Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M08668g65762231820.0
YDR266C63962214930.0
Scas_615.1267461114910.0
Scas_699.3861259813211e-175
Sklu_1676.265063412441e-163
AER391C63256711771e-153
Kwal_55.2000061762311081e-143
KLLA0E16698g65657510221e-130
Scas_672.226380780.18
ABR104W32863770.28
Scas_615.1333081760.34
KLLA0C09504g34757750.48
KLLA0E16720g30546701.7
CAGL0J03586g41132701.9
AGL289C24145692.1
KLLA0D00418g24472692.4
Scas_720.8946951692.8
KLLA0C08756g42740693.0
AFR499C25068673.4
AGR233W28471673.7
Kwal_27.970551532683.7
YCR066W (RAD18)48729666.4
Kwal_55.1999915245637.0
KLLA0D10758g85046659.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M08668g
         (647 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M08668g 862981..864954 similar to tr|Q05580 Saccharomyces c...  1230   0.0  
YDR266C (YDR266C) [1099] chr4 complement(1000096..1002015) Prote...   579   0.0  
Scas_615.12                                                           578   0.0  
Scas_699.38                                                           513   e-175
Sklu_1676.2 YDR266C, Contig c1676 743-2695                            483   e-163
AER391C [2891] [Homologous to ScYDR266C - SH] (1371409..1373307)...   457   e-153
Kwal_55.20000                                                         431   e-143
KLLA0E16698g 1479322..1481292 weakly similar to sgd|S0002674 Sac...   398   e-130
Scas_672.2                                                             35   0.18 
ABR104W [696] [Homologous to ScYPR093C - SH] complement(574067.....    34   0.28 
Scas_615.13                                                            34   0.34 
KLLA0C09504g complement(826607..827650) highly similar to sgd|S0...    33   0.48 
KLLA0E16720g complement(1481372..1482289) similar to sp|Q05568 S...    32   1.7  
CAGL0J03586g complement(341290..342525) similar to sp|P10862 Sac...    32   1.9  
AGL289C [4023] [Homologous to ScYER116C (SLX8) - SH] (164204..16...    31   2.1  
KLLA0D00418g 38504..39238 weakly similar to sp|P32800 Saccharomy...    31   2.4  
Scas_720.89                                                            31   2.8  
KLLA0C08756g complement(765847..767130) weakly similar to sp|P10...    31   3.0  
AFR499C [3691] [Homologous to ScYLR323C (CWC24) - SH] (1339549.....    30   3.4  
AGR233W [4544] [Homologous to ScYGL221C (NIF3) - SH] complement(...    30   3.7  
Kwal_27.9705                                                           31   3.7  
YCR066W (RAD18) [592] chr3 (231495..232958) Multifunctional DNA ...    30   6.4  
Kwal_55.19999                                                          29   7.0  
KLLA0D10758g 917125..919677 similar to sp|P47156 Saccharomyces c...    30   9.9  

>CAGL0M08668g 862981..864954 similar to tr|Q05580 Saccharomyces
           cerevisiae YDR266c, start by similarity
          Length = 657

 Score = 1230 bits (3182), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 590/622 (94%), Positives = 590/622 (94%)

Query: 1   MSSEQQQNGSKPKNRNFRRTQTXXXXXXXXXXXXKAKKITGNPDFLQKEIKSGKKSNIEK 60
           MSSEQQQNGSKPKNRNFRRTQT            KAKKITGNPDFLQKEIKSGKKSNIEK
Sbjct: 1   MSSEQQQNGSKPKNRNFRRTQTGGRSNGESGNGRKAKKITGNPDFLQKEIKSGKKSNIEK 60

Query: 61  KVEEFNAREEDDDTELCIICARVLVYASLSPCNHTTCHVCSFRQRALYEKKSCLICRTEN 120
           KVEEFNAREEDDDTELCIICARVLVYASLSPCNHTTCHVCSFRQRALYEKKSCLICRTEN
Sbjct: 61  KVEEFNAREEDDDTELCIICARVLVYASLSPCNHTTCHVCSFRQRALYEKKSCLICRTEN 120

Query: 121 DRLTFTDNIDAQYSEITDFSGSDDKFGIDFTSDEVKNATLDLLKYACPLCPDNEQHVSTT 180
           DRLTFTDNIDAQYSEITDFSGSDDKFGIDFTSDEVKNATLDLLKYACPLCPDNEQHVSTT
Sbjct: 121 DRLTFTDNIDAQYSEITDFSGSDDKFGIDFTSDEVKNATLDLLKYACPLCPDNEQHVSTT 180

Query: 181 YKKYNEHLKSAHNRMICLICAGNKHSFPREMKIYTANQLKNHHSRGDSEGFKGHPMCAFC 240
           YKKYNEHLKSAHNRMICLICAGNKHSFPREMKIYTANQLKNHHSRGDSEGFKGHPMCAFC
Sbjct: 181 YKKYNEHLKSAHNRMICLICAGNKHSFPREMKIYTANQLKNHHSRGDSEGFKGHPMCAFC 240

Query: 241 TGKRFYSDDELYIHMRNDHEKCHICDRIDHTQPQYFKDYEQLFEHFRTSHYVCTVQSCLD 300
           TGKRFYSDDELYIHMRNDHEKCHICDRIDHTQPQYFKDYEQLFEHFRTSHYVCTVQSCLD
Sbjct: 241 TGKRFYSDDELYIHMRNDHEKCHICDRIDHTQPQYFKDYEQLFEHFRTSHYVCTVQSCLD 300

Query: 301 DKFVVFKDDMELQAHILKEHGDILRGKPKFFQSELSTFISAPSQVIRERDSYNYDMGSVG 360
           DKFVVFKDDMELQAHILKEHGDILRGKPKFFQSELSTFISAPSQVIRERDSYNYDMGSVG
Sbjct: 301 DKFVVFKDDMELQAHILKEHGDILRGKPKFFQSELSTFISAPSQVIRERDSYNYDMGSVG 360

Query: 361 SSNIEESSNPEVNRLRMNERAKHYLNSSLEGFQKFETLNENYDSSVLTASQLVQEYKKLF 420
           SSNIEESSNPEVNRLRMNERAKHYLNSSLEGFQKFETLNENYDSSVLTASQLVQEYKKLF
Sbjct: 361 SSNIEESSNPEVNRLRMNERAKHYLNSSLEGFQKFETLNENYDSSVLTASQLVQEYKKLF 420

Query: 421 TDTHADIYLLVHNLSALYPKNSKKFKDLDVIYQEYEQTEKRKNALPSLLDDHIQTVPGGA 480
           TDTHADIYLLVHNLSALYPKNSKKFKDLDVIYQEYEQTEKRKNALPSLLDDHIQTVPGGA
Sbjct: 421 TDTHADIYLLVHNLSALYPKNSKKFKDLDVIYQEYEQTEKRKNALPSLLDDHIQTVPGGA 480

Query: 481 WGXXXXXXXXXXXIKNLNQLPSLGGVSSSFDPFKNPNKAPVYKGLRQSPKPVVSATQRQT 540
           WG           IKNLNQLPSLGGVSSSFDPFKNPNKAPVYKGLRQSPKPVVSATQRQT
Sbjct: 481 WGSSTGRSKSHSSIKNLNQLPSLGGVSSSFDPFKNPNKAPVYKGLRQSPKPVVSATQRQT 540

Query: 541 PMRISARPTASNRVEFNGGSTTKAATPSWGSQPXXXXXXXXXLADLNLPTLPAPKPKVYI 600
           PMRISARPTASNRVEFNGGSTTKAATPSWGSQP         LADLNLPTLPAPKPKVYI
Sbjct: 541 PMRISARPTASNRVEFNGGSTTKAATPSWGSQPSSNSSSKNKLADLNLPTLPAPKPKVYI 600

Query: 601 PPVHEPVIPDPKKWGQKGEPAP 622
           PPVHEPVIPDPKKWGQKGEPAP
Sbjct: 601 PPVHEPVIPDPKKWGQKGEPAP 622

>YDR266C (YDR266C) [1099] chr4 complement(1000096..1002015) Protein
           of unknown function, contains a RING finger domain [1920
           bp, 639 aa]
          Length = 639

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/622 (50%), Positives = 412/622 (66%), Gaps = 49/622 (7%)

Query: 15  RNFRRTQTXXXXXXXXXXXXKAKKITGNPDFLQKEIKSGKKSNI--EKKVEEFNAREEDD 72
           RNFRRTQ               K      +F +K+    KK+N+  E  +   +A + D+
Sbjct: 13  RNFRRTQ---------GPQNNTKPHNDRKNFRRKQ----KKNNLSAEPNLTTSSADDTDE 59

Query: 73  DTELCIICARVLVYASLSPCNHTTCHVCSFRQRALYEKKSCLICRTENDRLTFTDNIDAQ 132
           + ELC+ICAR L Y SL+PC+H TCH+C FRQRALY KKSCLICRTEN+ + FTD ID  
Sbjct: 60  ENELCVICARKLTYVSLTPCHHKTCHICGFRQRALYNKKSCLICRTENEEVMFTDRIDGD 119

Query: 133 YSEITDFSGSDDKFGIDFTSDEVKNATLDLLKYACPLCPDNEQHVSTTYKKYNEHLKSAH 192
            S+  +F   ++K+GI+FTS+EV   TL+LLK+ CPL  D +     ++KKYNEHLKS H
Sbjct: 120 ISDKYNFCEKNEKYGINFTSEEVATETLNLLKFFCPLSKDEQVCDFGSFKKYNEHLKSEH 179

Query: 193 NRMICLICAGNKHSFPREMKIYTANQLKNHHSRGDSEGFKGHPMCAFCTGKRFYSDDELY 252
           NRMICLICA +KH+FP E++I+T NQL+NH ++G+SEGFKGHPMCAFC+GKRFYSDDELY
Sbjct: 180 NRMICLICATHKHAFPCELEIFTQNQLRNHQTKGNSEGFKGHPMCAFCSGKRFYSDDELY 239

Query: 253 IHMRNDHEKCHICDRIDHTQPQYFKDYEQLFEHFRTSHYVCTVQSCLDDKFVVFKDDMEL 312
           IHMRN HEKCHICD+++   PQYFKDY QLF+HF+ SHYVCTVQ+CLD+KFVVFKD++EL
Sbjct: 240 IHMRNQHEKCHICDKMNPASPQYFKDYNQLFDHFKHSHYVCTVQTCLDNKFVVFKDELEL 299

Query: 313 QAHILKEHGDILRGKPKFFQSELSTFISAPSQVIRERDSYNYDMGSVGS-------SNIE 365
           QAHIL+EHG+IL+GKPKFFQSELSTFISAPS+VIRERD Y+    S          +++ 
Sbjct: 300 QAHILQEHGNILKGKPKFFQSELSTFISAPSRVIRERDDYDLPSISSLPGSSSGSRTDVR 359

Query: 366 ESSNPEVNRLRMNERAKHYLNSSLEGFQKFETLNENYDSSVLTASQLVQEYKKLFTDTHA 425
            +S+PE +RLR+ ERAK+YL +S E F KF + NE+Y    L+A +L++ YK LFT  +A
Sbjct: 360 SASSPEESRLRLAERAKYYLENSKEDFNKFSSYNEDYSKGRLSAEKLLESYKLLFTKPNA 419

Query: 426 DIYLLVHNLSALYPKNSKKFKDLDVIYQEYEQTEKRKN--ALPSLLDDHIQTVPGGAWGX 483
           D+YLL+HNL+  +PKNS K+ +L+ IY++ EQT  R+      S       ++  G WG 
Sbjct: 420 DVYLLIHNLAETFPKNSSKYNNLNAIYEQREQTLARQTSLPSLSSDSSLSMSIGRGHWGG 479

Query: 484 XX--XXXXXXXXIKNLNQLPSLGGVSSSFDPFKNPNKAPVYKGLRQSPKPVVSATQRQTP 541
                       ++N+  LP+L   S+S+DPF    K       + + +PV +  +R TP
Sbjct: 480 TNDGGSAGAALGVRNIKNLPTLKSPSASYDPFATTVK-------KNTLRPVQN-IKRTTP 531

Query: 542 MRISARPTASNRVEFNGGSTTKAATPSW-----GSQPXXXXXXXXXLADLNLPTLPAPKP 596
             +S R T++N V F         +P++     GS           L  LNLP LP PKP
Sbjct: 532 QSVSYR-TSTNTVAF---------SPTYLESKKGSSSTSLNNSKDKLKSLNLPQLPPPKP 581

Query: 597 KVYIPPVHEPVIPDPKKWGQKG 618
           KV IP ++ P I DPK+WG+K 
Sbjct: 582 KVQIPGLNRPQIADPKQWGKKS 603

>Scas_615.12
          Length = 674

 Score =  578 bits (1491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/611 (48%), Positives = 388/611 (63%), Gaps = 61/611 (9%)

Query: 55  KSNIEKKVEEFNAREEDDDTE--------LCIICARVLVYASLSPCNHTTCHVCSFRQRA 106
           KS I K +EE      + D          LC+ICA  LVYASLSPCNHTTCH CSF+QR+
Sbjct: 42  KSRISKPIEEIARTTRNLDINSGDDDDDDLCLICASKLVYASLSPCNHTTCHKCSFKQRS 101

Query: 107 LYEKKSCLICRTENDRLTFTDNIDAQYSEIT-DFSGSDDKFGIDFTSDEVKNATLDLLKY 165
           LY KK+CLICRTEND+L FT+NI+A Y++        ++K+GI FTS+EV  ATL+LLKY
Sbjct: 102 LYNKKACLICRTENDKLIFTENINANYTDSNLGHYQFNEKYGIVFTSEEVATATLNLLKY 161

Query: 166 ACPLCPDNEQHVS----TTYKKYNEHLKSAHNRMICLICAGNKHSFPREMKIYTANQLKN 221
            C +CP N+  +      +YKKYNEHL+S HN+ +C ICA N H FP E+ +YT NQL+N
Sbjct: 162 TCSVCPANKDGIEREDFGSYKKYNEHLRSKHNKCLCTICAQNNHIFPSELPVYTQNQLRN 221

Query: 222 HHSRGDSEGFKGHPMCAFCTGKRFYSDDELYIHMRNDHEKCHICDRIDHTQPQYFKDYEQ 281
           H S+G+SEGFKGHP+CAFC+G+RFY DDELY+HMRN HEKCHICD+IDH  PQYFKDY+Q
Sbjct: 222 HQSKGNSEGFKGHPLCAFCSGQRFYGDDELYVHMRNKHEKCHICDKIDHNSPQYFKDYDQ 281

Query: 282 LFEHFRTSHYVCTVQSCLDDKFVVFKDDMELQAHILKEHGDILRGKPKFFQSELSTFISA 341
           LF+HF+  HY+CTVQ+CLD+KF+VFKD++ELQAHILKEHGD++RGKPK FQSELSTF+S 
Sbjct: 282 LFDHFKNFHYICTVQTCLDNKFIVFKDELELQAHILKEHGDLIRGKPKLFQSELSTFMSG 341

Query: 342 PSQVIRERDSYNYDM------------------GSVGSSNIEESSNPEVNRLRMNERAKH 383
           PS+V+R+RD+ NYDM                  G+ G+ +  ++  PE+ +LR+ ERAK+
Sbjct: 342 PSRVVRDRDAMNYDMDSRPSLFSSSPSSSATPLGTDGNDDNSDNDIPELRQLRLEERAKY 401

Query: 384 YLNSSLEGFQKFETLNENYDSSVLTASQLVQEYKKLFTDTHADIYLLVHNLSALYPKNSK 443
           YL +S E + KF   N+ YD   LT   L+  YK++FT   +++YLL++N++ LYPKNS 
Sbjct: 402 YLENSQELYDKFIKCNDEYDKGYLTGLGLLDSYKEIFTTPQSNVYLLINNVAKLYPKNSP 461

Query: 444 KFKDLDVIYQEYEQTEKRKNALP-SLLDDHIQTVPGGAWGXXXXXXXXXXXIKNLNQLPS 502
           KFK+L+ IY+  EQ    +N LP         +    +W             +N+  LP+
Sbjct: 462 KFKELNAIYEAQEQKLYLQNGLPSLSGSSASISSATRSWNNSGSVAMN----RNIRDLPT 517

Query: 503 LGGVSSSFDPFKNP-NKAPVYKGLRQ------SPKPVV----SATQRQTPMRISARPTAS 551
           L   S SFDPF     K P  + +++      SP P+       +   +   +   PT +
Sbjct: 518 LEAKSKSFDPFATTVKKTPALRTMKKTVVKKVSPSPIAYTPLGGSSLSSLSTVPRLPTTN 577

Query: 552 NRVEFNGGSTTKAATPSWGSQPXXXXXXXXXLADLNLPTLPAPKPKVYIPPVHEPVIPDP 611
                  GS+T                    LADLNLP LP PKPKVYIPP+ +  IPDP
Sbjct: 578 VSNTVRMGSSTNGKN--------------KKLADLNLPQLPTPKPKVYIPPLRKTTIPDP 623

Query: 612 KKWGQKGEPAP 622
           K+WG  G+  P
Sbjct: 624 KQWGGGGQNVP 634

>Scas_699.38
          Length = 612

 Score =  513 bits (1321), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 278/598 (46%), Positives = 370/598 (61%), Gaps = 84/598 (14%)

Query: 53  GKKSNIEKKVEEFNAREEDDDTELCIICARVLVYASLSPCNHTTCHVCSFRQRALYEKKS 112
            KK     + EE N    DDD  +C+ICA  + +A+ SPCNH TCH CSFRQ AL++KKS
Sbjct: 24  NKKKQHSHRHEEIN----DDDENVCVICANPIKFAAWSPCNHKTCHKCSFRQLALFDKKS 79

Query: 113 CLICRTE--NDRLTFTDNIDAQYSEITDFSGS-------DDKFGIDFTSDEVKNATLDLL 163
           CLICRT+  N+ + FT+ +++Q  E  DF+ +       + K+GI FTSD+V   TL+L 
Sbjct: 80  CLICRTDFDNNSMIFTEKLNSQAYE--DFNSNMWQTDLINTKYGIKFTSDDVAKETLNLS 137

Query: 164 KYACPLC--PDNEQHVSTT----YKKYNEHLKSAHN-RMICLICAGNKHSFPREMKIYTA 216
           K+ C +C   D E  ++ T    +KK NEHLK  HN + IC+ICA +  SFP E+KIYT 
Sbjct: 138 KFICSVCIIEDKENVMNATDYKSFKKLNEHLKLEHNNKTICMICADHHFSFPSELKIYTT 197

Query: 217 NQLKNHHSRG-DSEGFKGHPMCAFCTGKRFYSDDELYIHMRNDHEKCHICDRIDHTQPQY 275
           NQLKNH+++G +++GFKGHPMC FC+ KRFYS DEL  HMR  HE+CHICD+IDH  PQ+
Sbjct: 198 NQLKNHNNKGSETDGFKGHPMCKFCSNKRFYSQDELMSHMREKHERCHICDKIDHNNPQF 257

Query: 276 FKDYEQLFEHFRTSHYVCTVQSCLDDKFVVFKDDMELQAHILKEHGDILRGKPKFFQSEL 335
           FK+Y+QLF HF+ SHY+CT Q+CLDDKF+VFKDDMELQAHIL+EHGD++RGKPKFFQSEL
Sbjct: 258 FKNYDQLFHHFKNSHYICTFQTCLDDKFIVFKDDMELQAHILQEHGDLIRGKPKFFQSEL 317

Query: 336 STFISAPSQVIRERDSYNY----------DMGSVGSSNIEESSNPEVNRLRMNERAKHYL 385
           STFIS PS+VI + +++             + SV S+N   SS  EV +LR++ERAKHYL
Sbjct: 318 STFISTPSRVITDDNAFTSQHSFSDSSLPSLNSVNSTNANNSSQ-EVKQLRLDERAKHYL 376

Query: 386 NSSLEGFQKFETLNENYDSSVLTASQLVQEYKKLFTDTHADIYLLVHNLSALYPKNSKKF 445
           ++S E FQ F  LN+ Y ++ LTA+QL+  YK LF    +D++LL+HNLS LYP NS K+
Sbjct: 377 DNSHEDFQTFINLNKQYAANKLTAAQLLNSYKNLFQTPQSDVHLLIHNLSELYPMNSLKY 436

Query: 446 KDLDVIYQEYEQTEKRKNALPSLLDD--HIQTVPGGAWGXXXXXXXXXXXIKNLNQ---L 500
           K+LD IY+  E+   +K  LPSL +D     ++    WG             N N+   L
Sbjct: 437 KELDSIYRAQEKKLSKKPQLPSLYNDPSSSSSMVNAVWGNSNNNRNVSSLRTNTNRPLNL 496

Query: 501 PSLGGVSSSFDPFKNPNKAPVYKGLRQSPKPVVSATQRQTPMRISARPTASNRVEFNGGS 560
           PSL    S+ +            G R  P  V  +T   T    +   ++++R+      
Sbjct: 497 PSLTSTPSNLN------------GTR--PLHVSHSTSSLTSKSRNDNASSNSRIS----- 537

Query: 561 TTKAATPSWGSQPXXXXXXXXXLADLNLPTLPAPKPKVYIPPVHEPVIPDPKKWGQKG 618
                                     NLP+LP PKPKVYIPPV + VIPDP  WG++G
Sbjct: 538 --------------------------NLPSLPTPKPKVYIPPVRQTVIPDPNSWGRRG 569

>Sklu_1676.2 YDR266C, Contig c1676 743-2695
          Length = 650

 Score =  483 bits (1244), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 271/634 (42%), Positives = 367/634 (57%), Gaps = 47/634 (7%)

Query: 1   MSSEQQQNGSKPKNRNFRRTQTXXXXXXXXXXXXKAKKITGNPDFLQKEIKS-GKKSNIE 59
           MS++ QQ     + RNFRRTQ             ++        F  + + S  + S+  
Sbjct: 1   MSTKLQQK----QQRNFRRTQDSQAPRKSDTNSSRSNGGKWKRAFADENLSSLNQTSSPG 56

Query: 60  KKVEEFNAREEDDDTELCIICARVLVYASLSPCNHTTCHVCSFRQRALYEKKSCLICRTE 119
             +EE       DD E+CIICA    Y +LS C+HTTCH C+FRQRALY KK CLICRTE
Sbjct: 57  DNLEE-------DDGEICIICANPRKYIALSACSHTTCHKCTFRQRALYGKKGCLICRTE 109

Query: 120 NDRLTFTDNIDAQYSEIT--DFSGSDDKFGIDFTSDEVKNATLDLLKYACPLCPDNEQHV 177
           N++L FTD  D Q+++ T  DF+ + +++GI FTS+ V  ATL LLKY CP   D     
Sbjct: 110 NEQLIFTDKFDHQFADFTPRDFAKTSEEYGIAFTSEAVYTATLQLLKYNCPF-GDVADKD 168

Query: 178 STTYKKYNEHLKSAHNRMICLICAGNKHSFPREMKIYTANQLKNHHSRGDSEGFKGHPMC 237
             ++KKYNEHLK++HN+ IC+ICA NK +FP E+KI+T NQL+NH SRGDS GFKGHPMC
Sbjct: 169 FESFKKYNEHLKTSHNKTICMICANNKKAFPSELKIFTPNQLRNHQSRGDSHGFKGHPMC 228

Query: 238 AFCTGKRFYSDDELYIHMRNDHEKCHICDRIDHTQPQYFKDYEQLFEHFRTSHYVCTVQS 297
            FCTG+RFYSDDELY+HMR+ HE+CHICD+ID T PQYFK+Y+QLFEHFR SHYVCTVQ+
Sbjct: 229 GFCTGQRFYSDDELYVHMRDRHERCHICDQIDSTNPQYFKNYDQLFEHFRNSHYVCTVQT 288

Query: 298 CLDDKFVVFKDDMELQAHILKEHGDILRG-------KPKFFQSELSTFISAPSQVIRERD 350
           CL+ KFVVF+DD++LQAHILKEH  IL           + FQSELSTF + P++ + ERD
Sbjct: 289 CLESKFVVFRDDIDLQAHILKEHRTILANDKGNIPVAGRRFQSELSTFSATPARAVHERD 348

Query: 351 SYNYDMGSVGSSNIEESSN-------PEVNRLRMNERAKHYLNSSLEGFQKFETLNENYD 403
           +  +D  ++ SS+   S+N       PEV R+RM ERA+HYLN S   F+ F  +NE+Y 
Sbjct: 349 T--FDTPALRSSSAARSANTTNSNSSPEVKRMRMEERARHYLNYSQPEFEAFLAINEDYR 406

Query: 404 SSVLTASQLVQEYKKLFTDTHADIYLLVHNLSALYPKNSKKFKDLDVIYQEYEQTEKRKN 463
            + L+A  +   Y+KLF    AD+ LL+++ S ++P+NS K KDL  IY+  ++    + 
Sbjct: 407 KNTLSAEDVFTAYQKLFNSPSADVPLLIYDFSGMFPQNSAKHKDLFAIYEAEQKKNNHQI 466

Query: 464 ALPSLLDDHIQTVPGGAWGXXXXXXXXXXXIKNLNQLPSLGGVSSSFDPFKNP-NKAPVY 522
             PSL        P                    +   S      +F     P N  P++
Sbjct: 467 NFPSL------APPSSVAAANVIGGSWGRSSSPSSASSSKSSGRYNFPALSKPVNSQPLF 520

Query: 523 KGLRQSPKPVVSATQRQTPMRISARPTASNRVEFNGGSTTKAATPSWGSQPXXXXXXXXX 582
                +PK    A+ +     +   P        NG + T     +  +           
Sbjct: 521 -----TPK---KASFKSLNTNVRTAPVVKKASANNGTNYTPTYLQNKSTSSGSLSSSSAS 572

Query: 583 LADLNLPTLP-APKPKVYIPPVHEPVIPDPKKWG 615
           +++   P LP A K K   P V+EP IP+P++WG
Sbjct: 573 ISEEKFPPLPKAQKKKFRAPLVNEPNIPNPQQWG 606

>AER391C [2891] [Homologous to ScYDR266C - SH] (1371409..1373307)
           [1899 bp, 632 aa]
          Length = 632

 Score =  457 bits (1177), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 251/567 (44%), Positives = 344/567 (60%), Gaps = 43/567 (7%)

Query: 69  EEDDDTELCIICARVLVYASLSPCNHTTCHVCSFRQRALYEKKSCLICRTENDRLTFTDN 128
           EED+    C+ICA  L Y +LSPCNHTTCH C+FRQRALYEKK+CL+CRTE++ L FTD 
Sbjct: 59  EEDNGEMTCLICADTLRYVALSPCNHTTCHKCAFRQRALYEKKACLVCRTEHEYLIFTDQ 118

Query: 129 IDAQYSEIT--DFSGSDDKFGIDFTSDEVKNATLDLLKYACPLCPDNEQHVSTTYKKYNE 186
           I A+++     D    DD++GI FTS   ++ TL LLKY CP   D  +    ++K YNE
Sbjct: 119 IKAEHARFGPRDIVAVDDRYGIQFTSLNAESVTLSLLKYNCPYG-DVPEFDLDSFKNYNE 177

Query: 187 HLKSAHNRMICLICAGNKHSFPREMKIYTANQLKNHHSRGDSEGFKGHPMCAFCTGKRFY 246
           HLK+ H R IC ICA ++  FP EMK  T NQLK H++ GDS+GF GHP+C FC+GKRFY
Sbjct: 178 HLKNEHKRSICTICARHRKQFPAEMKTLTPNQLKIHNTIGDSKGFTGHPLCGFCSGKRFY 237

Query: 247 SDDELYIHMRNDHEKCHICDRIDHTQPQYFKDYEQLFEHFRTSHYVCTVQSCLDDKFVVF 306
           SDDELYIHMR  HEKCHICD++D TQPQYFKDY+QLFEHF+ SHY+C V+SCLD KFVVF
Sbjct: 238 SDDELYIHMRERHEKCHICDQVDSTQPQYFKDYDQLFEHFKHSHYICAVRSCLDSKFVVF 297

Query: 307 KDDMELQAHILKEHGDILRGKPKF-------FQSELST-FISAPSQVIRERDSYNYDMGS 358
            DD++LQAH+LKEH +I+  K          ++SELS+ F    S+ + E  S N     
Sbjct: 298 ADDLDLQAHMLKEHPNIMGNKSTISLTAGRRYRSELSSGFTPNVSRAVHETSSSNALALG 357

Query: 359 VGSSNIEESSNPEVNRLRMNERAKHYLNSSLEGFQKFETLNENYDSSVLTASQLVQEYKK 418
              S +  + +PE+ R R+ ERA+HYLN S    + FE +N +Y+++V++A+ + + Y +
Sbjct: 358 PSVSPVATAESPEMKRKRLEERARHYLNYSQSEMKLFEQINNDYNNNVISATSVQRRYDQ 417

Query: 419 LFTDTHADIYLLVHNLSALYPKNSKKFKDLDVIYQEYEQTEKRKNALPSLLDDHIQTVP- 477
           LF +  AD +LL+ N +  +P+ S K+K+L+ IYQ  ++  +R+   PSL  +   + P 
Sbjct: 418 LFRNPEADTHLLLRNFADTFPEGSLKYKELNAIYQAEQEKRERQAKFPSLSTNPWYSAPV 477

Query: 478 -GGAWGXXXXXXXXXXXIKNLNQLPSLGGVSSSFDPFKNPNKAPVYKGLRQSPKPVVSAT 536
            G AWG            KN       GG SSS   F + + A     L  S + V    
Sbjct: 478 VGAAWG------------KN-------GGKSSSSRNFPSLSSA-----LTDSYQNVTPQP 513

Query: 537 QRQTPMRISARPTASNRVEFNGGSTTKAATPSWGSQPXXXXXXXXXLADLNLPTLPAPKP 596
           ++  P R ++ P AS+  +          TP++              A L  P L +P  
Sbjct: 514 KKPVPYRPTS-PVASSSTQVQNTKRNSNYTPTYLKSKTKGESRAQSNAAL-FPPLSSPDT 571

Query: 597 KVY-IPPVHEPVIPDPKKWGQ-KGEPA 621
           K +  PPV+E  +PDPK+WG+ K EP+
Sbjct: 572 KKFRAPPVNE--LPDPKQWGKSKREPS 596

>Kwal_55.20000
          Length = 617

 Score =  431 bits (1108), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 249/623 (39%), Positives = 352/623 (56%), Gaps = 63/623 (10%)

Query: 10  SKP-KNRNFRRTQTXXXXXXXXXXXXKAKKITGNPDFLQKEIKSGKKSNIEKKVEEFNAR 68
           +KP + R+FRRTQ             + +K +G      K  +S  K    +  E  N  
Sbjct: 3   AKPEQKRSFRRTQ---------GTQSRPRKESG------KNTESSWKRTFNQGTEGENEL 47

Query: 69  EEDDDTELCIICARVLVYASLSPCNHTTCHVCSFRQRALYEKKSCLICRTENDRLTFTDN 128
           +EDD   +CIICA  L Y +LSPCNH TC+ C+FRQRALY KKSCL+CRTE+D + F+ +
Sbjct: 48  DEDD---ICIICAEKLTYVTLSPCNHVTCNRCTFRQRALYNKKSCLVCRTESDLVIFSAD 104

Query: 129 IDAQYSEI--TDFSGSDDKFGIDFTSDEVKNATLDLLKYACPLCPDNEQHVSTTYKKYNE 186
            +A + +    +   ++   G+ FTS +V + TL LL Y+CP   D        +KKYN 
Sbjct: 105 RNAVFDDFDEKNLVETNVDLGVSFTSQDVASKTLGLLIYSCPF-GDTGGTNHENFKKYNA 163

Query: 187 HLKSAHNRMICLICAGNKHSFPREMKIYTANQLKNHHSRGDSEGFKGHPMCAFCTGKRFY 246
           HLK+ HN+ +C+ICA +K +FP E++IYT +QL+ H S+GDSEGFKGHPMC FC+G+RFY
Sbjct: 164 HLKNEHNKTLCMICASHKKAFPSELRIYTPSQLRIHQSKGDSEGFKGHPMCGFCSGQRFY 223

Query: 247 SDDELYIHMRNDHEKCHICDRIDHTQPQYFKDYEQLFEHFRTSHYVCTVQSCLDDKFVVF 306
           SDDEL +HMR+ HEKCHICD+ +   PQYFKDY+QLFEHF+  HYVC VQSCLD KFVVF
Sbjct: 224 SDDELNVHMRDRHEKCHICDQTNINSPQYFKDYDQLFEHFKFDHYVCGVQSCLDSKFVVF 283

Query: 307 KDDMELQAHILKEHGDILRG--------KPKFFQSELSTFISAPSQVIRERDSYNYDMGS 358
           +DD++LQAHILKEHG ILR           + +QS+LSTF   PS+    +D  +    +
Sbjct: 284 RDDLDLQAHILKEHGGILRNGNNNLSMKGGRKYQSQLSTFSRPPSRSSSTQDVRD----N 339

Query: 359 VGSSNIEESSNPEVNRLRMNERAKHYLNSSLEGFQKFETLNENYDSSVLTASQLVQEYKK 418
              +N  E+S  EV RLRM ERA+HYL  S   F++F  +N +Y + ++TA  ++  Y+ 
Sbjct: 340 TAKNNSSENS-LEVKRLRMEERARHYLKYSHTDFEQFLAINSSYQNGLITAQDVLSAYEG 398

Query: 419 LFTDTHADIYLLVHNLSALYPKNSKKFKDLDVIYQEYEQTEKRKNALPSLLDDHIQTVPG 478
           LF    A + LL+++ S L+P++SK  +DL VIY   ++ E R    PSL   +   +PG
Sbjct: 399 LFKSPEAQVGLLLYDFSELFPQSSKLHQDLRVIYDTVQKKENRHTNFPSLSALNPTLLPG 458

Query: 479 ----GAWGXXXXXXXXXXXIKNLNQLPSLGGVSSSFDPFKNPNKAPVYKGLRQSPKPVVS 534
               G+WG                  PSL   +S   P      +       Q     V 
Sbjct: 459 SVASGSWGRSTGSNKAARQY----NFPSLKKPASPQPPIITKKPSSTKVNNVQPKAKAVP 514

Query: 535 ATQRQTPMRISARPTASNRVEFNGGSTTKAATPSWGSQPXXXXXXXXXLADLNLPTLPAP 594
            T++ +    S +PT       +G   + +++P+              L     P LP  
Sbjct: 515 VTRKPSSNESSFKPTY-----LDGKQKSASSSPA--------------LDREKFPPLPKS 555

Query: 595 KPKVYIPP-VHEPVIPDPKKWGQ 616
           + + +  P V+E  IP+P +WG+
Sbjct: 556 QARKFRAPLVNEASIPNPSQWGK 578

>KLLA0E16698g 1479322..1481292 weakly similar to sgd|S0002674
           Saccharomyces cerevisiae YDR266c, start by similarity
          Length = 656

 Score =  398 bits (1022), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 231/575 (40%), Positives = 318/575 (55%), Gaps = 43/575 (7%)

Query: 59  EKKVEEFNAREEDDDTELCIICARVLVYASLSPCNHTTCHVCSFRQRALYEKKSCLICRT 118
           EK +   N  ++DD + +C+ICA  L   +LSPCNH TCH C  RQRALYEKK CL CR+
Sbjct: 71  EKSMGTGNGTDDDDSSNVCLICAEKLHIIALSPCNHPTCHKCCLRQRALYEKKQCLFCRS 130

Query: 119 ENDRLTFTDNIDAQYSEI---TDFSGSDDKFGIDFTSDEVKNATLDLLKYACPLCPDNEQ 175
           E + + FTD I   Y  +         ++K GI FTS  V N  ++LLKY  P    N+ 
Sbjct: 131 EVEDIIFTDKIKETYEHLDKKAKLEFKNEKLGIRFTSKNVMNDAMNLLKYVSPFGDANKD 190

Query: 176 HVSTTYKKYNEHLKSAHNRMICLICAGNKHSFPREMKIYTANQLKNHHSRGD-SEGFKGH 234
             S  +KK NE L+  HN+ IC+ICAG+K +FP E+K+ T  QLK H SRGD  +GFKGH
Sbjct: 191 FGS--FKKLNEFLRQEHNKTICMICAGHKKAFPGELKVMTVKQLKIHESRGDPKDGFKGH 248

Query: 235 PMCAFCTGKRFYSDDELYIHMRNDHEKCHICDRIDHTQPQYFKDYEQLFEHFRTSHYVCT 294
           PMC FC+GKRFYSDDELY HM+  HE+CHICD++D +QPQYFK+YE LFEHF+++HYVCT
Sbjct: 249 PMCGFCSGKRFYSDDELYKHMKLSHERCHICDQLDPSQPQYFKNYEDLFEHFKSAHYVCT 308

Query: 295 VQSCLDDKFVVFKDDMELQAHILKEH----GD------ILRGKPKFFQSELSTFISAPSQ 344
           V SCLD KFVVF D+++L+AHI+KEH    GD      ++    K F+S+++TF S P++
Sbjct: 309 VPSCLDAKFVVFSDELDLRAHIIKEHPHLAGDSRRAMTLIDNTSKKFRSQITTF-SNPTR 367

Query: 345 VIRERDSYNYDMGSVGSSNIEESSNPEVNRLRMNERAKHYLNSSLEGFQKFETLNENYDS 404
           +I   D+ N +  S  S         +V R RM +RA+HYL +S   FQ F  +N+ ++ 
Sbjct: 368 II---DAQNEESNSANSR--------DVKRRRMEQRARHYLGNSEPDFQSFLIINDLFNK 416

Query: 405 SVLTASQLVQEYKKLFTDTHADIYLLVHNLSALYPKNSKKFKDLDVIYQEYEQTEKRKNA 464
           + ++A +L  +Y+ LF     DI LL+++LS LY   S K K L  IY+   + ++    
Sbjct: 417 NEISAQELQSKYEDLFKQHADDIQLLIYDLSELYHSTSDKHKRLRAIYEGIMKKKENAGK 476

Query: 465 LPSLLDDHIQTVPG--GAWGXXXXXXXXXXXIKNLNQLPSLGG-VSSSFDPFKNPNKAPV 521
              L+ D   +V    G WG           +K    LP++   + SS   + N  K   
Sbjct: 477 FKPLVADSSSSVNVVYGKWGKKSSSGVGGSNVK-FTSLPAVSEPIFSSKASYTNLRK--- 532

Query: 522 YKGLRQSPKPVVSATQRQTPMRISARPTASNRVEFNGGSTTKAATPSWGSQPXXXXXXXX 581
             G      PV+ +         ++   A       G ST         SQP        
Sbjct: 533 -NGSSSPSSPVIRSGLTSNSSSSTSLNYAKKNQSPPGSSTVVV-----NSQPNVTAIKSP 586

Query: 582 XLADLNLPTLPAPKPKVYIPPVHEPVIPDPKKWGQ 616
                + P L A K K   PPV +  IP+P  WG+
Sbjct: 587 N--PTSFPKLQATKKKFVAPPVKQTTIPNPSTWGK 619

>Scas_672.2
          Length = 263

 Score = 34.7 bits (78), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 33/80 (41%), Gaps = 14/80 (17%)

Query: 44  DFLQKEIKSGKKSNIEKKVEEFNAREEDDDTELCIICARVLVYASLSPCNHTTCHVCSFR 103
           D ++ EI+ GKK    + V E+           C IC      A ++PC H  C  C F+
Sbjct: 174 DEIEDEIQRGKKQETYRPVTEYR----------CPICMDPPETALIAPCGHVFCCDCLFQ 223

Query: 104 Q----RALYEKKSCLICRTE 119
                R   +   C +CR E
Sbjct: 224 MVNSSRTYRKDGHCALCRKE 243

>ABR104W [696] [Homologous to ScYPR093C - SH]
           complement(574067..575053) [987 bp, 328 aa]
          Length = 328

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 4/63 (6%)

Query: 89  LSPCNHTTCHVCSFRQRALYE-KKSCLICRTENDRLTFTDN---IDAQYSEITDFSGSDD 144
           L PC H     C  +   L+   +SC +CRTE   L  TD+   ID    ++ DF G  D
Sbjct: 32  LMPCGHEYHLACIRKWFHLHSGNRSCPVCRTEASVLVDTDHEVKIDLSVGQLLDFYGLLD 91

Query: 145 KFG 147
           + G
Sbjct: 92  EIG 94

>Scas_615.13
          Length = 330

 Score = 33.9 bits (76), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 36/81 (44%), Gaps = 10/81 (12%)

Query: 47  QKEIKSGKKSNI--EKKVEEFNAREED------DDTELCIICARVLVYASLSPCNHTTCH 98
           Q +I++G  + I  E +V   N  +++      +D   CI+C   +   S SPC H  C 
Sbjct: 242 QGDIQAGILTRIPNESEVNHLNLSDKEIFPFIPEDARKCILCLAYMTDPSCSPCGHIFCW 301

Query: 99  VCSFRQRALYEKKSCLICRTE 119
            C        E+  C +CR E
Sbjct: 302 ECILDWCK--ERPECPLCRQE 320

>KLLA0C09504g complement(826607..827650) highly similar to
           sgd|S0005788 Saccharomyces cerevisiae YOR262w, start by
           similarity
          Length = 347

 Score = 33.5 bits (75), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 395 FETLNENYDSSVLTASQLVQEYKK-LFTDTHADIYLLVHNLSALYPKNSKKFKDLDV 450
            E+LNE+ D  +L    LVQE K  L  D    + L  HN SAL+    +  KDLD+
Sbjct: 78  IESLNESIDLFILQIKSLVQEEKAYLVFDCPGQVELFTHN-SALFKIFKRLEKDLDI 133

>KLLA0E16720g complement(1481372..1482289) similar to sp|Q05568
           Saccharomyces cerevisiae YDR265w PAS4 peroxisomal
           assembly protein - peroxin singleton, start by
           similarity
          Length = 305

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 2/46 (4%)

Query: 72  DDTELCIICARVLVYASLSPCNHTTCHVCSFRQRALYEKKSCLICR 117
           +D+  C++C   ++  S +PC H  C  C        E++ C +CR
Sbjct: 250 EDSRKCVLCLNYMLDPSATPCGHLFCWDCIMEWTL--ERQECPLCR 293

>CAGL0J03586g complement(341290..342525) similar to sp|P10862
           Saccharomyces cerevisiae YCR066w RAD18 DNA repair
           protein, hypothetical start
          Length = 411

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 17/32 (53%)

Query: 69  EEDDDTELCIICARVLVYASLSPCNHTTCHVC 100
           +E DD   C IC   L    L+PC HT C +C
Sbjct: 19  QELDDLLRCHICKDFLKNPVLTPCGHTFCSLC 50

>AGL289C [4023] [Homologous to ScYER116C (SLX8) - SH]
           (164204..164929) [726 bp, 241 aa]
          Length = 241

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 19/45 (42%), Gaps = 4/45 (8%)

Query: 77  CIICARVLVYASLSPCNHTTCHVCSFRQ----RALYEKKSCLICR 117
           C IC      A ++PC H  C VC F+     R       C +CR
Sbjct: 173 CPICFDPPEAALMTPCGHIYCTVCLFQMVNSSRGYRRNGQCALCR 217

>KLLA0D00418g 38504..39238 weakly similar to sp|P32800 Saccharomyces
           cerevisiae YJL210w PAS5 peroxisomal assembly protein -
           peroxin singleton, start by similarity
          Length = 244

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 10/72 (13%)

Query: 53  GKKSNIEKKVEEFNAREEDDDTELCIICARVLVYA-SLSPCNHTTCHVCSFRQRALYEKK 111
           G  S++    E+F+ +       LC +C  V   A +++ CN   C+ C+       E+ 
Sbjct: 180 GGSSSVGAPGEKFSQKNT-----LCPVCGEVATNAFTITCCNTRYCYTCALE----VEQS 230

Query: 112 SCLICRTENDRL 123
            CL+C T+N + 
Sbjct: 231 HCLVCNTKNPKF 242

>Scas_720.89
          Length = 469

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 2/51 (3%)

Query: 69  EEDDDTELCIICARVLVYASLSPCNHTTCHVCSFRQRALYEKKSCLICRTE 119
           +E D    C IC   L    L+PC+HT C +C   +  L +   C +C  E
Sbjct: 20  QEIDTLLRCHICKDFLKVPVLTPCSHTFCSLCI--REYLKDNSKCPLCLNE 68

>KLLA0C08756g complement(765847..767130) weakly similar to sp|P10862
           Saccharomyces cerevisiae YCR066w RAD18 DNA repair
           protein singleton, start by similarity
          Length = 427

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 22/40 (55%), Gaps = 2/40 (5%)

Query: 77  CIICARVLVYASLSPCNHTTCHVCSFRQRALYEKKSCLIC 116
           C IC   L  + L+PC H+ C +C   ++ L ++  C +C
Sbjct: 32  CHICKDFLKASVLTPCGHSFCSICI--RKYLQKESKCPLC 69

>AFR499C [3691] [Homologous to ScYLR323C (CWC24) - SH]
           (1339549..1340301) [753 bp, 250 aa]
          Length = 250

 Score = 30.4 bits (67), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 31/68 (45%), Gaps = 2/68 (2%)

Query: 49  EIKSGKKSNIEKKVEEFNAREEDDDTELCIICARVLVYASLSPCNHTTCHVCSFRQRALY 108
           + ++G + N E KV +  AR+ D     C++C         + C H  C  C  R+  + 
Sbjct: 130 DFRAGWRLNEEWKVGQTEARDLDSIPFRCVLCRGHYRAPVRTRCGHYFCGGCFARR--VR 187

Query: 109 EKKSCLIC 116
           E + C +C
Sbjct: 188 ETRQCAVC 195

>AGR233W [4544] [Homologous to ScYGL221C (NIF3) - SH]
           complement(1185515..1186369) [855 bp, 284 aa]
          Length = 284

 Score = 30.4 bits (67), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 32/71 (45%), Gaps = 5/71 (7%)

Query: 199 ICAGN-----KHSFPREMKIYTANQLKNHHSRGDSEGFKGHPMCAFCTGKRFYSDDELYI 253
           +CAG+     K   P ++ +Y   +L +H      E  K   +C     +R Y  D +Y 
Sbjct: 203 LCAGSGSGVFKGVSPGDVDLYYTGELSHHEILRYREAGKAVIVCNHSNTERGYLRDVMYK 262

Query: 254 HMRNDHEKCHI 264
           H++    +CH+
Sbjct: 263 HIQELGVECHV 273

>Kwal_27.9705
          Length = 515

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 21/32 (65%), Gaps = 2/32 (6%)

Query: 434 LSALYPKNSKKFKDLDVIYQEYEQTEKRKNAL 465
           L AL+P+   KF ++DV YQEY   EKR + L
Sbjct: 316 LKALFPQIDIKFVEVDVAYQEY--LEKRDHIL 345

>YCR066W (RAD18) [592] chr3 (231495..232958) Multifunctional DNA
           repair protein, required for post-replication repair
           [1464 bp, 487 aa]
          Length = 487

 Score = 30.0 bits (66), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 16/29 (55%), Gaps = 1/29 (3%)

Query: 73  DTEL-CIICARVLVYASLSPCNHTTCHVC 100
           DT L C IC   L    L+PC HT C +C
Sbjct: 23  DTLLRCHICKDFLKVPVLTPCGHTFCSLC 51

>Kwal_55.19999
          Length = 152

 Score = 28.9 bits (63), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 21/45 (46%), Gaps = 2/45 (4%)

Query: 73  DTELCIICARVLVYASLSPCNHTTCHVCSFRQRALYEKKSCLICR 117
           D+  CI+C   ++  S +PC H  C  C        E+  C +CR
Sbjct: 98  DSRKCILCLGFMLDPSCAPCGHVFCWKCLLSW--CNERPECPLCR 140

>KLLA0D10758g 917125..919677 similar to sp|P47156 Saccharomyces
           cerevisiae YJR119c, start by similarity
          Length = 850

 Score = 29.6 bits (65), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 2/46 (4%)

Query: 59  EKKVEEFNAREEDDDTELCIICAR-VLVYASLSPCNHTTCHVCSFR 103
           +++V++FN  +ED+D E C IC + V    + S     TC+ C F+
Sbjct: 273 DEEVDDFNIEDEDED-EKCPICVKHVPTKVTSSSVAIVTCNSCDFK 317

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.132    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 21,689,707
Number of extensions: 991006
Number of successful extensions: 3610
Number of sequences better than 10.0: 53
Number of HSP's gapped: 3688
Number of HSP's successfully gapped: 55
Length of query: 647
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 539
Effective length of database: 12,857,365
Effective search space: 6930119735
Effective search space used: 6930119735
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)