Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M08690g32832317350.0
YDR265W (PEX10)3373197831e-103
Scas_615.133303157701e-101
AER390W3163197527e-99
KLLA0E16720g3053177032e-91
Kwal_55.199991521563371e-38
Sklu_1676.3101772466e-26
KLLA0F12166g1528561377e-09
Kwal_14.12871518431314e-08
Sklu_2432.91475511297e-08
Scas_573.91502431252e-07
CAGL0B05049g1470401191e-06
AAL030C1539431145e-06
YLR247C1556391101e-05
KLLA0E03960g704281073e-05
YDR143C (SAN1)610411064e-05
Kwal_56.22522513931064e-05
CAGL0J03586g411381021e-04
CAGL0E01441g717311021e-04
Scas_720.89469381002e-04
CAGL0E02299g545571002e-04
Sklu_2317.249329993e-04
YOL013C (HRD1)55152984e-04
Scas_625.1127486964e-04
ACL019C57566975e-04
CAGL0K02563g58691958e-04
Scas_713.4557029958e-04
YLR427W (MAG2)67092950.001
Scas_477.724450920.001
Kwal_56.2390058929930.001
YCR066W (RAD18)48738920.002
Scas_719.5164757920.002
Scas_705.4142846910.002
YOL054W40647900.003
CAGL0J04796g59957910.003
AGL191W58231910.003
KLLA0C05874g55350900.004
AAR049C44371900.004
Scas_644.651046880.006
YER068W (MOT2)58776880.006
Sklu_1785.333133870.007
KLLA0C18260g22938860.007
Kwal_23.628545838860.010
Scas_665.139247860.010
KLLA0C08756g42738850.013
Scas_672.226373830.015
AER074W64361840.018
Scas_625.476125840.019
Sklu_2423.864761840.019
YHL010C58546830.022
Kwal_26.809975083830.024
AGL217W41463830.024
AFR499C25056820.025
CAGL0A03432g1151157830.029
YLR323C (CWC24)25943810.031
Kwal_27.1041930033810.032
CAGL0K08052g30548810.033
Sklu_2102.175125820.033
Kwal_47.1777197267810.043
Sklu_2411.239345800.046
YKL034W (TUL1)75825810.049
Scas_701.461276810.050
CAGL0F00803g838130800.067
CAGL0G09493g140887790.079
KLLA0F25674g75725790.079
KLLA0D02552g61962780.089
CAGL0J03102g62076780.094
Kwal_47.1709960588780.096
Kwal_23.413966861780.10
CAGL0H10274g11424730.11
CAGL0D00638g69341780.11
ADL064W64673770.13
Kwal_26.809052048770.13
KLLA0E07007g27966740.23
Sklu_2353.461649750.23
CAGL0I09988g38744740.24
AER113W66556750.25
CAGL0L01947g75725750.26
Kwal_14.1868135760750.28
Kwal_27.1054610424690.28
KLLA0B08679g36376740.29
AFR275W75355740.31
Kwal_23.366076844740.35
YPR093C28848720.38
Scas_551.371239730.41
ABR067C35343720.41
CAGL0A00935g22662710.45
AGR034W159112700.49
YDL074C (BRE1)70039720.54
KLLA0B02981g66361720.55
Kwal_26.824738642720.55
KLLA0F25740g51743720.58
KLLA0F18458g14024680.66
Scas_697.3252153710.78
Kwal_23.585961949710.81
Kwal_27.1072322946671.5
AAR147W158043681.7
CAGL0G03553g21032661.8
KLLA0F17479g111452681.8
CAGL0K07766g83045672.1
CAGL0D05368g11364632.2
Kwal_55.2120627547662.5
Scas_721.100113774672.6
ABR104W32829662.6
AFR104W54326662.9
YBR114W (RAD16)79044663.0
Kwal_26.803066025653.5
AGL289C24146643.5
Sklu_2412.7112757663.6
CAGL0I10098g161832654.0
YOL138C134140654.6
Scas_675.3054225645.3
YDR128W114841645.6
Scas_560.6*11824606.3
KLLA0C08041g57450637.5
KLLA0E07568g33135628.6
AFR220W108587628.6
YML068W (ITT1)46423628.7
YBR062C11525599.4
Kwal_47.1763824838619.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M08690g
         (323 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M08690g complement(865182..866168) similar to sp|Q05568 Sac...   672   0.0  
YDR265W (PEX10) [1098] chr4 (998856..999869) Peroxisomal biogene...   306   e-103
Scas_615.13                                                           301   e-101
AER390W [2890] [Homologous to ScYDR265W (PEX10) - SH] complement...   294   7e-99
KLLA0E16720g complement(1481372..1482289) similar to sp|Q05568 S...   275   2e-91
Kwal_55.19999                                                         134   1e-38
Sklu_1676.3 YDR265W, Contig c1676 2766-3071 reverse complement         99   6e-26
KLLA0F12166g complement(1116715..1121301) weakly similar to sgd|...    57   7e-09
Kwal_14.1287                                                           55   4e-08
Sklu_2432.9 , Contig c2432 20306-24733 reverse complement              54   7e-08
Scas_573.9                                                             53   2e-07
CAGL0B05049g 487186..491598 some similarities with tr|Q06554 Sac...    50   1e-06
AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4...    49   5e-06
YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protei...    47   1e-05
KLLA0E03960g 369201..371315 some similarities with sp|P22470 Sac...    46   3e-05
YDR143C (SAN1) [988] chr4 complement(742036..743868) Protein tha...    45   4e-05
Kwal_56.22522                                                          45   4e-05
CAGL0J03586g complement(341290..342525) similar to sp|P10862 Sac...    44   1e-04
CAGL0E01441g 135075..137228 weakly similar to sp|P22470 Saccharo...    44   1e-04
Scas_720.89                                                            43   2e-04
CAGL0E02299g complement(219009..220646) similar to tr|Q08109 Sac...    43   2e-04
Sklu_2317.2 YDR143C, Contig c2317 4002-5483                            43   3e-04
YOL013C (HRD1) [4803] chr15 complement(301380..303035) E3 ubiqui...    42   4e-04
Scas_625.11                                                            42   4e-04
ACL019C [1030] [Homologous to ScYOL013C (HRD1) - SH] (328044..32...    42   5e-04
CAGL0K02563g complement(230983..232743) similar to sp|P38748 Sac...    41   8e-04
Scas_713.45                                                            41   8e-04
YLR427W (MAG2) [3803] chr12 (988424..990436) Protein containing ...    41   0.001
Scas_477.7                                                             40   0.001
Kwal_56.23900                                                          40   0.001
YCR066W (RAD18) [592] chr3 (231495..232958) Multifunctional DNA ...    40   0.002
Scas_719.51                                                            40   0.002
Scas_705.41                                                            40   0.002
YOL054W (YOL054W) [4765] chr15 (228612..229832) Protein required...    39   0.003
CAGL0J04796g 453697..455496 similar to tr|Q06436 Saccharomyces c...    40   0.003
AGL191W [4121] [Homologous to ScYDR143C (SAN1) - SH] complement(...    40   0.003
KLLA0C05874g complement(520079..521740) weakly similar to sgd|S0...    39   0.004
AAR049C [235] [Homologous to ScYCR066W (RAD18) - SH] (428904..43...    39   0.004
Scas_644.6                                                             39   0.006
YER068W (MOT2) [1499] chr5 (293048..294811) Zinc finger transcri...    39   0.006
Sklu_1785.3 YOL054W, Contig c1785 2663-3658 reverse complement         38   0.007
KLLA0C18260g 1613311..1614000 similar to sp|P53769 Saccharomyces...    38   0.007
Kwal_23.6285                                                           38   0.010
Scas_665.1                                                             38   0.010
KLLA0C08756g complement(765847..767130) weakly similar to sp|P10...    37   0.013
Scas_672.2                                                             37   0.015
AER074W [2579] [Homologous to ScYDL074C (BRE1) - SH] complement(...    37   0.018
Scas_625.4                                                             37   0.019
Sklu_2423.8 YDL074C, Contig c2423 13513-15456 reverse complement       37   0.019
YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein t...    37   0.022
Kwal_26.8099                                                           37   0.024
AGL217W [4095] [Homologous to ScYOL054W - SH] complement(290043....    37   0.024
AFR499C [3691] [Homologous to ScYLR323C (CWC24) - SH] (1339549.....    36   0.025
CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces c...    37   0.029
YLR323C (CWC24) [3710] chr12 complement(778173..778952) Protein ...    36   0.031
Kwal_27.10419                                                          36   0.032
CAGL0K08052g complement(800162..801079) weakly similar to tr|Q06...    36   0.033
Sklu_2102.1 YKL034W, Contig c2102 417-2672 reverse complement          36   0.033
Kwal_47.17771                                                          36   0.043
Sklu_2411.2 YMR026C, Contig c2411 3617-4798                            35   0.046
YKL034W (TUL1) [3222] chr11 (371472..373748) Protein containing ...    36   0.049
Scas_701.4                                                             36   0.050
CAGL0F00803g 88454..90970 similar to sp|P19659 Saccharomyces cer...    35   0.067
CAGL0G09493g complement(902228..906454) similar to tr|Q08562 Sac...    35   0.079
KLLA0F25674g 2384293..2386566 similar to sp|P36096 Saccharomyces...    35   0.079
KLLA0D02552g complement(215290..217149) similar to sgd|S0004419 ...    35   0.089
CAGL0J03102g 294126..295988 similar to sp|P34909 Saccharomyces c...    35   0.094
Kwal_47.17099                                                          35   0.096
Kwal_23.4139                                                           35   0.10 
CAGL0H10274g complement(1003801..1004145) similar to sp|P38239 S...    33   0.11 
CAGL0D00638g complement(80947..83028) similar to tr|Q07457 Sacch...    35   0.11 
ADL064W [1677] [Homologous to ScYER068W (MOT2) - SH] complement(...    34   0.13 
Kwal_26.8090                                                           34   0.13 
KLLA0E07007g 641391..642230 some similarities with sp|P40072 Sac...    33   0.23 
Sklu_2353.4 YER068W, Contig c2353 8340-10190                           33   0.23 
CAGL0I09988g complement(951368..952531) similar to tr|Q12161 Sac...    33   0.24 
AER113W [2618] [Homologous to ScYLR427W - SH] complement(848584....    33   0.25 
CAGL0L01947g 225999..228272 similar to sp|P36096 Saccharomyces c...    33   0.26 
Kwal_14.1868                                                           33   0.28 
Kwal_27.10546                                                          31   0.28 
KLLA0B08679g 767808..768899 weakly similar to sgd|S0005415 Sacch...    33   0.29 
AFR275W [3467] [Homologous to ScYKL034W (TUL1) - NSH] complement...    33   0.31 
Kwal_23.3660                                                           33   0.35 
YPR093C (YPR093C) [5516] chr16 complement(719554..720420) Protei...    32   0.38 
Scas_551.3                                                             33   0.41 
ABR067C [658] [Homologous to ScYMR026C (PEX12) - SH] (514945..51...    32   0.41 
CAGL0A00935g complement(97372..98052) some similarities with sp|...    32   0.45 
AGR034W [4344] [Homologous to ScYBR062C - SH] complement(772772....    32   0.49 
YDL074C (BRE1) [794] chr4 complement(324047..326149) Ubiquitin l...    32   0.54 
KLLA0B02981g complement(267798..269789) similar to sgd|S0002232 ...    32   0.55 
Kwal_26.8247                                                           32   0.55 
KLLA0F25740g complement(2389226..2390779) similar to sp|P38748 S...    32   0.58 
KLLA0F18458g complement(1697871..1698293) some similarities with...    31   0.66 
Scas_697.32                                                            32   0.78 
Kwal_23.5859                                                           32   0.81 
Kwal_27.10723                                                          30   1.5  
AAR147W [335] [Homologous to ScYOR191W (RIS1) - SH] complement(6...    31   1.7  
CAGL0G03553g complement(345057..345689) weakly similar to sp|P40...    30   1.8  
KLLA0F17479g complement(1601287..1604631) similar to sp|P32849 S...    31   1.8  
CAGL0K07766g 770935..773427 highly similar to sp|P31244 Saccharo...    30   2.1  
CAGL0D05368g complement(513884..514225) similar to sp|P32570 Sac...    29   2.2  
Kwal_55.21206                                                          30   2.5  
Scas_721.100                                                           30   2.6  
ABR104W [696] [Homologous to ScYPR093C - SH] complement(574067.....    30   2.6  
AFR104W [3296] [Homologous to ScYKR017C - SH] complement(623416....    30   2.9  
YBR114W (RAD16) [303] chr2 (467204..469576) Nucleotide excision ...    30   3.0  
Kwal_26.8030                                                           30   3.5  
AGL289C [4023] [Homologous to ScYER116C (SLX8) - SH] (164204..16...    29   3.5  
Sklu_2412.7 YLR032W, Contig c2412 15481-18864                          30   3.6  
CAGL0I10098g complement(958948..963804) some similarities with s...    30   4.0  
YOL138C (YOL138C) [4686] chr15 complement(61324..65349) Possible...    30   4.6  
Scas_675.30                                                            29   5.3  
YDR128W (YDR128W) [975] chr4 (709543..712989) Protein containing...    29   5.6  
Scas_560.6*                                                            28   6.3  
KLLA0C08041g complement(705516..707240) gi|24741192|emb|CAD56154...    29   7.5  
KLLA0E07568g 685564..686559 weakly similar to sp|Q04370 Saccharo...    28   8.6  
AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH] complement(...    28   8.6  
YML068W (ITT1) [3901] chr13 (137550..138944) Involved in transla...    28   8.7  
YBR062C (YBR062C) [253] chr2 complement(365936..366283) Protein ...    27   9.4  
Kwal_47.17638                                                          28   9.7  

>CAGL0M08690g complement(865182..866168) similar to sp|Q05568
           Saccharomyces cerevisiae YDR265w peroxisomal assembly
           protein - peroxin, hypothetical start
          Length = 328

 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/323 (100%), Positives = 323/323 (100%)

Query: 1   MVEEDRRWKLPFAGAPSIVQAHQKDEQIETMLSVKVSELLRGVRGQLFINNYQKEISVVV 60
           MVEEDRRWKLPFAGAPSIVQAHQKDEQIETMLSVKVSELLRGVRGQLFINNYQKEISVVV
Sbjct: 1   MVEEDRRWKLPFAGAPSIVQAHQKDEQIETMLSVKVSELLRGVRGQLFINNYQKEISVVV 60

Query: 61  KLIYLGLTTALSRRTLGEEYVDLIYVNKRGSQLVRGIKRVLFVLSYTSIPYLVTKLSKKV 120
           KLIYLGLTTALSRRTLGEEYVDLIYVNKRGSQLVRGIKRVLFVLSYTSIPYLVTKLSKKV
Sbjct: 61  KLIYLGLTTALSRRTLGEEYVDLIYVNKRGSQLVRGIKRVLFVLSYTSIPYLVTKLSKKV 120

Query: 121 NNRSTNNEESDDGNESTYTDILSTMIDLHLMVFYITGTYYDVFKRFWGMRYALGHTLSQE 180
           NNRSTNNEESDDGNESTYTDILSTMIDLHLMVFYITGTYYDVFKRFWGMRYALGHTLSQE
Sbjct: 121 NNRSTNNEESDDGNESTYTDILSTMIDLHLMVFYITGTYYDVFKRFWGMRYALGHTLSQE 180

Query: 181 EENYRDKSSKSYKILGYIILLQHISKVKPIINKVLSILPQTKETLNAGSNGVGLKEGFAP 240
           EENYRDKSSKSYKILGYIILLQHISKVKPIINKVLSILPQTKETLNAGSNGVGLKEGFAP
Sbjct: 181 EENYRDKSSKSYKILGYIILLQHISKVKPIINKVLSILPQTKETLNAGSNGVGLKEGFAP 240

Query: 241 AATPGLLTDVPENFNIDHIKLSNGKELAFIPTESRNCILCLMEMTDPSCLPCGHVFCWDC 300
           AATPGLLTDVPENFNIDHIKLSNGKELAFIPTESRNCILCLMEMTDPSCLPCGHVFCWDC
Sbjct: 241 AATPGLLTDVPENFNIDHIKLSNGKELAFIPTESRNCILCLMEMTDPSCLPCGHVFCWDC 300

Query: 301 ITDWTKENPECPLCRQRSYPQQV 323
           ITDWTKENPECPLCRQRSYPQQV
Sbjct: 301 ITDWTKENPECPLCRQRSYPQQV 323

>YDR265W (PEX10) [1098] chr4 (998856..999869) Peroxisomal biogenesis
           protein (peroxin) [1014 bp, 337 aa]
          Length = 337

 Score =  306 bits (783), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 143/319 (44%), Positives = 208/319 (65%), Gaps = 9/319 (2%)

Query: 9   KLPFAGAPSIVQAHQKDEQIETMLSVKVSELLRGVRGQLFINNYQKEISVVVKLIYLGLT 68
           + PFA APSIVQAHQKDEQI+ +L +KV+EL + ++ QLF+N+Y KE+S+  KL+YL  T
Sbjct: 19  RFPFADAPSIVQAHQKDEQIQGLLIMKVTELCKLIKSQLFVNSYPKELSIFAKLLYLLFT 78

Query: 69  TALSRRTLGEEYVDLIYVNKRGSQLVRGIKRVLFVLSYTSIPYLVTKLSKKV--NNRSTN 126
           T    RTLGEEYVDL Y N++G++L   +K ++F  +Y   PY +TKL KK+  NN+ + 
Sbjct: 79  TGRRGRTLGEEYVDLTYTNRKGTRLAGRLKMIVFAFAYPLCPYFITKLYKKIMKNNKESK 138

Query: 127 NEESDDGNESTYTDILSTMIDLHLMVFYITGTYYDVFKRFWGMRYALGHTLSQEEENYRD 186
            E+++    +    +L  ++D+H+ +FY  G +Y + KR +GMRY   H LS+ E N+R+
Sbjct: 139 IEDTESV-AAFCKGLLDFILDVHMTLFYFKGAFYSISKRIFGMRYVFKHILSKNEANFRE 197

Query: 187 KSSKSYKILGYIILLQHISKVKPIINKVLS--ILPQTKETLNAGSNGVGLKEGFAPAATP 244
           + S+ YK+LGYI+L Q++ K  P++   L   I  + +   +   + VGL+E     +  
Sbjct: 198 EGSQKYKVLGYILLAQNVMKWYPVLTSTLGSWIYGRKRTNDSITRSSVGLQERSEHESIE 257

Query: 245 GLLTDVPENFNIDHIKLSNGKELAFIPTESRNCILCLMEMTDPSCLPCGHVFCWDCITDW 304
           G    +P+   + HI LS+  +L FIP  SR CILCLM M+DPSC PCGH+FCW C+  W
Sbjct: 258 G----IPKESQLTHINLSDKNQLPFIPEASRKCILCLMNMSDPSCAPCGHLFCWSCLMSW 313

Query: 305 TKENPECPLCRQRSYPQQV 323
            KE PECPLCRQ   PQ++
Sbjct: 314 CKERPECPLCRQHCQPQEI 332

>Scas_615.13
          Length = 330

 Score =  301 bits (770), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 150/315 (47%), Positives = 211/315 (66%), Gaps = 7/315 (2%)

Query: 10  LPFAGAPSIVQAHQKDEQIETMLSVKVSELLRGVRGQLFINNYQKEISVVVKLIYLGLTT 69
           LPFA AP+IVQAHQKD QIE++L+ K++ LL  ++GQLF N Y KEIS+ VKL+YL LTT
Sbjct: 18  LPFADAPTIVQAHQKDLQIESILTEKLTTLLTSLKGQLFTNTYPKEISIAVKLLYLTLTT 77

Query: 70  ALSRRTLGEEYVDLIYVNKRGSQLVRGIKRVLFVLSYTSIPYLVTKLSKKVNNRSTNNEE 129
              RRTLGEEYVDLIYV+++G+ LV+  +++LF+LSYT  PYL+TK+  K+  +   NEE
Sbjct: 78  FRGRRTLGEEYVDLIYVDRKGTGLVKRYRKLLFILSYTLGPYLITKVYNKLCAKIYANEE 137

Query: 130 SDDGNESTYTDILSTMIDLHLMVFYITGTYYDVFKRFWGMRYALGHTLSQEEENYRDKSS 189
            ++  + +   +LS +++ HL++FY  G YY++ KR +G+RY++GH  S  E   R++S+
Sbjct: 138 DENRKKISLKQVLSAIVETHLVLFYFKGAYYEISKRLFGLRYSIGHEPSANEAQTREQST 197

Query: 190 KSYKILGYIILLQHISKVKPIINKVLSILPQTKETLNAGSNGVGLKEGFAPA-ATPGLLT 248
            +YK+LG I+LLQ  ++V PI           K   +    G    E  +      G+LT
Sbjct: 198 NTYKLLGNIMLLQQTAEVLPICKGWF------KSYYSKDEKGTLTNEKQSQGDIQAGILT 251

Query: 249 DVPENFNIDHIKLSNGKELAFIPTESRNCILCLMEMTDPSCLPCGHVFCWDCITDWTKEN 308
            +P    ++H+ LS+ +   FIP ++R CILCL  MTDPSC PCGH+FCW+CI DW KE 
Sbjct: 252 RIPNESEVNHLNLSDKEIFPFIPEDARKCILCLAYMTDPSCSPCGHIFCWECILDWCKER 311

Query: 309 PECPLCRQRSYPQQV 323
           PECPLCRQ    QQ+
Sbjct: 312 PECPLCRQECQIQQI 326

>AER390W [2890] [Homologous to ScYDR265W (PEX10) - SH]
           complement(1370316..1370364,1370423..1371324) [951 bp,
           316 aa]
          Length = 316

 Score =  294 bits (752), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 149/319 (46%), Positives = 212/319 (66%), Gaps = 19/319 (5%)

Query: 10  LPFAGAPSIVQAHQKDEQIETMLSVKVSELLRGVRGQLFINNYQKEISVVVKLIYLGLTT 69
            PFA APSIVQAHQKD  IE++L  K+ + L+ ++GQLF N Y +EIS+  K++YLGLTT
Sbjct: 8   FPFADAPSIVQAHQKDVYIESILGTKLEDALKALKGQLFANRYYQEISIASKILYLGLTT 67

Query: 70  ALSRRTLGEEYVDLIYVNKRGSQLVRGIKRVLFVLSYTSIPYLVTKLSKKVNNRSTNNEE 129
              RRTLGEEYVDLIYV++ G  LV+  +R+LFVLSY ++PY ++KL K++  R  ++  
Sbjct: 68  LRERRTLGEEYVDLIYVSRNGMGLVKAWRRLLFVLSYAALPYGLSKLFKRLKRRYEDDTP 127

Query: 130 SDDG-----NESTYTDILSTMIDLHLMVFYITGTYYDVFKRFWGMRYALGHTLSQEEENY 184
           + +G        T+ DI+   + +HL+VFY+TG +Y + KR +G+RYA+GH +++EE+ +
Sbjct: 128 NKNGILHYLAGLTFKDIMDNALSVHLLVFYLTGGFYQISKRIFGLRYAIGHDVTKEEKEF 187

Query: 185 RDKSSKSYKILGYIILLQHISKVKPIINKVLSILPQTKETLNAGSNGVGLKEGFAPAATP 244
           R  SS+SY+ILG ++LLQ ++KV+P +N +L +  ++        NG+ L  G +P AT 
Sbjct: 188 RKSSSRSYRILGGLVLLQLLAKVQPHVNTMLKMYLKSPTENATNKNGI-LTNG-SPEATA 245

Query: 245 GLLTDVPENFNIDHIKLSNGKELAFIPTESRNCILCLMEMTDPSCLPCGHVFCWDCITDW 304
                        HI+LSN +   FI  +SR CILCL +MTDPSCLPCGH+FCW C+  W
Sbjct: 246 ------------RHIELSNPEIFPFISEQSRKCILCLADMTDPSCLPCGHMFCWACVMQW 293

Query: 305 TKENPECPLCRQRSYPQQV 323
             E  ECPLCRQ    Q +
Sbjct: 294 CNERNECPLCRQHCTKQSI 312

>KLLA0E16720g complement(1481372..1482289) similar to sp|Q05568
           Saccharomyces cerevisiae YDR265w PAS4 peroxisomal
           assembly protein - peroxin singleton, start by
           similarity
          Length = 305

 Score =  275 bits (703), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 139/317 (43%), Positives = 204/317 (64%), Gaps = 24/317 (7%)

Query: 9   KLPFAGAPSIVQAHQKDEQIETMLSVKVSELLRGVRGQLFINNYQKEISVVVKLIYLGLT 68
           K PFA APSIVQAHQKD+ +E +L  K+ ++LR V+GQ F N Y  EI ++ KLIYL +T
Sbjct: 6   KFPFADAPSIVQAHQKDDTVENLLLQKIQDVLRKVKGQQFTNRYVSEIMILSKLIYLSIT 65

Query: 69  TALSRRTLGEEYVDLIYVNKRGSQLVRGIKRVLFVLSYTSIPYLVTKL--SKKVNNRSTN 126
           T   RRTLGEEYVDL YV++RG  + R ++R+ F +SY  +P++++K+    K+N R + 
Sbjct: 66  TLRYRRTLGEEYVDLAYVDRRGKGVARLLRRIGFAISYCGVPWILSKVFYKYKLNERGSG 125

Query: 127 NEESDDGNESTYTDILSTMIDLHLMVFYITGTYYDVFKRFWGMRYALGHTLSQEEENYRD 186
             +  +G   ++ DIL + ++LHL++FY++G YYD+ KR +GMRY +GH +++ E  ++ 
Sbjct: 126 FLKVFNGK--SFRDILDSTLNLHLIIFYLSGQYYDISKRIFGMRYVVGHEMNKNEVEFKK 183

Query: 187 KSSKSYKILGYIILLQHISKVKPIINKVLSILPQTKETLNAGSNGVGLKEGFAPAATPGL 246
           KSS++YKILG+I+ +Q  SK          +LPQ  E +   ++ +G  +G +  +   L
Sbjct: 184 KSSQNYKILGFILGMQLASK----------LLPQIAEYI---ADRIGTDDGKSHKSLSAL 230

Query: 247 LTDVPENFNIDHIKLSNGKELAFIPTESRNCILCLMEMTDPSCLPCGHVFCWDCITDWTK 306
                         LS+ + L FI  +SR C+LCL  M DPS  PCGH+FCWDCI +WT 
Sbjct: 231 AKKHTSK------DLSDLEVLPFIKEDSRKCVLCLNYMLDPSATPCGHLFCWDCIMEWTL 284

Query: 307 ENPECPLCRQRSYPQQV 323
           E  ECPLCRQR  P+Q+
Sbjct: 285 ERQECPLCRQRC-PRQL 300

>Kwal_55.19999
          Length = 152

 Score =  134 bits (337), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 67/156 (42%), Positives = 91/156 (58%), Gaps = 9/156 (5%)

Query: 169 MRYALGHTLSQEEENYRDKSSKSYKILGYIILLQHISK-VKPIINKVLSILPQTKETLNA 227
           MRYA+GH L + E  +R+  +K+Y+ILG ++L+Q  SK + P    +  ++   +     
Sbjct: 1   MRYAVGHKLDESEIRFRESGNKTYRILGTLLLVQLFSKRLLPAFRWMKGLIADDQNEKAT 60

Query: 228 GSNGVGLKEGFAPAATPGLLTDVPENFNIDHIKLSNGKELAFIPTESRNCILCLMEMTDP 287
            S    L  G    +T GL TD      ++HI L    E++FIP++SR CILCL  M DP
Sbjct: 61  SS----LSVGETTLSTAGLPTDS----QVEHIGLEQASEMSFIPSDSRKCILCLGFMLDP 112

Query: 288 SCLPCGHVFCWDCITDWTKENPECPLCRQRSYPQQV 323
           SC PCGHVFCW C+  W  E PECPLCRQ  + Q V
Sbjct: 113 SCAPCGHVFCWKCLLSWCNERPECPLCRQTCHAQNV 148

>Sklu_1676.3 YDR265W, Contig c1676 2766-3071 reverse complement
          Length = 101

 Score = 99.4 bits (246), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 54/77 (70%)

Query: 247 LTDVPENFNIDHIKLSNGKELAFIPTESRNCILCLMEMTDPSCLPCGHVFCWDCITDWTK 306
           ++ VP + +I H+ LS+  ++ FI   SR CILCL EM DPSC PCGH+FCW+CI +W K
Sbjct: 21  ISGVPLDSSIRHVDLSDPAQMPFINESSRKCILCLTEMKDPSCAPCGHIFCWNCIINWCK 80

Query: 307 ENPECPLCRQRSYPQQV 323
           E  ECPLCRQ+   Q +
Sbjct: 81  ERSECPLCRQKCLKQSI 97

>KLLA0F12166g complement(1116715..1121301) weakly similar to
            sgd|S0004237 Saccharomyces cerevisiae YLR247c,
            hypothetical start
          Length = 1528

 Score = 57.4 bits (137), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 268  AFIPTESRNCILCLMEMTDPSCLPCGHVFCWDCITDWTKENPECPLCRQRSYPQQV 323
            A    E+ +C +C  ++   S L CGH FC DC+T W K+N  CP+C+ R    +V
Sbjct: 1199 AIANGENISCAVCYSDIYTGSILKCGHFFCKDCVTHWFKKNTSCPMCKNRMSSSEV 1254

>Kwal_14.1287
          Length = 1518

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 27/43 (62%)

Query: 276  NCILCLMEMTDPSCLPCGHVFCWDCITDWTKENPECPLCRQRS 318
            +C +CL E+   S + CGH FC DCI  W K +  CPLC+ ++
Sbjct: 1188 SCTICLGEIYMGSVIKCGHFFCQDCICSWLKNHSSCPLCKMQT 1230

>Sklu_2432.9 , Contig c2432 20306-24733 reverse complement
          Length = 1475

 Score = 54.3 bits (129), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%)

Query: 273  ESRNCILCLMEMTDPSCLPCGHVFCWDCITDWTKENPECPLCRQRSYPQQV 323
            E  +C +C  E+   S + CGH FC+ CI  W KE+  CPLC+    P +V
Sbjct: 1161 EELSCAVCFNEIFVGSVVKCGHFFCYSCIHTWLKEHNTCPLCKTNVTPSEV 1211

>Scas_573.9
          Length = 1502

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 26/43 (60%)

Query: 273  ESRNCILCLMEMTDPSCLPCGHVFCWDCITDWTKENPECPLCR 315
            +S  C +CL +++  S L CGH FC  CIT W K    CP+C+
Sbjct: 1187 KSFKCSICLQDISLGSMLKCGHFFCKRCITSWLKNKKNCPMCK 1229

>CAGL0B05049g 487186..491598 some similarities with tr|Q06554
            Saccharomyces cerevisiae YLR247c, hypothetical start
          Length = 1470

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 24/40 (60%)

Query: 277  CILCLMEMTDPSCLPCGHVFCWDCITDWTKENPECPLCRQ 316
            C +CL  +T+ + + CGH+FC  CI  W K    CPLC+ 
Sbjct: 1164 CSICLQPITNGAMVNCGHLFCTSCIFSWLKNRKTCPLCKH 1203

>AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4620
            bp, 1539 aa]
          Length = 1539

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 27/43 (62%)

Query: 276  NCILCLMEMTDPSCLPCGHVFCWDCITDWTKENPECPLCRQRS 318
            NC +CL ++ D + +  GH +C +CI+ W +    CPLC+ ++
Sbjct: 1218 NCTICLCDICDGAIIGRGHFYCQECISSWLETKQSCPLCKTQT 1260

>YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protein
            containing an SNF2 related N-terminal domain, a C3HC4
            type (RING) zinc finger, and a helicase conserved
            C-terminal domain, has a region of low similarity to a
            region of transcription termination factor RNA polymerase
            II (human TTF2) [4671 bp, 1556 aa]
          Length = 1556

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 24/39 (61%)

Query: 277  CILCLMEMTDPSCLPCGHVFCWDCITDWTKENPECPLCR 315
            C +CL E+   + + CGH FC  CI  W + + +CP+C+
Sbjct: 1239 CSICLGEVEIGAIIKCGHYFCKSCILTWLRAHSKCPICK 1277

>KLLA0E03960g 369201..371315 some similarities with sp|P22470
           Saccharomyces cerevisiae YDR143c SAN1 mating-type
           regulation protein singleton, hypothetical start
          Length = 704

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 288 SCLPCGHVFCWDCITDWTKENPECPLCR 315
           + LPCGHVF  +C+  WT E+  CP+CR
Sbjct: 215 TVLPCGHVFGRECLYKWTTEHNSCPICR 242

>YDR143C (SAN1) [988] chr4 complement(742036..743868) Protein that
           may antagonize the function of Spt16p and Sir4p [1833
           bp, 610 aa]
          Length = 610

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 25/41 (60%), Gaps = 6/41 (14%)

Query: 283 EMTDPS------CLPCGHVFCWDCITDWTKENPECPLCRQR 317
           E T+PS       LPCGH+F  +CI  W++    CPLCRQ+
Sbjct: 242 EETNPSYKHSPIKLPCGHIFGRECIYKWSRLENSCPLCRQK 282

>Kwal_56.22522
          Length = 513

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 41/93 (44%), Gaps = 12/93 (12%)

Query: 234 LKEGFAPAATP-GLLTDVPENFNIDHIKLSNGKELAFIPTESRNCILCLMEMTDPS-C-- 289
           L + FA   T   LL     N  ID  KL +  E     ++ + CI+C+ +M  PS C  
Sbjct: 273 LWDAFAVFHTAKSLLLTWKSNRQIDE-KLPDVSEAQLAASDDKMCIVCMDDMLAPSECTN 331

Query: 290 -------LPCGHVFCWDCITDWTKENPECPLCR 315
                  LPC H     C+  W + +  CP+CR
Sbjct: 332 AKQKPKRLPCNHCLHLGCLKSWMERSQTCPICR 364

>CAGL0J03586g complement(341290..342525) similar to sp|P10862
           Saccharomyces cerevisiae YCR066w RAD18 DNA repair
           protein, hypothetical start
          Length = 411

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 21/38 (55%)

Query: 277 CILCLMEMTDPSCLPCGHVFCWDCITDWTKENPECPLC 314
           C +C   + +P   PCGH FC  CI  +    P+CPLC
Sbjct: 27  CHICKDFLKNPVLTPCGHTFCSLCIRGYLSNEPKCPLC 64

>CAGL0E01441g 135075..137228 weakly similar to sp|P22470
           Saccharomyces cerevisiae YDR143c mating-type regulation
           protein, hypothetical start
          Length = 717

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (67%)

Query: 287 PSCLPCGHVFCWDCITDWTKENPECPLCRQR 317
           P  +PCGH+F   C+ +WT+    CPLCR++
Sbjct: 290 PVKIPCGHIFGRSCLYEWTRLENSCPLCRKK 320

>Scas_720.89
          Length = 469

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%)

Query: 277 CILCLMEMTDPSCLPCGHVFCWDCITDWTKENPECPLC 314
           C +C   +  P   PC H FC  CI ++ K+N +CPLC
Sbjct: 28  CHICKDFLKVPVLTPCSHTFCSLCIREYLKDNSKCPLC 65

>CAGL0E02299g complement(219009..220646) similar to tr|Q08109
           Saccharomyces cerevisiae YOL013c HRD1, start by
           similarity
          Length = 545

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 12/57 (21%)

Query: 271 PTESRNCILCLMEMTD------------PSCLPCGHVFCWDCITDWTKENPECPLCR 315
           P     CI+C+ E+              P  LPCGHV    C+ +W + +  CP+CR
Sbjct: 344 PNFDNVCIVCMDELVSENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICR 400

>Sklu_2317.2 YDR143C, Contig c2317 4002-5483
          Length = 493

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 19/29 (65%)

Query: 287 PSCLPCGHVFCWDCITDWTKENPECPLCR 315
           P+ L CGH F   CI  WTKE+  CP+CR
Sbjct: 136 PTQLKCGHRFGRMCIYQWTKEHNSCPICR 164

>YOL013C (HRD1) [4803] chr15 complement(301380..303035) E3 ubiquitin
           ligase required for endoplasmic reticulum-associated
           degradation of misfolded luminal and integral membrane
           proteins [1656 bp, 551 aa]
          Length = 551

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 13/52 (25%)

Query: 277 CILCLMEMTD-------------PSCLPCGHVFCWDCITDWTKENPECPLCR 315
           CI+C+ E+               P  LPCGH+    C+ +W + +  CP+CR
Sbjct: 349 CIICMDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICR 400

>Scas_625.11
          Length = 274

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 39/86 (45%), Gaps = 19/86 (22%)

Query: 250 VPENFNIDHIKLSNGK-------------ELAFIPTESRNCILCLMEMTDP-----SCLP 291
           +PENF+I   + S  K               A +   S  C +C +  +D      +CLP
Sbjct: 170 IPENFDIITSQRSAAKPCTNEFIEQLPRTNCAELSNSSDECPICRIAYSDDFETEITCLP 229

Query: 292 -CGHVFCWDCITDWTKENPECPLCRQ 316
            C H F ++CI  W ++N  CPLCR 
Sbjct: 230 NCSHHFHFECIKLWLQKNSLCPLCRD 255

>ACL019C [1030] [Homologous to ScYOL013C (HRD1) - SH]
           (328044..329771) [1728 bp, 575 aa]
          Length = 575

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 11/66 (16%)

Query: 260 KLSNGKELAFIPTESRNCILCLMEMTDPS----------CLPCGHVFCWDCITDWTKENP 309
           KLS+  E     T+S  CI+C+ +M   +           LPCGH+  + C+  W + + 
Sbjct: 304 KLSDVSEEQLDDTDSM-CIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQ 362

Query: 310 ECPLCR 315
            CP+CR
Sbjct: 363 TCPICR 368

>CAGL0K02563g complement(230983..232743) similar to sp|P38748
           Saccharomyces cerevisiae YHL010c, hypothetical start
          Length = 586

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 38/91 (41%), Gaps = 22/91 (24%)

Query: 237 GFAPAATPGLLTD----VPENFNIDHIKLSNGKELAFIPTESRNCILCLMEMTDPSC--- 289
           G      P LL D    V EN N DH           +PT    C +CL  M   +    
Sbjct: 215 GDEKKELPYLLNDPFTTVRENTNADHD--------VELPT----CPVCLERMDSETTGLI 262

Query: 290 -LPCGHVFCWDCITDWTKENPECPLCRQRSY 319
            +PC H F   C+  W  +N +CP+CR  S+
Sbjct: 263 TIPCQHTFHCQCLDKW--KNSKCPVCRLSSF 291

>Scas_713.45
          Length = 570

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 19/29 (65%)

Query: 287 PSCLPCGHVFCWDCITDWTKENPECPLCR 315
           P+ LPCGH+F  +C+  W K    CPLCR
Sbjct: 230 PTKLPCGHIFGRECLYRWCKLENTCPLCR 258

>YLR427W (MAG2) [3803] chr12 (988424..990436) Protein containing a
           C3HC4 type (RING) zinc finger, which may mediate
           protein-protein interactions, has low similarity to
           uncharacterized C. albicans Orf6.6916p [2013 bp, 670 aa]
          Length = 670

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 40/92 (43%), Gaps = 17/92 (18%)

Query: 249 DVPENFNIDHIKLSNGKELAFIPTESRNCILCLMEM-TDPSCLPCGHVFCWDCITDW--- 304
           D PE     ++ +   K L  I  + +NC +CL E    P  + CGH+FC  C+ ++   
Sbjct: 167 DYPEQNCNPNVPVDQEKILRVIVPKGQNCSICLSEEPVAPRMVTCGHIFCLSCLLNFFSI 226

Query: 305 -------------TKENPECPLCRQRSYPQQV 323
                         K+  ECPLC     P++V
Sbjct: 227 EETVKNKETGYSKKKKYKECPLCGSIIGPKRV 258

>Scas_477.7
          Length = 244

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 3/50 (6%)

Query: 265 KELAFIPTESRNCILCLMEMTDPSCLPCGHVFCWDCITDWTKENPECPLC 314
           K+L  IP +   C+LC  +   P    CGH FC  C T   +E+  C +C
Sbjct: 12  KKLEEIPFK---CVLCKDDYKSPIVTNCGHYFCSSCFTKRVREDASCFIC 58

>Kwal_56.23900
          Length = 589

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 18/29 (62%)

Query: 287 PSCLPCGHVFCWDCITDWTKENPECPLCR 315
           P  LPC HVF  +CI  WT  +  CP+CR
Sbjct: 222 PVQLPCSHVFGRECIRQWTNLHNTCPICR 250

>YCR066W (RAD18) [592] chr3 (231495..232958) Multifunctional DNA
           repair protein, required for post-replication repair
           [1464 bp, 487 aa]
          Length = 487

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 18/38 (47%)

Query: 277 CILCLMEMTDPSCLPCGHVFCWDCITDWTKENPECPLC 314
           C +C   +  P   PCGH FC  CI       P CPLC
Sbjct: 28  CHICKDFLKVPVLTPCGHTFCSLCIRTHLNNQPNCPLC 65

>Scas_719.51
          Length = 647

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 17/57 (29%)

Query: 275 RNCILCLMEMT-DPSCLPCGHVFCWDCITDW-----TKENP-----------ECPLC 314
           +NC +CL E    P  + CGH+FC  C+ ++     T +NP           ECPLC
Sbjct: 175 QNCPICLSEEPIAPRMITCGHIFCMSCLINFFSIEETIKNPETGYVKKKKYKECPLC 231

>Scas_705.41
          Length = 428

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 7/46 (15%)

Query: 277 CILCLMEMTDPSCL-----PCGHVFCWDCITDWT--KENPECPLCR 315
           C +C  ++ D   L     PC H + +DCI  W    +N +CPLCR
Sbjct: 12  CPICFDDLNDTDILQGKLKPCNHKYHYDCIRRWHGYSDNSDCPLCR 57

>YOL054W (YOL054W) [4765] chr15 (228612..229832) Protein required
           for normal resistance to NaCl and for normal mating
           efficiency of MATa cells, contains a C3HC4-type zinc
           finger [1221 bp, 406 aa]
          Length = 406

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 4/47 (8%)

Query: 273 ESRNCILCLMEMTDPSCLPCGHVFCWDCITDWTKENPE----CPLCR 315
           ES  C +C   M  P   PCGH +C+ C+  W   N +    CP CR
Sbjct: 26  ESLVCSICHDYMFVPMMTPCGHNYCYGCLNTWFASNTQKELACPQCR 72

>CAGL0J04796g 453697..455496 similar to tr|Q06436 Saccharomyces
           cerevisiae YLR427w, hypothetical start
          Length = 599

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 17/57 (29%)

Query: 275 RNCILCLMEM-TDPSCLPCGHVFCWDCITDWTK-----ENP-----------ECPLC 314
           +NC +CL E+   P  + CGH+FC  C+ ++ +     +NP           ECPLC
Sbjct: 150 QNCPICLNEIPVAPRMVTCGHIFCMSCLENFFEIEEVVKNPETGIKQKKKFKECPLC 206

>AGL191W [4121] [Homologous to ScYDR143C (SAN1) - SH]
           complement(339295..341043) [1749 bp, 582 aa]
          Length = 582

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%)

Query: 287 PSCLPCGHVFCWDCITDWTKENPECPLCRQR 317
           P+ LPCGHVF  DCI  WT+E+     C  R
Sbjct: 221 PTELPCGHVFGRDCIFRWTQEHNSLSYCWAR 251

>KLLA0C05874g complement(520079..521740) weakly similar to
           sgd|S0005373 Saccharomyces cerevisiae YOL013c HRD1
           involved in degradation of HMG2P, start by similarity
          Length = 553

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 12/50 (24%)

Query: 277 CILCLMEMTDPS-----------CLPCGHVFCWDCITDWTKENPECPLCR 315
           CI+C ME   PS            LPC H     C+ +W   +P CP+CR
Sbjct: 353 CIVC-MEDFLPSHQRKSDGKKVKILPCTHALHLSCLKNWIARSPTCPICR 401

>AAR049C [235] [Homologous to ScYCR066W (RAD18) - SH]
           (428904..430235) [1332 bp, 443 aa]
          Length = 443

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 32/71 (45%), Gaps = 6/71 (8%)

Query: 244 PGLLTDVPENFNIDHIKLSNGKELAFIPTESRNCILCLMEMTDPSCLPCGHVFCWDCITD 303
           PG +   P +F    I      ELA + +  R C +C   +  P    CGH FC  CI +
Sbjct: 5   PGQVVTDPSDFAGTTIP-----ELADLDSLLR-CHICKDMLQTPVLTQCGHTFCSLCIRE 58

Query: 304 WTKENPECPLC 314
           +  +   CPLC
Sbjct: 59  YLNKESRCPLC 69

>Scas_644.6
          Length = 510

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 7/46 (15%)

Query: 277 CILCLMEMTDPSC-------LPCGHVFCWDCITDWTKENPECPLCR 315
           CI+C+ ++            LPCGH     C+ +W + +  CP+CR
Sbjct: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398

>YER068W (MOT2) [1499] chr5 (293048..294811) Zinc finger
           transcriptional repressor, involved in G protein
           mediated pheromone signal transduction and member of the
           CCR4-Not complex [1764 bp, 587 aa]
          Length = 587

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 36/76 (47%), Gaps = 9/76 (11%)

Query: 250 VPENFNIDHIKLSNGKELAFIPTESRNCILCL--MEMTDPSCLPC--GHVFCWDCITDWT 305
           V EN    H  LSN         E   C LC+  M++TD +  PC  G+  C  C  +  
Sbjct: 6   VQENLQAIHNALSNFDTSFLSEDEEDYCPLCIEPMDITDKNFFPCPCGYQICQFCYNN-I 64

Query: 306 KENPE----CPLCRQR 317
           ++NPE    CP CR++
Sbjct: 65  RQNPELNGRCPACRRK 80

>Sklu_1785.3 YOL054W, Contig c1785 2663-3658 reverse complement
          Length = 331

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 4/33 (12%)

Query: 287 PSCLPCGHVFCWDCITDWTKENPE----CPLCR 315
           P    CGH +C+DCI++W   N      CP CR
Sbjct: 4   PVMTSCGHNYCYDCISNWLNNNNATELTCPQCR 36

>KLLA0C18260g 1613311..1614000 similar to sp|P53769 Saccharomyces
           cerevisiae YLR323c singleton, start by similarity
          Length = 229

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 17/38 (44%)

Query: 277 CILCLMEMTDPSCLPCGHVFCWDCITDWTKENPECPLC 314
           C LC  E T P    C H FC  C     K +  CP+C
Sbjct: 171 CFLCKKEYTSPVVTKCNHYFCSSCFMKQMKVSTNCPIC 208

>Kwal_23.6285
          Length = 458

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 18/38 (47%)

Query: 277 CILCLMEMTDPSCLPCGHVFCWDCITDWTKENPECPLC 314
           C +C   +  P   PC H FC  CI ++      CPLC
Sbjct: 37  CHICKDFIKSPVLTPCAHTFCSLCIREYLNRELRCPLC 74

>Scas_665.1
          Length = 392

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 4/47 (8%)

Query: 273 ESRNCILCLMEMTDPSCLPCGHVFCWDCITDWTKENPE----CPLCR 315
           ES  C +C   M  P    CGH +C+ C+  W   N +    CP CR
Sbjct: 26  ESAICTICSEYMFVPMMTSCGHNYCYGCLKSWISTNSKKELACPQCR 72

>KLLA0C08756g complement(765847..767130) weakly similar to sp|P10862
           Saccharomyces cerevisiae YCR066w RAD18 DNA repair
           protein singleton, start by similarity
          Length = 427

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 20/38 (52%)

Query: 277 CILCLMEMTDPSCLPCGHVFCWDCITDWTKENPECPLC 314
           C +C   +      PCGH FC  CI  + ++  +CPLC
Sbjct: 32  CHICKDFLKASVLTPCGHSFCSICIRKYLQKESKCPLC 69

>Scas_672.2
          Length = 263

 Score = 36.6 bits (83), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 33/73 (45%), Gaps = 7/73 (9%)

Query: 250 VPENFNIDHIKLSNGKELAFIPTESRNCILCLMEMTDPSCLPCGHVFCWDCITDWT---- 305
           +P++   D I+    +E  + P     C +C+         PCGHVFC DC+        
Sbjct: 171 IPDDEIEDEIQRGKKQE-TYRPVTEYRCPICMDPPETALIAPCGHVFCCDCLFQMVNSSR 229

Query: 306 --KENPECPLCRQ 316
             +++  C LCR+
Sbjct: 230 TYRKDGHCALCRK 242

>AER074W [2579] [Homologous to ScYDL074C (BRE1) - SH]
           complement(775019..776950) [1932 bp, 643 aa]
          Length = 643

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 25/61 (40%), Gaps = 7/61 (11%)

Query: 261 LSNGKELAFIPTESRN------CILCLMEMTDPSCLPCGHVFCWDCITD-WTKENPECPL 313
           +SNG +   +  E  N      C LC     D     CGHVFC DC  +       +CP 
Sbjct: 569 VSNGGDNGALAEELENFRTVVYCSLCSKNWKDTVIKTCGHVFCADCCKERLAARMRKCPT 628

Query: 314 C 314
           C
Sbjct: 629 C 629

>Scas_625.4
          Length = 761

 Score = 37.0 bits (84), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 16/25 (64%)

Query: 291 PCGHVFCWDCITDWTKENPECPLCR 315
           PC H+F  DC+ +W     +CP+CR
Sbjct: 731 PCDHIFHTDCLENWMGYKLQCPVCR 755

>Sklu_2423.8 YDL074C, Contig c2423 13513-15456 reverse complement
          Length = 647

 Score = 37.0 bits (84), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 26/61 (42%), Gaps = 7/61 (11%)

Query: 261 LSNGKELAFIPTESRN------CILCLMEMTDPSCLPCGHVFCWDCITD-WTKENPECPL 313
           +SNG +   I  E  N      C LC     + +   CGHVFC +C  +       +CP 
Sbjct: 573 ISNGGDAGVIAEELENFRTVVYCSLCSKNWKNTAIKSCGHVFCEECCKERLAARMRKCPT 632

Query: 314 C 314
           C
Sbjct: 633 C 633

>YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein that
           binds in vitro to proteins containing canonical nuclear
           localization signal, has similarity to human BRAP2
           breast cancer-associated protein which may regulate
           protein import into the nucleus [1758 bp, 585 aa]
          Length = 585

 Score = 36.6 bits (83), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 6/46 (13%)

Query: 277 CILCLMEMTDPSC----LPCGHVFCWDCITDWTKENPECPLCRQRS 318
           C +CL  M   +     +PC H F   C+  W  +N  CP+CR  S
Sbjct: 240 CPVCLERMDSETTGLVTIPCQHTFHCQCLNKW--KNSRCPVCRHSS 283

>Kwal_26.8099
          Length = 750

 Score = 36.6 bits (83), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 35/83 (42%), Gaps = 18/83 (21%)

Query: 250 VPENFNIDHIKLSNGKELAFIPTESR--NCILCLMEMT---------------DPSCLPC 292
           +PE ++  H  +S+G  L    + S   +C +C+ E+                D    PC
Sbjct: 663 IPEGYSY-HKGISSGDLLEHGSSSSYSVDCAICMSEVAVYVDDIPETHKVDKDDYMITPC 721

Query: 293 GHVFCWDCITDWTKENPECPLCR 315
            H+F   C+  W     +CP+CR
Sbjct: 722 SHIFHTQCLESWMSYKLQCPVCR 744

>AGL217W [4095] [Homologous to ScYOL054W - SH]
           complement(290043..291287) [1245 bp, 414 aa]
          Length = 414

 Score = 36.6 bits (83), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 28/63 (44%), Gaps = 6/63 (9%)

Query: 259 IKLSNGKELAFIPT--ESRNCILCLMEMTDPSCLPCGHVFCWDCITDWTKENPE----CP 312
           +K S  K L  I    E+  C +C   M  P    CGH +C+ CI++W          CP
Sbjct: 18  VKQSGRKHLIIIRKLLETTICTICHDYMYVPVMTGCGHNYCYFCISNWLNNTSSTELNCP 77

Query: 313 LCR 315
            CR
Sbjct: 78  QCR 80

>AFR499C [3691] [Homologous to ScYLR323C (CWC24) - SH]
           (1339549..1340301) [753 bp, 250 aa]
          Length = 250

 Score = 36.2 bits (82), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 24/56 (42%), Gaps = 3/56 (5%)

Query: 259 IKLSNGKELAFIPTESRNCILCLMEMTDPSCLPCGHVFCWDCITDWTKENPECPLC 314
           +  +  ++L  IP     C+LC      P    CGH FC  C     +E  +C +C
Sbjct: 143 VGQTEARDLDSIPF---RCVLCRGHYRAPVRTRCGHYFCGGCFARRVRETRQCAVC 195

>CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces
           cerevisiae YLR032w RAD5, hypothetical start
          Length = 1151

 Score = 36.6 bits (83), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 36/157 (22%), Positives = 63/157 (40%), Gaps = 17/157 (10%)

Query: 177 LSQEEENYRDKSSKSYKILGYIILLQHISKVKPII--NKVLSILPQTKETLNAGSNGVGL 234
           L + E+ +R        +  Y  +L HI +++ +   + ++  L +  E L++G+N +  
Sbjct: 789 LQRAEKTFRSGLQSGDLLKKYSTILVHILRLRQVCCDSNLIGTLDENDEDLSSGNNKLIT 848

Query: 235 KEGFAPAATPGLL---TDVPENFNIDHIKLSNGKELAFI------PTESRNCILCLMEMT 285
           +        P       +VP   N +  KL    E  FI      P E   C    +E +
Sbjct: 849 ESVDVKTLIPDTEEEEDEVPPFENDELDKLIESVEAKFIDSNQLIPVECSICTAEPIESS 908

Query: 286 DPSCLPCGHVFCWDCITDWTKENPE------CPLCRQ 316
                 C HVFC +C+ ++     E      CP CR+
Sbjct: 909 SAVVTECEHVFCKECLEEYGNFQKEKSLQQKCPNCRR 945

>YLR323C (CWC24) [3710] chr12 complement(778173..778952) Protein
           containing a CCCH-type zinc finger domain, which bind
           DNA or RNA, and a C3HC4 type (RING) zinc finger, which
           may mediate protein-protein interactions, has low
           similarity to uncharacterized zinc finger protein 183
           (human ZNF183) [780 bp, 259 aa]
          Length = 259

 Score = 35.8 bits (81), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 20/43 (46%)

Query: 277 CILCLMEMTDPSCLPCGHVFCWDCITDWTKENPECPLCRQRSY 319
           C LC  +   P    CGH FC  C     K+  +C +C + ++
Sbjct: 199 CTLCKEDYKSPVVTNCGHYFCGSCFAKDMKKGTKCFICHKETH 241

>Kwal_27.10419
          Length = 300

 Score = 35.8 bits (81), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 4/33 (12%)

Query: 287 PSCLPCGHVFCWDCITDWTKENPE----CPLCR 315
           P    CGH +C+DCI++W   N      CP CR
Sbjct: 4   PVMTTCGHNYCYDCISNWLVSNNANELTCPQCR 36

>CAGL0K08052g complement(800162..801079) weakly similar to tr|Q06834
           Saccharomyces cerevisiae YPR093c, hypothetical start
          Length = 305

 Score = 35.8 bits (81), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 6/48 (12%)

Query: 274 SRNCILCLMEMTDPSCL----PCGHVFCWDCITDW--TKENPECPLCR 315
           S+ C +CL ++   S      PCGH +  DCI  W    E+ +CP+CR
Sbjct: 3   SKVCAICLEDICGKSSTSYLKPCGHEYHSDCIRKWHGHAEDLKCPMCR 50

>Sklu_2102.1 YKL034W, Contig c2102 417-2672 reverse complement
          Length = 751

 Score = 36.2 bits (82), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 15/25 (60%)

Query: 291 PCGHVFCWDCITDWTKENPECPLCR 315
           PCGH+F   C+  W     +CP+CR
Sbjct: 721 PCGHIFHTQCLESWMSYKLQCPVCR 745

>Kwal_47.17771
          Length = 972

 Score = 35.8 bits (81), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 30/67 (44%), Gaps = 14/67 (20%)

Query: 271 PTESR----NCILCLMEMTDPSC----LPCGHVFCWDCITDWTK------ENPECPLCRQ 316
           P E R     C +C  E  DP        CGH FC  CI ++ +      ++ +CP CR 
Sbjct: 709 PHEDRLRNLECSICTSEPIDPVTQVIFTECGHAFCELCILEYIRFQTERQQDIKCPNCRH 768

Query: 317 RSYPQQV 323
              P+++
Sbjct: 769 EINPKRL 775

>Sklu_2411.2 YMR026C, Contig c2411 3617-4798
          Length = 393

 Score = 35.4 bits (80), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 274 SRNCILCLMEMTDPSCLPCGHVFCWDCITDWTKENP-ECPLCRQR 317
           S  C +C   +T+P  +  G+VFC+ C+ ++   N  +CP+  +R
Sbjct: 326 STKCEICHQIITNPCAIETGYVFCYPCVLNYLPANEGKCPVTGKR 370

>YKL034W (TUL1) [3222] chr11 (371472..373748) Protein containing a
           C3HC4 type (RING) zinc finger, which may mediate
           protein-protein interactions, has low similarity to
           uncharacterized C. albicans Orf6.5365p [2277 bp, 758 aa]
          Length = 758

 Score = 35.8 bits (81), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 15/25 (60%)

Query: 291 PCGHVFCWDCITDWTKENPECPLCR 315
           PC HVF   C+ +W     +CP+CR
Sbjct: 728 PCNHVFHTSCLENWMNYKLQCPVCR 752

>Scas_701.4
          Length = 612

 Score = 35.8 bits (81), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 35/76 (46%), Gaps = 9/76 (11%)

Query: 250 VPENFNIDHIKLSNGKELAFIPTESRNCILCL--MEMTDPSCLPC--GHVFCWDCITDWT 305
           V EN       LSN         E   C LC+  M++TD +  PC  G+  C  C  +  
Sbjct: 7   VHENLQSIQAALSNYDTSFLSDDEEEFCPLCIEPMDITDKNFFPCPCGYQICQFCYNN-I 65

Query: 306 KENPE----CPLCRQR 317
           ++NPE    CP CR++
Sbjct: 66  RQNPELNGRCPACRRK 81

>CAGL0F00803g 88454..90970 similar to sp|P19659 Saccharomyces
           cerevisiae YOL051w GAL11 DNA-directed RNA polymerase II,
           hypothetical start
          Length = 838

 Score = 35.4 bits (80), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 30/130 (23%), Positives = 56/130 (43%), Gaps = 23/130 (17%)

Query: 136 STYTDILSTMIDLHLMVFYITGTYYDVFKRFWGMRYALGHTLSQEEENYRDKSSKSYKIL 195
           S Y + LS +  +   + +I     +V K++   RY LGH L+ EE           +++
Sbjct: 241 SKYQEQLSKLFKME-EIKHIIQQAIEVGKKYATQRYQLGHMLTNEE-----------RVV 288

Query: 196 GYIILLQHISKVKPIINKVLSILPQTKETLNAGSNGVGLKEGFAPAATPGLLTDVPENFN 255
            +   L H+         +L  + +TK +    +  + L +      T G  + VP+ FN
Sbjct: 289 FFKKFLNHV---------ILKKMEETKGSNKTDATMMNLTDNHTQMGT-GQESTVPQQFN 338

Query: 256 IDHIKLSNGK 265
            D + +SN +
Sbjct: 339 TDQV-ISNNQ 347

>CAGL0G09493g complement(902228..906454) similar to tr|Q08562
            Saccharomyces cerevisiae YOR191w RIS1, hypothetical start
          Length = 1408

 Score = 35.0 bits (79), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 39/87 (44%), Gaps = 17/87 (19%)

Query: 232  VGLKEGFAPAATPGLLTDVPENFNIDHIKL--------SNGKELAFIPTESRNCILCLME 283
            +G K+  A     G      +NFN D ++L        S   E+    ++S  C+ CL +
Sbjct: 1072 LGEKKAEAATVVNG------KNFNNDWLRLYYVIKKMKSEAVEIVKSASDSMTCLWCLEQ 1125

Query: 284  MTDPSCL---PCGHVFCWDCITDWTKE 307
            +   S      CGH+ C DCI  ++++
Sbjct: 1126 IEPESAFVLSGCGHLICNDCINPFSED 1152

>KLLA0F25674g 2384293..2386566 similar to sp|P36096 Saccharomyces
           cerevisiae YKL034w singleton, start by similarity
          Length = 757

 Score = 35.0 bits (79), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 16/25 (64%)

Query: 291 PCGHVFCWDCITDWTKENPECPLCR 315
           PC H+F  +C+ +W     +CP+CR
Sbjct: 727 PCSHIFHTECLENWMSYKLQCPVCR 751

>KLLA0D02552g complement(215290..217149) similar to sgd|S0004419
           Saccharomyces cerevisiae YLR427w, start by similarity
          Length = 619

 Score = 34.7 bits (78), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 25/62 (40%), Gaps = 20/62 (32%)

Query: 273 ESRNCILCLME-MTDPSCLPCGHVFCWDCITDWTKENP-------------------ECP 312
           + + C +CL E +  P  + CGHVFC  C+      +P                   ECP
Sbjct: 172 KGQTCPICLSEDLISPRMVVCGHVFCQTCLLQLFTNDPMVGKNDESTYARMKRKDLRECP 231

Query: 313 LC 314
           LC
Sbjct: 232 LC 233

>CAGL0J03102g 294126..295988 similar to sp|P34909 Saccharomyces
           cerevisiae YER068w MOT2 transcriptional repressor, start
           by similarity
          Length = 620

 Score = 34.7 bits (78), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 35/76 (46%), Gaps = 9/76 (11%)

Query: 250 VPENFNIDHIKLSNGKELAFIPTESRNCILCL--MEMTDPSCLPC--GHVFCWDCITDWT 305
           V EN       LSN         E   C LC+  M++TD +  PC  G+  C  C  +  
Sbjct: 6   VQENLQAIQNTLSNYDTSFLSEDEEDYCPLCIEPMDITDKNFFPCPCGYQICQFCYNNI- 64

Query: 306 KENPE----CPLCRQR 317
           ++NPE    CP CR++
Sbjct: 65  RQNPELNGRCPACRRK 80

>Kwal_47.17099
          Length = 605

 Score = 34.7 bits (78), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 37/88 (42%), Gaps = 27/88 (30%)

Query: 245 GLLTDVPENFNIDHIKLSNGKELAFIPTESRNCILCL-MEMTDPSCLPCGHVFCWDCITD 303
           GL  +VP    I H K+     +    ++ ++C +CL  E+  P  + CGH+FC  C+  
Sbjct: 143 GLDPNVP----IPHEKI-----VRVTASKGQSCPICLSQEIIAPRMVSCGHLFCQTCLLS 193

Query: 304 W-----------------TKENPECPLC 314
           +                  K   ECPLC
Sbjct: 194 FFAAGAQEQDKGAGINYKKKRYMECPLC 221

>Kwal_23.4139
          Length = 668

 Score = 34.7 bits (78), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 26/61 (42%), Gaps = 7/61 (11%)

Query: 261 LSNGKELAFIPTESRN------CILCLMEMTDPSCLPCGHVFCWDCITD-WTKENPECPL 313
           +SNG +   I  E  N      C LC     + +   CGHVFC +C  +       +CP 
Sbjct: 594 VSNGGDNGVIAEELDNFRTIVYCSLCSKNWKNTAIKNCGHVFCEECCKERLAARMRKCPT 653

Query: 314 C 314
           C
Sbjct: 654 C 654

>CAGL0H10274g complement(1003801..1004145) similar to sp|P38239
           Saccharomyces cerevisiae YBR062c, hypothetical start
          Length = 114

 Score = 32.7 bits (73), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 17/24 (70%)

Query: 292 CGHVFCWDCITDWTKENPECPLCR 315
           CGH F ++C++ W  +N  CP+CR
Sbjct: 64  CGHKFDFECVSMWLTKNTTCPMCR 87

>CAGL0D00638g complement(80947..83028) similar to tr|Q07457
           Saccharomyces cerevisiae YDL074c BRE1, hypothetical
           start
          Length = 693

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 1/41 (2%)

Query: 277 CILCLMEMTDPSCLPCGHVFCWDCITD-WTKENPECPLCRQ 316
           C LC     + +   CGHVFC DC  +       +CP C +
Sbjct: 641 CSLCSKNWKNMAIRTCGHVFCEDCCKERLAARMRKCPTCNK 681

>ADL064W [1677] [Homologous to ScYER068W (MOT2) - SH]
           complement(567690..569630) [1941 bp, 646 aa]
          Length = 646

 Score = 34.3 bits (77), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 37/73 (50%), Gaps = 11/73 (15%)

Query: 255 NIDHIK--LSNGKELAFIPTESRNCILCL--MEMTDPS--CLPCGHVFCWDCITDWTKEN 308
           N+ HI+  LSN         E   C LC+  +++TD +    PCG+  C  C  +  ++N
Sbjct: 9   NLQHIQAVLSNYDTSFLSDDEEDYCPLCMEPLDITDKNFKPCPCGYQICQFCYNN-IRQN 67

Query: 309 PE----CPLCRQR 317
           PE    CP CR++
Sbjct: 68  PELNGRCPACRRK 80

>Kwal_26.8090
          Length = 520

 Score = 34.3 bits (77), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 6/48 (12%)

Query: 272 TESRNCILCL----MEMTDPSCLPCGHVFCWDCITDWTKENPECPLCR 315
           TE   C +CL     E+T  + +PC H F   C+  W   +  CP+CR
Sbjct: 222 TELPTCPVCLERLDSEVTGLATIPCQHTFHCVCLNKWG--DNRCPVCR 267

>KLLA0E07007g 641391..642230 some similarities with sp|P40072
           Saccharomyces cerevisiae YER116c subunit of HEX3P-SLX8P
           complex, required for cell growth in the absence of SGS1
           or TOP3 singleton, hypothetical start
          Length = 279

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 29/66 (43%), Gaps = 12/66 (18%)

Query: 263 NGKELAFIPTESRN-----CILCLMEMTDPSCLPCGHVFCWDCITDWT-------KENPE 310
           +GK+++  P E++      C +C+          CGHVFC  C+           + N  
Sbjct: 193 SGKDMSETPLETKKAADYVCPICMEPPEAALVTKCGHVFCTTCLYGMVNSSKGNGRRNGL 252

Query: 311 CPLCRQ 316
           C LCR+
Sbjct: 253 CALCRE 258

>Sklu_2353.4 YER068W, Contig c2353 8340-10190
          Length = 616

 Score = 33.5 bits (75), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 9/49 (18%)

Query: 277 CILCL--MEMTDPS--CLPCGHVFCWDCITDWTKENPE----CPLCRQR 317
           C LC+  M++TD +    PCG+  C  C  +  ++NPE    CP CR++
Sbjct: 29  CPLCIEPMDITDKNFKPCPCGYQICQFCYNNI-RQNPELNGRCPACRRK 76

>CAGL0I09988g complement(951368..952531) similar to tr|Q12161
           Saccharomyces cerevisiae YOL054w, start by similarity
          Length = 387

 Score = 33.1 bits (74), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 19/44 (43%), Gaps = 5/44 (11%)

Query: 277 CILCLMEMTDPSCLPCGHVFCWDCITDWTKENP-----ECPLCR 315
           C +C   M  P    CGH +C+ C+  W   +       CP CR
Sbjct: 30  CSICHDYMFVPMTTECGHSYCYTCLKTWFSSDTNRGGLSCPECR 73

>AER113W [2618] [Homologous to ScYLR427W - SH]
           complement(848584..850581) [1998 bp, 665 aa]
          Length = 665

 Score = 33.5 bits (75), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 23/56 (41%), Gaps = 18/56 (32%)

Query: 277 CILCLME-MTDPSCLPCGHVFCWDCITD----------------WTKENP-ECPLC 314
           C +CL E +  P   PCGH+ C  C+                  + +  P ECPLC
Sbjct: 229 CPICLAEEVVAPRMAPCGHILCMTCMLQFFAAETGREVARAPGAYVRRPPKECPLC 284

>CAGL0L01947g 225999..228272 similar to sp|P36096 Saccharomyces
           cerevisiae YKL034w, start by similarity
          Length = 757

 Score = 33.5 bits (75), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 14/25 (56%)

Query: 291 PCGHVFCWDCITDWTKENPECPLCR 315
           PC H+F   C+  W     +CP+CR
Sbjct: 727 PCDHMFHTSCLESWMSYKLQCPVCR 751

>Kwal_14.1868
          Length = 1357

 Score = 33.5 bits (75), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 11/60 (18%)

Query: 252  ENFNIDHIKLSN--------GKELAFIPTESRNCILCLMEMTDPSCL---PCGHVFCWDC 300
            +NF+ D ++L +        GKE      ES  C  C+ +M   S +   PCGH+ C  C
Sbjct: 1030 KNFHTDWLRLFDVARRMPGAGKEAVADGLESMTCPQCMEQMELESTMVITPCGHMLCEGC 1089

>Kwal_27.10546
          Length = 104

 Score = 31.2 bits (69), Expect = 0.28,   Method: Composition-based stats.
 Identities = 10/24 (41%), Positives = 14/24 (58%)

Query: 292 CGHVFCWDCITDWTKENPECPLCR 315
           C H F  +C+  W  ++  CPLCR
Sbjct: 56  CNHRFDLECVAVWLSKSRTCPLCR 79

>KLLA0B08679g 767808..768899 weakly similar to sgd|S0005415
           Saccharomyces cerevisiae YOL054w, start by similarity
          Length = 363

 Score = 33.1 bits (74), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 37/76 (48%), Gaps = 12/76 (15%)

Query: 246 LLTDVPENFNIDHIKLSNGKELAFIPTESRNCILCLMEMTDPSCLPCGHVFCWDCITDWT 305
           L T +P+  N DH+++  G+ L     +S  C +C   M  P    CGH +C++C+ +W 
Sbjct: 5   LHTVIPKKSNADHLRIV-GRVL-----DSTVCTICHDYMFVPVMTSCGHNYCYECLNNWL 58

Query: 306 KENPE------CPLCR 315
             N        CP CR
Sbjct: 59  NNNRSNVSELTCPQCR 74

>AFR275W [3467] [Homologous to ScYKL034W (TUL1) - NSH]
           complement(928488..930749) [2262 bp, 753 aa]
          Length = 753

 Score = 33.1 bits (74), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 23/55 (41%), Gaps = 15/55 (27%)

Query: 276 NCILCLMEMT---------------DPSCLPCGHVFCWDCITDWTKENPECPLCR 315
           +C +C+ E+                D    PC H+F   C+ +W     +CP+CR
Sbjct: 693 SCAICMSELAIHVEDIPETHKANIHDYMVTPCSHLFHTGCLENWMSYKLQCPVCR 747

>Kwal_23.3660
          Length = 768

 Score = 33.1 bits (74), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 6/44 (13%)

Query: 277 CILCLMEMTDPSCLPCGHVFCWDCITDWTK---ENPE---CPLC 314
           C LC  E  +P    C H FC  CI ++T+   EN E   CP+C
Sbjct: 515 CQLCDDEAEEPIESKCHHRFCRLCIKEYTESFLENLEKLTCPVC 558

>YPR093C (YPR093C) [5516] chr16 complement(719554..720420) Protein
           containing a C3HC4 type (RING) zinc finger, which may
           mediate protein-protein interactions [867 bp, 288 aa]
          Length = 288

 Score = 32.3 bits (72), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 6/48 (12%)

Query: 277 CILCLMEMTDP---SCLP-CGHVFCWDCITDWTKE--NPECPLCRQRS 318
           C +CL +  +     CL  CGH F  +CI +W K   N +CP+CR  S
Sbjct: 4   CPICLADDQEGEQFGCLNVCGHKFHLNCIREWHKYSINLKCPICRVES 51

>Scas_551.3
          Length = 712

 Score = 32.7 bits (73), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 18/39 (46%), Gaps = 1/39 (2%)

Query: 277 CILCLMEMTDPSCLPCGHVFCWDCITD-WTKENPECPLC 314
           C LC     + +   CGHVFC +C  +       +CP C
Sbjct: 660 CSLCSKNWKNMAIKTCGHVFCEECCKERLAARMRKCPTC 698

>ABR067C [658] [Homologous to ScYMR026C (PEX12) - SH]
           (514945..516006) [1062 bp, 353 aa]
          Length = 353

 Score = 32.3 bits (72), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 11/43 (25%), Positives = 24/43 (55%)

Query: 271 PTESRNCILCLMEMTDPSCLPCGHVFCWDCITDWTKENPECPL 313
           P  S  C +C   +++P  L  G++ C+ C   + +++ +CP+
Sbjct: 294 PYISVRCPVCRSAVSNPGVLQTGYIACYPCAVRYVEKHGKCPV 336

>CAGL0A00935g complement(97372..98052) some similarities with
           sp|P53769 Saccharomyces cerevisiae YLR323c, hypothetical
           start
          Length = 226

 Score = 32.0 bits (71), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 27/62 (43%), Gaps = 5/62 (8%)

Query: 253 NFNIDHIKLSNGKELAFIPTESRNCILCLMEMTDPSCLPCGHVFCWDCITDWTKENPECP 312
           ++ ID  K    KE   +P +   C+LC      P    CGH FC  C  +  K +  C 
Sbjct: 146 DWKIDEQKEETRKEA--VPFK---CVLCKESYERPVKTNCGHYFCQKCFVNRIKIDKSCF 200

Query: 313 LC 314
           +C
Sbjct: 201 IC 202

>AGR034W [4344] [Homologous to ScYBR062C - SH]
           complement(772772..773251) [480 bp, 159 aa]
          Length = 159

 Score = 31.6 bits (70), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 46/112 (41%), Gaps = 25/112 (22%)

Query: 210 IINKVLSILPQTKETLNAGSNGVGLKEGFAPAATPGLLTDVPENFNIDHIKLSNGKELAF 269
           ++N ++ ++P   E L      +G  +G  P      L  VP+            K LA 
Sbjct: 42  LLNVIVRLMP---EELQQHLQLIGEGDGGVPDGYMDTLPRVPK------------KRLA- 85

Query: 270 IPTESRNCILCL---MEMTDPSC--LP-CGHVFCWDCITDWTKENPECPLCR 315
              E  NC +C    +E   P    LP CGH F   C++ W   +  CP+CR
Sbjct: 86  ---EGDNCAICCCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRSTTCPMCR 134

>YDL074C (BRE1) [794] chr4 complement(324047..326149) Ubiquitin
           ligase (E3), may be required for Rad6p function in
           chromatin modification, plays a role in gene silencing
           [2103 bp, 700 aa]
          Length = 700

 Score = 32.3 bits (72), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 18/39 (46%), Gaps = 1/39 (2%)

Query: 277 CILCLMEMTDPSCLPCGHVFCWDCITD-WTKENPECPLC 314
           C LC     + +   CGHVFC +C  +       +CP C
Sbjct: 648 CSLCSKNWKNMAIKTCGHVFCENCCKERLAARMRKCPTC 686

>KLLA0B02981g complement(267798..269789) similar to sgd|S0002232
           Saccharomyces cerevisiae YDL074c BRE1, start by
           similarity
          Length = 663

 Score = 32.3 bits (72), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 25/61 (40%), Gaps = 7/61 (11%)

Query: 261 LSNGKELAFIPTESRN------CILCLMEMTDPSCLPCGHVFCWDCITD-WTKENPECPL 313
           LSNG +   +  E  N      C LC     + +   CGHVFC  C  +       +CP 
Sbjct: 589 LSNGGDNGALAEELENFRTIIYCSLCSKNWKNTALKTCGHVFCDVCCKERLAARMRKCPT 648

Query: 314 C 314
           C
Sbjct: 649 C 649

>Kwal_26.8247
          Length = 386

 Score = 32.3 bits (72), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 12/42 (28%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 273 ESRNCILCLMEMTDPSCLPCGHVFCWDCITDWTKENP-ECPL 313
           E   C +C   + +P+ +  G+VFC+ CI ++  ++   CP+
Sbjct: 318 EDGTCRICKGPIQNPAAIGTGYVFCYPCILEYLPQHEGRCPV 359

>KLLA0F25740g complement(2389226..2390779) similar to sp|P38748
           Saccharomyces cerevisiae YHL010c singleton, start by
           similarity
          Length = 517

 Score = 32.3 bits (72), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 6/43 (13%)

Query: 277 CILCL----MEMTDPSCLPCGHVFCWDCITDWTKENPECPLCR 315
           C +CL     E+T     PC H F   C+  W  +N  CP+CR
Sbjct: 215 CPVCLEKLDSEVTGLVTTPCQHTFHCKCLDQW--KNGNCPVCR 255

>KLLA0F18458g complement(1697871..1698293) some similarities with
           sp|P38239 Saccharomyces cerevisiae YBR062c singleton,
           hypothetical start
          Length = 140

 Score = 30.8 bits (68), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 10/24 (41%), Positives = 15/24 (62%)

Query: 292 CGHVFCWDCITDWTKENPECPLCR 315
           C H F  +C++ W + N  CP+CR
Sbjct: 92  CNHKFDLECLSIWLQNNHTCPMCR 115

>Scas_697.32
          Length = 521

 Score = 32.0 bits (71), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 6/53 (11%)

Query: 271 PTESRNCILCLMEMTDPSCL---PCGHVFCWDCITDW-TKENP--ECPLCRQR 317
           P  + NC LCL ++T+   +   PC H + + C+ D  T E P   CP C+ +
Sbjct: 339 PNATDNCSLCLSKITEGKPIFISPCSHHWHYKCVKDLITVEYPFFFCPTCKNQ 391

>Kwal_23.5859
          Length = 619

 Score = 32.0 bits (71), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 9/49 (18%)

Query: 277 CILCL--MEMTDPS--CLPCGHVFCWDCITDWTKENPE----CPLCRQR 317
           C LC+  +++TD +    PCG+  C  C  +  ++NPE    CP CR++
Sbjct: 33  CPLCIETLDITDKNFKPCPCGYQICQFCYNNI-RQNPELNGRCPACRRK 80

>Kwal_27.10723
          Length = 229

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 19/46 (41%), Gaps = 6/46 (13%)

Query: 277 CILCLMEMTDPSCLPCGHVFCWDCI------TDWTKENPECPLCRQ 316
           C +C          PCGHVFC +C+      +        C LCR+
Sbjct: 164 CPICFEPPEAALVTPCGHVFCTECLFQMVNSSRGQSRAGHCALCRR 209

>AAR147W [335] [Homologous to ScYOR191W (RIS1) - SH]
            complement(608865..613607) [4743 bp, 1580 aa]
          Length = 1580

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 3/43 (6%)

Query: 277  CILCL--MEMTDPSCL-PCGHVFCWDCITDWTKENPECPLCRQ 316
            C  C+  ME+   S L PCGH+ C  C+  + ++  E    R+
Sbjct: 1285 CPFCMEQMEIESLSVLTPCGHLLCDACVEPYLEDARESEYARK 1327

>CAGL0G03553g complement(345057..345689) weakly similar to sp|P40072
           Saccharomyces cerevisiae YER116c YEU6, hypothetical
           start
          Length = 210

 Score = 30.0 bits (66), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 18/32 (56%), Gaps = 6/32 (18%)

Query: 291 PCGHVFCWDCI------TDWTKENPECPLCRQ 316
           PCGHVFC +C+      +   ++   C LCR+
Sbjct: 160 PCGHVFCCECLFQMVNNSRTPRKGGVCALCRK 191

>KLLA0F17479g complement(1601287..1604631) similar to sp|P32849
           Saccharomyces cerevisiae YLR032w RAD5 DNA helicase,
           start by similarity
          Length = 1114

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 22/52 (42%), Gaps = 10/52 (19%)

Query: 274 SRNCILCLMEMTDP----SCLPCGHVFCWDCITDW------TKENPECPLCR 315
           S  C +C  E  +P    S   C H FC  C+ ++       K +  CP CR
Sbjct: 855 SFECAICTTECIEPLSAVSITECLHTFCEPCLAEYIEFQQNKKLSINCPYCR 906

>CAGL0K07766g 770935..773427 highly similar to sp|P31244
           Saccharomyces cerevisiae YBR114w RAD16 DNA repair
           protein, start by similarity
          Length = 830

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 7/45 (15%)

Query: 277 CILCLMEMTDPSCLPCGHVFCWDCITDWTK-------ENPECPLC 314
           C LC  E  +P    C H FC  CI ++ +        N  CP+C
Sbjct: 576 CQLCNDEAEEPIESKCHHKFCRLCIREYVESYIESSGSNLTCPVC 620

>CAGL0D05368g complement(513884..514225) similar to sp|P32570
           Saccharomyces cerevisiae YBR253w SRB6 DNA-directed RNA
           polymerase II suppressor protein, start by similarity
          Length = 113

 Score = 28.9 bits (63), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 38/64 (59%), Gaps = 3/64 (4%)

Query: 83  LIYVNKRGSQLVRGIKRVLFVLSYTSIPYLVTKLSKKVNNR---STNNEESDDGNESTYT 139
           L+ VN +  QLVRG++ ++ +       +L+T++ +++  +   S N+EE  +  ES  +
Sbjct: 48  LMMVNNQTLQLVRGVQDLILLTRNIREKWLLTQIPEQLTPKEQDSINHEELTELLESCVS 107

Query: 140 DILS 143
           +I+S
Sbjct: 108 EIIS 111

>Kwal_55.21206
          Length = 275

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 5/47 (10%)

Query: 277 CILC---LMEMTDPSCLPCGHVFCWDCITDWTKENPE-CPLCRQRSY 319
           C +C     ++ +   L C HVF   CI  W   N   CPLC+ RSY
Sbjct: 120 CAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCK-RSY 165

>Scas_721.100
          Length = 1137

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 33/74 (44%), Gaps = 18/74 (24%)

Query: 256 IDHIKLSNGKELAFIPTESRNCILCLMEMTDPSCL------PCGHVFCWDCITDWTK--- 306
           ID I      ++ F   E   C +C    TDP  L       CGH FC  CI ++ +   
Sbjct: 866 IDRIMKKYNPQIDFPALE---CSIC---TTDPIPLDKIVFTECGHPFCESCIEEYFEFQA 919

Query: 307 -ENPE--CPLCRQR 317
            +N E  CP CR++
Sbjct: 920 GKNLELKCPNCREQ 933

>ABR104W [696] [Homologous to ScYPR093C - SH]
           complement(574067..575053) [987 bp, 328 aa]
          Length = 328

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 3/29 (10%)

Query: 290 LPCGHVFCWDCITDW---TKENPECPLCR 315
           +PCGH +   CI  W      N  CP+CR
Sbjct: 33  MPCGHEYHLACIRKWFHLHSGNRSCPVCR 61

>AFR104W [3296] [Homologous to ScYKR017C - SH]
           complement(623416..625047) [1632 bp, 543 aa]
          Length = 543

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 14/26 (53%), Gaps = 3/26 (11%)

Query: 289 CLPCGHVFCWDCITDW---TKENPEC 311
           C  C H FCW C  DW   TK+  EC
Sbjct: 350 CGTCHHEFCWICEADWRLHTKDYFEC 375

>YBR114W (RAD16) [303] chr2 (467204..469576) Nucleotide excision
           repair protein involved in G2 repair of inactive genes,
           component of the nucleotide excision repair factor four
           (NEF4, Rad7p-Rad16p) ATP-dependent damage recognition
           complex, has DNA helicase domain of Snf2p family [2373
           bp, 790 aa]
          Length = 790

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 6/44 (13%)

Query: 277 CILCLMEMTDPSCLPCGHVFCWDCITDWTKENPE------CPLC 314
           C LC  E  +P    C H FC  CI ++ +   E      CP+C
Sbjct: 537 CQLCNDEAEEPIESKCHHKFCRLCIKEYVESFMENNNKLTCPVC 580

>Kwal_26.8030
          Length = 660

 Score = 29.6 bits (65), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 15/25 (60%)

Query: 291 PCGHVFCWDCITDWTKENPECPLCR 315
           PCGH     C  ++TK + +CP C+
Sbjct: 405 PCGHAIHQHCFDEYTKHSYKCPSCQ 429

>AGL289C [4023] [Homologous to ScYER116C (SLX8) - SH]
           (164204..164929) [726 bp, 241 aa]
          Length = 241

 Score = 29.3 bits (64), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 21/46 (45%), Gaps = 6/46 (13%)

Query: 277 CILCLMEMTDPSCLPCGHVFCWDCI------TDWTKENPECPLCRQ 316
           C +C          PCGH++C  C+      +   + N +C LCR+
Sbjct: 173 CPICFDPPEAALMTPCGHIYCTVCLFQMVNSSRGYRRNGQCALCRK 218

>Sklu_2412.7 YLR032W, Contig c2412 15481-18864
          Length = 1127

 Score = 30.0 bits (66), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 25/57 (43%), Gaps = 10/57 (17%)

Query: 277 CILCLMEMTDPSC----LPCGHVFCWDCITDW------TKENPECPLCRQRSYPQQV 323
           C +C  E  +P        C H FC  C+ ++       K   +CP CR+   P+++
Sbjct: 874 CSICTSEPIEPITQVIFTECAHAFCEHCLLEYIDFQTQKKLELKCPNCRESIDPKRL 930

>CAGL0I10098g complement(958948..963804) some similarities with
            sp|P08640 Saccharomyces cerevisiae YIR019c STA1,
            hypothetical start
          Length = 1618

 Score = 29.6 bits (65), Expect = 4.0,   Method: Composition-based stats.
 Identities = 16/32 (50%), Positives = 17/32 (53%), Gaps = 5/32 (15%)

Query: 219  PQTKETLNAGSNGVGL-----KEGFAPAATPG 245
            PQTK T NAGSNG          G +PAA  G
Sbjct: 1457 PQTKPTANAGSNGASPAANAGSNGASPAANAG 1488

>YOL138C (YOL138C) [4686] chr15 complement(61324..65349) Possible
            component of a glycogen synthase kinase, homozygous
            diploid null mutant accumulates glycogen [4026 bp, 1341
            aa]
          Length = 1341

 Score = 29.6 bits (65), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 4/40 (10%)

Query: 277  CILCLMEMTDPS--CLPCGHVFCWDCITDW--TKENPECP 312
            C+LC   +   +   LPCGH   + CI +W   +   ECP
Sbjct: 1293 CVLCERPLKKLTMVILPCGHEGHFQCIQEWFLDENEQECP 1332

>Scas_675.30
          Length = 542

 Score = 29.3 bits (64), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 15/25 (60%), Gaps = 1/25 (4%)

Query: 277 CILCLMEM-TDPSCLPCGHVFCWDC 300
           CI+C  E  TD   L CGH +C DC
Sbjct: 169 CIICCEEKNTDTFSLECGHEYCLDC 193

>YDR128W (YDR128W) [975] chr4 (709543..712989) Protein containing five
            WD domains (WD-40 repeat), which may mediate
            protein-protein interactions, has a region of low
            similarity to a region of S. cerevisiae Sec27p, which a
            coatomer (COPI) complex beta' chain (beta'-COP) of
            secretory pathway vesicles [3447 bp, 1148 aa]
          Length = 1148

 Score = 29.3 bits (64), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 19/41 (46%), Gaps = 2/41 (4%)

Query: 274  SRNCILCLMEMTDPS--CLPCGHVFCWDCITDWTKENPECP 312
            +RNC  C + +T  S  C  C HV    C   W +   ECP
Sbjct: 1095 ARNCNYCDLRVTRSSFICGNCQHVLHSSCARIWWEIGDECP 1135

>Scas_560.6*
          Length = 118

 Score = 27.7 bits (60), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 15/24 (62%)

Query: 292 CGHVFCWDCITDWTKENPECPLCR 315
           C H F  +CI+ W  ++  CPLCR
Sbjct: 70  CNHRFDLECISVWLSKSVTCPLCR 93

>KLLA0C08041g complement(705516..707240) gi|24741192|emb|CAD56154.1
           Kluyveromyces lactis CCr4/NOT complex/transcription
           factor subunit, start by similarity
          Length = 574

 Score = 28.9 bits (63), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 11/50 (22%)

Query: 277 CILCL-----MEMTDPSCLPCGHVFCWDCITDWTKENPE----CPLCRQR 317
           C LC+     M+     C PCG+  C  C  +  ++NPE    CP CR++
Sbjct: 38  CPLCIEPLDVMDKHFKPC-PCGYQICQFCYNNI-RQNPELNGRCPACRRK 85

>KLLA0E07568g 685564..686559 weakly similar to sp|Q04370
           Saccharomyces cerevisiae YMR026c PEX12 required for
           biogenesis of peroxisomes - peroxin singleton, start by
           similarity
          Length = 331

 Score = 28.5 bits (62), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 11/35 (31%), Positives = 17/35 (48%)

Query: 277 CILCLMEMTDPSCLPCGHVFCWDCITDWTKENPEC 311
           C LC  E+T+P+ +  G+V   +C   W      C
Sbjct: 281 CPLCGEEITEPAMISSGYVANLECAKKWVSTENTC 315

>AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH]
           complement(830240..833497) [3258 bp, 1085 aa]
          Length = 1085

 Score = 28.5 bits (62), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 34/87 (39%), Gaps = 18/87 (20%)

Query: 239 APAATPGLLTDVPENFNIDHIKLSNGKELAFIPTESRNCILCLMEMTDPSC----LPCGH 294
           +P ++   + D  E+F   +      K+L         C +C  E   P        CGH
Sbjct: 802 SPGSSSEGMPDFIEDFKTKYPNSDALKDL--------ECSICTCEAISPLTSVVFTRCGH 853

Query: 295 VFCWDCITDW----TKENPE--CPLCR 315
            FC  C+ ++     K+  E  CP CR
Sbjct: 854 PFCESCLLEYIQFQNKKGSETICPNCR 880

>YML068W (ITT1) [3901] chr13 (137550..138944) Involved in
           translation termination, has TRIAD composite zinc finger
           domain [1395 bp, 464 aa]
          Length = 464

 Score = 28.5 bits (62), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 13/23 (56%)

Query: 289 CLPCGHVFCWDCITDWTKENPEC 311
           C  C  VFC+DC+  W   N +C
Sbjct: 316 CQKCHFVFCFDCLHAWHGYNNKC 338

>YBR062C (YBR062C) [253] chr2 complement(365936..366283) Protein
           containing a C3HC4 type (RING) zinc finger, which may
           mediate protein-protein interactions, has moderate
           similarity to uncharacterized C. albicans Orf6.8878p
           [348 bp, 115 aa]
          Length = 115

 Score = 27.3 bits (59), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 14/25 (56%)

Query: 292 CGHVFCWDCITDWTKENPECPLCRQ 316
           C H F  +C++ W   +  CPLCR 
Sbjct: 65  CHHKFDLECLSVWLSRSTTCPLCRD 89

>Kwal_47.17638
          Length = 248

 Score = 28.1 bits (61), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 10/38 (26%), Positives = 17/38 (44%)

Query: 277 CILCLMEMTDPSCLPCGHVFCWDCITDWTKENPECPLC 314
           C++C  +   P    C H FC  C     ++  +C +C
Sbjct: 188 CLICKGDYKKPVVTKCQHYFCSSCFLAKARKTTKCVVC 225

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.136    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,782,401
Number of extensions: 463045
Number of successful extensions: 1813
Number of sequences better than 10.0: 142
Number of HSP's gapped: 1797
Number of HSP's successfully gapped: 142
Length of query: 323
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 221
Effective length of database: 13,065,073
Effective search space: 2887381133
Effective search space used: 2887381133
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)