----EQTLHLLLQQFPRFINHRGENGRAPIHI 115

Query: 205 AAYQGDSLTVAALIKFNASVKIADEGGFTPLHWGTVKGQPHVLKYLIQDG 254
           A        ++ LI   A + + D  G TPLH     G    +K L+ +G
Sbjct: 116 ACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLLNEG 165

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 36/74 (48%), Gaps = 4/74 (5%)

Query: 202 LLWAAYQGDSLTVAALIKFNASV--KIADEGGFTPLHWGTVKGQPHVLKYLIQDGADFFQ 259
           L  A  +G+ L V  L++ N  +   I  E G++ LH+ +  G+  +  YLIQ G D  +
Sbjct: 9   LREAIIEGNLLIVKRLLRRNPDLLTNIDSENGWSSLHYASYHGRYLICVYLIQLGHDKHE 68

Query: 260 --KTNDNKDCFVIA 271
             KT     C  +A
Sbjct: 69  LIKTFKGNTCVHLA 82

>Scas_713.9
          Length = 1208

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 24/40 (60%)

Query: 179 VLFFVVSKGIIDIDYVDPKGRTALLWAAYQGDSLTVAALI 218
           V ++V  KG++DI+  D  G T L  AAYQ  +  VA L+
Sbjct: 86  VKYYVDEKGLLDINQKDANGNTPLHLAAYQSRTDAVAYLM 125

>YDL056W (MBP1) [809] chr4 (352877..355378) Transcription factor
           that collaborates with Swi6p to form the MBF
           (Mbp1p-Swi6p) factor for regulation at Mlu1 cell cycle
           box (MCB) elements, has two ankyrin repeats [2502 bp,
           833 aa]
          Length = 833

 Score = 34.3 bits (77), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 55/153 (35%), Gaps = 49/153 (32%)

Query: 129 TPLHWAARYGFVYVVDYLLQHGASATTTDKQG----------------------FNLLHL 166
           T  HWA   G + + + L + G S  +T+ QG                      F LLH 
Sbjct: 397 TAFHWACSMGNLPIAEALYEAGTSIRSTNSQGQTPLMRSSLFHNSYTRRTFPRIFQLLHE 456

Query: 167 SV----------------NSSNIMLVVYVLFFVVSKGIID----------IDYVDPKGRT 200
           +V                  S     VY L  V+SK I D          ++  D  G T
Sbjct: 457 TVFDIDSQSQTVIHHIVKRKSTTPSAVYYLDVVLSK-IKDFSPQYRIELLLNTQDKNGDT 515

Query: 201 ALLWAAYQGDSLTVAALIKFNASVKIADEGGFT 233
           AL  A+  GD +    L+K  A   I+++ G T
Sbjct: 516 ALHIASKNGDVVFFNTLVKMGALTTISNKEGLT 548

>Scas_683.37
          Length = 820

 Score = 33.9 bits (76), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 63/161 (39%), Gaps = 19/161 (11%)

Query: 90  DREGVTGLHWAAINNRLNVVDFLVREGANVESKAGALEATPLHWAARYGFVYV------V 143
           D E  +  HWA     L +V+ L   G N+ +   +   TPL  +A +   Y       +
Sbjct: 417 DPEQHSAFHWACSMGILPIVETLFSAGTNIRT-TNSHGQTPLMRSAMFHNSYTRRSFPRI 475

Query: 144 DYLLQHGASATTTDKQGFNLLHLSVNSSNIMLVVYVLFFVVSKGIID----------IDY 193
             LL         D Q   + H+    S+    +Y L  V+SK I D          ++ 
Sbjct: 476 FQLLHETVFDVDNDLQTV-IHHIVKRKSSTPSAIYYLDTVLSK-IKDFSPQYGVEMLLNA 533

Query: 194 VDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGFTP 234
            D  G TAL  AA  GD L    L+   A   I ++ G TP
Sbjct: 534 QDNNGDTALHIAARNGDKLFFDTLLNNGALNTIRNKKGLTP 574

>Sklu_2237.5 YPL239W, Contig c2237 9761-10357
          Length = 198

 Score = 32.7 bits (73), Expect = 0.68,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 10/60 (16%)

Query: 63  HNACQRGDLEVVREMIHGGQ-------VNVSSDADREGVTGLHWAAINNRLNVVDFLVRE 115
           H A   G LEV++ ++   +       VN  ++    G T LHWA++N  L +V  L  E
Sbjct: 55  HMAAANGHLEVIKYLLSIAEPSEVKQWVNTRNET---GNTALHWASLNGNLEIVKLLCEE 111

 Score = 30.0 bits (66), Expect = 5.1,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 1/62 (1%)

Query: 212 LTVAALIKFNASVKIADEGGFTPLHWGTVKGQPHVLKYLIQD-GADFFQKTNDNKDCFVI 270
           L++A   +    V   +E G T LHW ++ G   ++K L ++  AD F + + + D    
Sbjct: 70  LSIAEPSEVKQWVNTRNETGNTALHWASLNGNLEIVKLLCEEYDADPFIRNDFDHDAIFE 129

Query: 271 AE 272
           AE
Sbjct: 130 AE 131

>YLR182W (SWI6) [3586] chr12 (517942..520353) Transcription factor
           that participates in the SBF complex (Swi4p-Swi6p) for
           regulation at the cell cycle box (CCB) and in the MBF
           complex (Mbp1p-Swi6p) for regulation at the Mlu1 cell
           cycle box (MCB) [2412 bp, 803 aa]
          Length = 803

 Score = 33.5 bits (75), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 24/44 (54%)

Query: 228 DEGGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTNDNKDCFVIA 271
           DE G TPLHW T      ++K+L++ G++     N  + C V A
Sbjct: 315 DEHGNTPLHWLTSIANLELVKHLVKHGSNRLYGDNMGESCLVKA 358

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (54%)

Query: 129 TPLHWAARYGFVYVVDYLLQHGASATTTDKQGFNLLHLSVNSSN 172
           TPLHW      + +V +L++HG++    D  G + L  +V S N
Sbjct: 320 TPLHWLTSIANLELVKHLVKHGSNRLYGDNMGESCLVKAVKSVN 363

 Score = 30.0 bits (66), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 24/48 (50%)

Query: 71  LEVVREMIHGGQVNVSSDADREGVTGLHWAAINNRLNVVDFLVREGAN 118
           L+ V +     Q+N++   D  G T LHW      L +V  LV+ G+N
Sbjct: 296 LQEVNDAFPNTQLNLNIPVDEHGNTPLHWLTSIANLELVKHLVKHGSN 343

>KLLA0F00660g 54232..58356 similar to sgd|S0006031 Saccharomyces
           cerevisiae YPL110c, start by similarity
          Length = 1374

 Score = 33.5 bits (75), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 34/70 (48%)

Query: 95  TGLHWAAINNRLNVVDFLVREGANVESKAGALEATPLHWAARYGFVYVVDYLLQHGASAT 154
           T L+ A   N     + L+  GA++E        TP+  AA  GF  +V  L +HGA+  
Sbjct: 574 TALYLACKLNLREAAEHLLNRGADMEIGEKLFGWTPIFVAATEGFTDLVKVLKEHGANYD 633

Query: 155 TTDKQGFNLL 164
             D+ G++ +
Sbjct: 634 ALDESGWSPM 643

>Scas_587.4
          Length = 751

 Score = 33.1 bits (74), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 3/60 (5%)

Query: 228 DEGGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTNDNKDCFVIAEEMSNTH---SFQEAL 284
           DE G TPLHW T      ++K ++++GA+     N  +   V A +  N +   +F+E L
Sbjct: 269 DEYGNTPLHWLTSTANIDLVKEMVKNGANRLLGDNSGESALVKATKTVNNYDSGTFEELL 328

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 23/43 (53%)

Query: 129 TPLHWAARYGFVYVVDYLLQHGASATTTDKQGFNLLHLSVNSS 171
           T L+ AAR G V +VD LL++GA     +K G   L     +S
Sbjct: 412 TCLNIAARLGNVGIVDALLEYGADPYIANKSGLRPLDFGAGTS 454

>CAGL0B01166g 103561..105987 similar to sp|P09959 Saccharomyces
           cerevisiae YLR182w SWI6 transcription factor,
           hypothetical start
          Length = 808

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%)

Query: 129 TPLHWAARYGFVYVVDYLLQHGASATTTDKQGFNLLHLSVNSSN 172
           TPLHW      + +V  L++HGAS    D  G + L  +V S N
Sbjct: 345 TPLHWLTSIANIDLVKELVKHGASRLLGDNAGESALVKAVKSVN 388

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 3/61 (4%)

Query: 227 ADEGGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTNDNKDCFVIAEEMSNTH---SFQEA 283
           ADE G TPLHW T      ++K L++ GA      N  +   V A +  N +   +F+E 
Sbjct: 339 ADEHGNTPLHWLTSIANIDLVKELVKHGASRLLGDNAGESALVKAVKSVNNYDAGTFEEL 398

Query: 284 L 284
           L
Sbjct: 399 L 399

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 24/45 (53%)

Query: 129 TPLHWAARYGFVYVVDYLLQHGASATTTDKQGFNLLHLSVNSSNI 173
           T L+ AAR G V ++D LL +GA    ++K G   +     +S +
Sbjct: 482 TCLNIAARLGNVSIIDALLDYGADPVISNKSGLRPVDFGAGTSKL 526

>Kwal_14.982
          Length = 416

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 79/196 (40%), Gaps = 34/196 (17%)

Query: 131 LHWAARYGFVYVVDYLLQ--HGASATTTDKQGFNLLHLSV----NSSNIMLVVYVLFFVV 184
           LH+A+ +G      YL+Q  HG        QG   +HL++      +  +L+ +  + + 
Sbjct: 44  LHYASYHGRYLTCVYLVQLGHGKKEILRTFQGNTCVHLALLNGHEQTAHLLLQHFPYCLN 103

Query: 185 SKGIIDIDYVDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGFTPLHWGTVKGQP 244
            KG          GRT +           ++ L+   A + + DE G T LH   + G  
Sbjct: 104 IKGHY--------GRTPVQMTCQYDHYQCLSLLLGLGADLSVRDEFGNTALHICLIYGSE 155

Query: 245 HVLKYLIQDGADFFQKT--------NDNKDCFVIAEEMSNTHSFQEALRHNNFDKNGYPI 296
           + ++ L+++     Q++         D    F +AE       +Q+ALR           
Sbjct: 156 NCMRMLVREEDMEDQESLMIGKWGPTDLCQTFELAE------MYQKALREKRTR------ 203

Query: 297 NKLVKRDDHAKIITFL 312
           +KL KR  +  +I+ L
Sbjct: 204 SKLTKRPSYQFMISPL 219

>KLLA0E05357g 485919..488183 gi|729994|sp|P39679|MBP1_KLULA
           Kluyveromyces lactis Transcription factor MBP1 (MBF
           subunit P120), start by similarity
          Length = 754

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 24/43 (55%)

Query: 193 YVDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGFTPL 235
           ++DP+  TA  WA   G    V AL+K  +S++  +  G TPL
Sbjct: 371 WIDPEHHTAFHWACAMGTLPIVEALLKAGSSIRSLNNVGETPL 413

 Score = 30.0 bits (66), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 58/144 (40%), Gaps = 20/144 (13%)

Query: 129 TPLHWAARYGFVYVVDYLLQHGASATTTDKQGFN-LLHLSVNSSNIMLVVYVLFFVVSKG 187
           T  HWA   G + +V+ LL+ G+S  + +  G   L+  S+  +      Y   F + K 
Sbjct: 378 TAFHWACAMGTLPIVEALLKAGSSIRSLNNVGETPLIRSSIFHNCYTKRTYPQIFEILKD 437

Query: 188 II-DID---------YVDPKGRTALLWAAYQGDSLTVAALIKFNASVKI------ADEGG 231
            + D+D          V  K  T    A Y  D + ++ +  F    +I       D  G
Sbjct: 438 TVFDLDAKSRNVIHRIVSRKSHTP--SAVYYLD-VVLSKIKDFTPQYRIDVLINQQDNDG 494

Query: 232 FTPLHWGTVKGQPHVLKYLIQDGA 255
            +PLH+          + L+Q+GA
Sbjct: 495 NSPLHYAATNKDDQFYQLLLQNGA 518

>KLLA0D08910g 750828..751448 similar to sp|P46683 Saccharomyces
           cerevisiae YPL239w YAR1 ankyrin repeat-containing
           protein singleton, start by similarity
          Length = 206

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 10/63 (15%)

Query: 60  SKYHNACQRGDLEVVREMIH-------GGQVNVSSDADREGVTGLHWAAINNRLNVVDFL 112
           S  H A   G  EVV+ ++           VN  ++    G T LHWA++N +L++V  L
Sbjct: 52  SALHMAAANGHFEVVKYLLSIFPKDKLKEWVNKQNET---GNTALHWASLNGKLDIVQLL 108

Query: 113 VRE 115
             E
Sbjct: 109 CEE 111

>YER111C (SWI4) [1542] chr5 complement(382591..385872) Transcription
           factor that is a component of the SBF (Swi4p-Swi6p)
           complex that regulates expression at promoters
           containing the cell cycle box (CCB) element, contains
           two ankyrin repeats [3282 bp, 1093 aa]
          Length = 1093

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 22/40 (55%)

Query: 129 TPLHWAARYGFVYVVDYLLQHGASATTTDKQGFNLLHLSV 168
           TPLHWA     + ++  L+   A+A   +K GFN +  S+
Sbjct: 523 TPLHWATAMANIPLIKMLITLNANALQCNKLGFNCITKSI 562

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 35/81 (43%), Gaps = 15/81 (18%)

Query: 179 VLFFVVSKGIIDIDYVDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGFTPLHWG 238
           +L  + S+   D+D        ALL   Y        A   FN + +I D+ G TPLHW 
Sbjct: 484 ILTILSSERSSDVDQ-------ALLATLY-------PAPKNFNINFEI-DDQGHTPLHWA 528

Query: 239 TVKGQPHVLKYLIQDGADFFQ 259
           T      ++K LI   A+  Q
Sbjct: 529 TAMANIPLIKMLITLNANALQ 549

>Scas_685.12
          Length = 1131

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 30/62 (48%)

Query: 190 DIDYVDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGFTPLHWGTVKGQPHVLKY 249
           +I   D +GRT L  A+ +      + LI+    V   D  GFT LH+  + G   +++ 
Sbjct: 758 NISMCDDRGRTLLHLASLKRYFNLCSILIRSGIRVNDRDAFGFTALHFACISGDARIIRL 817

Query: 250 LI 251
           L+
Sbjct: 818 LL 819

>KLLA0F19690g 1820355..1821329 weakly similar to sp|Q04629
           Saccharomyces cerevisiae YDR126w, start by similarity
          Length = 324

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 28/56 (50%)

Query: 450 FDTRSFCLETWVRKPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFILA 505
           F   + C      K  RSK+  + +  I   DH+C WI N VG  N++ F  F+L+
Sbjct: 123 FHPSAVCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLS 178

>CAGL0G05786g 557656..558291 similar to sp|Q02774 Saccharomyces
           cerevisiae YDL212w SHR3, start by similarity
          Length = 211

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 42/97 (43%), Gaps = 2/97 (2%)

Query: 144 DYLLQHGASATTTDKQGFNLLHLSVNSSNIMLVVYVLFFVVSKGIIDIDYVDPKGRTALL 203
           DY L     AT  ++    L H  V S+  M V+Y+L FVV+ GII       K    L 
Sbjct: 33  DYHLLFNPQATQ-EQFDLALKHYQVLSTTPMPVLYLLGFVVALGIIGNTIRIYKPNPDLQ 91

Query: 204 WAAYQGDSLTVAALIKFNASVKIADEGGFTPLHWGTV 240
              Y    L V A+  F  +VK   E   T  +WG V
Sbjct: 92  LFEYASLGLFVLAVCVFITNVKTGIECSITG-NWGEV 127

>CAGL0C03003g 297244..297864 similar to sp|P25631 Saccharomyces
           cerevisiae YCR051w, hypothetical start
          Length = 206

 Score = 30.4 bits (67), Expect = 3.5,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 2/67 (2%)

Query: 100 AAINNRLNVVDFLVREGANVESKAGALEATPLHWAARYGFVYVVDYLLQ-HGASATTTDK 158
           AA + R ++V+  + +G +  SK      TP+H AA YG + ++  L Q HG      D 
Sbjct: 6   AASDGRGDIVEKFLADGLSANSKDPN-GYTPVHAAAAYGHLDLLRKLCQEHGGDINVRDS 64

Query: 159 QGFNLLH 165
            G   LH
Sbjct: 65  DGDTPLH 71

>Scas_458.3
          Length = 198

 Score = 30.4 bits (67), Expect = 3.7,   Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 16/23 (69%)

Query: 93  GVTGLHWAAINNRLNVVDFLVRE 115
           G T LHWA++N +L+VV  L  E
Sbjct: 90  GNTALHWASLNGKLDVVKLLCDE 112

 Score = 30.4 bits (67), Expect = 4.3,   Method: Composition-based stats.
 Identities = 30/134 (22%), Positives = 59/134 (44%), Gaps = 6/134 (4%)

Query: 157 DKQGFNLLHLSVNSSNIMLVVYVLFFVVSKGIID--IDYVDPKGRTALLWAAYQGDSLTV 214
           +  G   LH++  + +IM+V Y+L  +  +      ++ V+  G TAL WA+  G  L V
Sbjct: 47  EDTGTTALHMAAGNGHIMVVQYLLSLLPDEDDRKEYVNAVNNTGNTALHWASLNG-KLDV 105

Query: 215 AALI--KFNASVKIADEGGFTPLHWGTVKGQPHVLKYLIQD-GADFFQKTNDNKDCFVIA 271
             L+  +++A   I ++ G   +      G+  V  Y ++    +   +  DN       
Sbjct: 106 VKLLCDEYDADPFIRNQFGHDAIFEAENNGREEVETYFLKKYDVEPENEEEDNGKTETAD 165

Query: 272 EEMSNTHSFQEALR 285
            E++  H  +E  +
Sbjct: 166 VEVTEGHEIEEVTK 179

 Score = 29.6 bits (65), Expect = 6.0,   Method: Composition-based stats.
 Identities = 26/84 (30%), Positives = 36/84 (42%), Gaps = 13/84 (15%)

Query: 72  EVVREMIHGGQVNVSSDADREGVTGLHWAAINNRLNVVDFLV---------REGANVESK 122
           E+   +I    +    D D  G T LH AA N  + VV +L+         +E  N  + 
Sbjct: 30  EIFTTLIDPSLLPTCRDED-TGTTALHMAAGNGHIMVVQYLLSLLPDEDDRKEYVNAVNN 88

Query: 123 AGALEATPLHWAARYGFVYVVDYL 146
            G    T LHWA+  G + VV  L
Sbjct: 89  TG---NTALHWASLNGKLDVVKLL 109

>Scas_510.2
          Length = 1043

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 17/32 (53%)

Query: 228 DEGGFTPLHWGTVKGQPHVLKYLIQDGADFFQ 259
           DE G TPLHW T      ++K LI   A+  Q
Sbjct: 522 DEQGHTPLHWATAMANVPLIKLLIILNANALQ 553

>CAGL0A04565g 445883..449008 similar to sp|P25302 Saccharomyces
           cerevisiae YER111c SWI4, start by similarity
          Length = 1041

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 22/40 (55%)

Query: 129 TPLHWAARYGFVYVVDYLLQHGASATTTDKQGFNLLHLSV 168
           TPLHW A    + +V  L+   A+A   + QGFN +  +V
Sbjct: 485 TPLHWTAAMANIPLVKLLIGLNANALHCNSQGFNCITKAV 524

>Kwal_26.9359
          Length = 742

 Score = 30.4 bits (67), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 64/174 (36%), Gaps = 22/174 (12%)

Query: 90  DREGVTGLHWAAINNRLNVVDFLVREGANVESKAGALEATPLHWA------ARYGFVYVV 143
           D E  T  HWA     L +V+ L   GA+V +     E+  +  +       R  +  +V
Sbjct: 353 DHERHTAFHWACAMGNLPIVEALFSAGASVRAVNSQGESPLIRGSIFHNSFTRRSYPRIV 412

Query: 144 DYLLQHGASATTTDKQGFNLLHLSVNSSNIMLVVYVLFFVVSKGIID----------IDY 193
             L  H        +    + H+    S     VY L  ++SK + D          I+ 
Sbjct: 413 QLL--HDTVFDVDSRLQTVIHHIVKRKSTTASAVYYLDVLLSK-LKDFSPQYRIESLINA 469

Query: 194 VDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGFTP---LHWGTVKGQP 244
            D  G TA+  AA   D +    L++      I +  G TP   +++     QP
Sbjct: 470 QDQNGDTAVHIAAQNRDRIFFQTLVQHGGLSTIKNSRGLTPTEIINYSLPSSQP 523

 Score = 30.4 bits (67), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%)

Query: 193 YVDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGFTPLHWGTV 240
           ++D +  TA  WA   G+   V AL    ASV+  +  G +PL  G++
Sbjct: 351 WIDHERHTAFHWACAMGNLPIVEALFSAGASVRAVNSQGESPLIRGSI 398

>YGR216C (GPI1) [2166] chr7 complement(922636..924465) Protein
           involved with Gpi2p and Spt14p in the first step in
           glycosylphosphatidylinositol (GPI) anchor synthesis
           [1830 bp, 609 aa]
          Length = 609

 Score = 30.4 bits (67), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 42/85 (49%), Gaps = 9/85 (10%)

Query: 343 ASNKFIKSFLLPSYETKGTNSASLLKSPLIAGILF----GSIFWLAFVWILRILPYTFTK 398
           AS++ +K FL   Y++  T + +L  +PL  GI       +     F+W++     TF K
Sbjct: 309 ASHRVLKFFL---YDSLKTITETLANNPL--GIKLNAELANFLSELFLWVIEFSYTTFIK 363

Query: 399 RPLGNLTFCAILCFVCYSLFLLAFS 423
           R +   T  ++L    Y +FL+ FS
Sbjct: 364 RLIDPKTLSSLLTLTIYMMFLVGFS 388

>Scas_578.11
          Length = 631

 Score = 29.6 bits (65), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 7/61 (11%)

Query: 575 KGLTNSELNALIREGRRVDIDSQTHNEFFNTVPEGFINNKDTEEEAAPPVRNNTNERIST 634
           + L    LN +IRE   VD       +F NT P   + N D+E + A     +T +RI +
Sbjct: 347 RSLPPQNLNDIIREYSNVD-------QFGNTRPNTALMNNDSENDMASVTSQSTLQRIKS 399

Query: 635 T 635
           +
Sbjct: 400 S 400

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.323    0.139    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 24,426,738
Number of extensions: 1070932
Number of successful extensions: 2922
Number of sequences better than 10.0: 114
Number of HSP's gapped: 2820
Number of HSP's successfully gapped: 191
Length of query: 751
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 642
Effective length of database: 12,822,747
Effective search space: 8232203574
Effective search space used: 8232203574
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 65 (29.6 bits)