Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M08646g33733217320.0
Scas_615.1134934611761e-162
YDR267C33033311731e-162
ACR091W32833410561e-144
KLLA0E21879g33333210201e-139
Kwal_55.215593513219921e-134
Sklu_1710.12402368371e-112
Kwal_23.53514742622131e-18
Scas_679.288151841831e-14
ADR077C12041751803e-14
AEL269C4552331766e-14
CAGL0I03718g12011751778e-14
Kwal_56.2452612101751778e-14
KLLA0F04884g12121751751e-13
Scas_630.66212401751e-13
AEL246C8152181705e-13
CAGL0J03476g5172791687e-13
Scas_720.955153721679e-13
YDL145C (COP1)12011751662e-12
YCR072C5151821652e-12
KLLA0F10263g6822381652e-12
Scas_631.174743361633e-12
Scas_674.202972331604e-12
YLR222C (UTP13)8171741634e-12
AGL234W6292331625e-12
AGL196C9352321625e-12
AFR199C3342251595e-12
KLLA0E23529g8262561626e-12
Kwal_23.64297502431608e-12
YGL137W (SEC27)8892631609e-12
Scas_713.509832451591e-11
Kwal_23.63245141811581e-11
CAGL0G09845g5002251572e-11
Kwal_56.239209372411582e-11
CAGL0M04279g9402321572e-11
CAGL0C03608g6432481563e-11
KLLA0C08547g5151811563e-11
CAGL0H08932g9022661563e-11
Scas_624.1112051751554e-11
Kwal_27.120537552141554e-11
Sklu_2173.25151811544e-11
YFL009W (CDC4)7792641545e-11
CAGL0J10340g3382461517e-11
AER263C5131581519e-11
CAGL0E00561g8362391511e-10
Scas_592.4*3182101482e-10
KLLA0F06754g3442481482e-10
AGR180W8061851502e-10
Sklu_2431.127492121492e-10
YNL006W (LST8)3032251462e-10
Scas_702.168161951483e-10
ACR199C2951941453e-10
KLLA0D16390g9362541483e-10
Scas_721.115*3182101453e-10
YBR198C (TAF5)7982241474e-10
Kwal_47.174658001341465e-10
CAGL0I03454g3032521436e-10
Scas_720.83d9151691456e-10
Kwal_55.220674511741447e-10
Scas_629.126711771457e-10
YCR057C (PWP2)9232651458e-10
YPR178W (PRP4)4652281439e-10
Scas_652.163451721411e-09
Kwal_23.57696271581431e-09
AGR168W8251331431e-09
Kwal_27.115858232221431e-09
AFL014C5571821421e-09
CAGL0E02805g8401871422e-09
AER114W6332931422e-09
Kwal_27.103855361771412e-09
YCR084C (TUP1)7132391412e-09
YGL100W (SEH1)3492431383e-09
CAGL0L02629g7952221403e-09
ADL082C5691581384e-09
KLLA0A04928g8611951394e-09
Scas_704.406081581385e-09
CAGL0J08778g2981761365e-09
Kwal_56.245962941721365e-09
YLR129W (DIP2)9432321385e-09
Scas_695.153272231365e-09
Scas_721.328222511376e-09
Kwal_23.50357442071377e-09
AAR057W9222161377e-09
Kwal_14.16113342481358e-09
KLLA0D04840g3032251331e-08
KLLA0E12287g3261411341e-08
CAGL0M05335g8062191351e-08
ACR017W4232361341e-08
CAGL0L00781g6731581341e-08
YLR208W (SEC13)2971751321e-08
YBL008W (HIR1)8401371341e-08
AFL038C3302511321e-08
Kwal_23.62409131691342e-08
KLLA0C08976g9111691332e-08
KLLA0F10791g5451841322e-08
CAGL0K09284g9112161332e-08
KLLA0E07073g4521741322e-08
YIL046W (MET30)6401581322e-08
Kwal_26.87764333281313e-08
YBR175W (SWD3)3151901303e-08
Scas_707.227302021323e-08
YNL317W (PFS2)4651881313e-08
KLLA0B01958g8901821323e-08
Kwal_0.2123032271294e-08
AER280C5102081304e-08
CAGL0A02772g4413181295e-08
KLLA0F27511g6231581305e-08
CAGL0H03729g3032251285e-08
Kwal_26.75702181791248e-08
AFL118W8323131289e-08
Kwal_27.122393161891261e-07
KLLA0E11143g4933141261e-07
YLR429W (CRN1)6512941261e-07
Kwal_56.2368511021371262e-07
CAGL0M04081g4551731252e-07
KLLA0C16643g3022081242e-07
Sklu_2114.211401281262e-07
KLLA0D07546g6471891252e-07
Sklu_2442.23032271223e-07
Sklu_2416.54591531233e-07
KLLA0F22000g7933111234e-07
CAGL0J04818g6542951234e-07
Sklu_1645.25871941224e-07
Scas_585.84601881224e-07
Kwal_14.17105741941224e-07
Scas_719.526282931225e-07
ADL184W4492561215e-07
KLLA0D02530g7072961216e-07
KLLA0E04741g4591591198e-07
Sklu_2160.37601331209e-07
Scas_603.55892361191e-06
AGR207C3201901171e-06
Scas_673.114342411171e-06
ACL116W8042761182e-06
Sklu_2420.24411791172e-06
KLLA0F13244g8142921172e-06
CAGL0C00737g8162641172e-06
Scas_721.73251871152e-06
CAGL0G04345g7112531163e-06
YPL151C (PRP46)4511781153e-06
Kwal_33.155917141591144e-06
KLLA0E24508g3271881125e-06
CAGL0B03575g4192521126e-06
Scas_680.113471401126e-06
CAGL0L03201g5792451127e-06
KLLA0E18986g9901851128e-06
Kwal_33.154757833541129e-06
Sklu_2172.62631861099e-06
KLLA0C07425g4441791101e-05
AGL024W7561931111e-05
CAGL0K00957g7931591101e-05
CAGL0A00605g6402391101e-05
CAGL0F07337g6211811102e-05
Scas_558.37251581092e-05
Scas_658.14423231072e-05
KLLA0E03982g3721441073e-05
AFL056C9762061073e-05
KLLA0E21263g4291821064e-05
Scas_469.36241821064e-05
Sklu_1963.23141951054e-05
CAGL0K00275g7151671064e-05
Sklu_2317.33681461045e-05
Kwal_56.241637291261055e-05
CAGL0L06952g3471491036e-05
YGL003C (CDH1)5661931047e-05
AFL007C5511921047e-05
KLLA0F11231g4342311038e-05
YDR364C (CDC40)4552671038e-05
Sklu_2318.17112221049e-05
YGR200C (ELP2)7881391049e-05
Sklu_2364.45552421031e-04
Scas_571.46011991021e-04
CAGL0M06193g3161901001e-04
CAGL0C01441g10052801021e-04
Kwal_27.111269962741012e-04
Kwal_55.214505033241002e-04
KLLA0D06787g4361361002e-04
ADR176W4611311002e-04
Scas_442.2*7953411002e-04
Kwal_47.175675901921002e-04
YMR116C (ASC1)319241983e-04
AER448W714215993e-04
CAGL0B01529g369158983e-04
Scas_670.21595195993e-04
Scas_693.36375194983e-04
Scas_465.41002280993e-04
Scas_717.68908104993e-04
YPL183C1013138984e-04
CAGL0L04950g80587984e-04
Scas_605.18424249974e-04
YKR036C (CAF4)659259984e-04
AER255C467262965e-04
Scas_693.221145126976e-04
ADL322C501307958e-04
Kwal_26.8975445247958e-04
CAGL0L10890g457261959e-04
AGL190W370246940.001
Kwal_26.765574382950.001
CAGL0J06512g54577950.001
YMR102C834210940.001
AER337W445243940.001
ACR097W467258930.001
Kwal_56.23895367154920.002
YDR128W1148128930.002
AGR242C419236920.002
YKL213C (DOA1)715218930.002
KLLA0E11297g512240920.002
AAL009C303210910.002
Kwal_34.15818349127910.002
KLLA0C07513g439178910.002
KLLA0F19734g1133128920.002
Scas_718.6*546281910.003
Sklu_1880.3471272910.003
CAGL0L02761g419154910.003
YGR225W (AMA1)562145910.003
ADR264C346145900.003
KLLA0A08822g582160910.003
Scas_720.45755123910.003
Kwal_33.13515398126900.003
Scas_660.7*60371900.003
Kwal_56.23035424243900.004
YOR212W (STE4)423244900.004
CAGL0M02277g427261890.004
YDL195W (SEC31)1273277900.004
YGL116W (CDC20)610221890.005
YEL056W (HAT2)401123880.005
CAGL0L09647g429155880.005
CAGL0G00704g440104880.005
Kwal_56.22345396221880.006
Kwal_0.356526118880.006
Sklu_675.1308131870.006
AEL314W715252880.006
YAR003W (SWD1)426104870.007
Scas_711.11695254880.007
AAL119W53789870.007
CAGL0K03861g513151870.009
YDR142C (PEX7)375102860.009
Sklu_1926.5509230870.009
Scas_512.353471870.009
Kwal_27.12667721205870.009
Scas_700.27*433163860.010
YBR195C (MSI1)422181860.010
Scas_712.34399128860.010
YMR146C (TIF34)347145860.010
YMR131C (RRB1)51192860.012
YOR272W (YTM1)460258850.013
Kwal_26.8628422234850.014
Kwal_47.17827523105850.014
Kwal_27.9840471100850.014
CAGL0C02937g467210850.015
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M08646g
         (332 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces c...   671   0.0  
Scas_615.11                                                           457   e-162
YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Prote...   456   e-162
ACR091W [1138] [Homologous to ScYDR267C - SH] complement(520609....   411   e-144
KLLA0E21879g complement(1944865..1945866) similar to sgd|S000267...   397   e-139
Kwal_55.21559                                                         386   e-134
Sklu_1710.1 YDR267C, Contig c1710 17-739                              327   e-112
Kwal_23.5351                                                           87   1e-18
Scas_679.28                                                            75   1e-14
ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH] (843171..84...    74   3e-14
AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH] (134760..13...    72   6e-14
CAGL0I03718g complement(317565..321170) highly similar to sp|P53...    73   8e-14
Kwal_56.24526                                                          73   8e-14
KLLA0F04884g complement(478044..481682) similar to sp|P53622 Sac...    72   1e-13
Scas_630.6                                                             72   1e-13
AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH] (172849..1...    70   5e-13
CAGL0J03476g 331933..333486 highly similar to sp|P25382 Saccharo...    69   7e-13
Scas_720.95                                                            69   9e-13
YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer (C...    69   2e-12
YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein ...    68   2e-12
KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA Kluy...    68   2e-12
Scas_631.17                                                            67   3e-12
Scas_674.20                                                            66   4e-12
YLR222C (UTP13) [3622] chr12 complement(579320..581773) Componen...    67   4e-12
AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH] complement(...    67   5e-12
AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH] (328838..33...    67   5e-12
AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH] (799876..80...    66   5e-12
KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces...    67   6e-12
Kwal_23.6429                                                           66   8e-12
YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741) Coat...    66   9e-12
Scas_713.50                                                            66   1e-11
Kwal_23.6324                                                           65   1e-11
CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces c...    65   2e-11
Kwal_56.23920                                                          65   2e-11
CAGL0M04279g 469040..471862 highly similar to sp|Q12220 Saccharo...    65   2e-11
CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces c...    65   3e-11
KLLA0C08547g 749737..751284 highly similar to sp|P25382 Saccharo...    65   3e-11
CAGL0H08932g join(871668..871685,872089..874779) highly similar ...    65   3e-11
Scas_624.11                                                            64   4e-11
Kwal_27.12053                                                          64   4e-11
Sklu_2173.2 YCR072C, Contig c2173 2732-4279                            64   4e-11
YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and co...    64   5e-11
CAGL0J10340g complement(1008637..1009653) highly similar to sp|P...    63   7e-11
AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)...    63   9e-11
CAGL0E00561g 49750..52260 some similarities with sp|P16649 Sacch...    63   1e-10
Scas_592.4*                                                            62   2e-10
KLLA0F06754g complement(650475..651509) similar to sp|P53011 Sac...    62   2e-10
AGR180W [4491] [Homologous to ScYLR222C - SH] complement(1090647...    62   2e-10
Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement      62   2e-10
YNL006W (LST8) [4579] chr14 (620066..620977) Protein required fo...    61   2e-10
Scas_702.16                                                            62   3e-10
ACR199C [1246] [Homologous to ScYLR208W (SEC13) - SH] (698881..6...    60   3e-10
KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces...    62   3e-10
Scas_721.115*                                                          60   3e-10
YBR198C (TAF5) [381] chr2 complement(616084..618480) Component o...    61   4e-10
Kwal_47.17465                                                          61   5e-10
CAGL0I03454g 292823..293734 similar to sp|Q04491 Saccharomyces c...    60   6e-10
Scas_720.83d                                                           60   6e-10
Kwal_55.22067                                                          60   7e-10
Scas_629.12                                                            60   7e-10
YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential p...    60   8e-10
YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associa...    60   9e-10
Scas_652.16                                                            59   1e-09
Kwal_23.5769                                                           60   1e-09
AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH] complement(...    60   1e-09
Kwal_27.11585                                                          60   1e-09
AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH] (409496..4...    59   1e-09
CAGL0E02805g complement(265137..267659) similar to sp|P32479 Sac...    59   2e-09
AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH] complement(...    59   2e-09
Kwal_27.10385                                                          59   2e-09
YCR084C (TUP1) [608] chr3 complement(260307..262448) General rep...    59   2e-09
YGL100W (SEH1) [1883] chr7 (313235..314284) Protein found in com...    58   3e-09
CAGL0L02629g complement(307323..309710) similar to sp|P07834 Sac...    59   3e-09
ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH] (538948..5...    58   4e-09
KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces c...    58   4e-09
Scas_704.40                                                            58   5e-09
CAGL0J08778g 866175..867071 highly similar to sp|Q04491 Saccharo...    57   5e-09
Kwal_56.24596                                                          57   5e-09
YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 sno...    58   5e-09
Scas_695.15                                                            57   5e-09
Scas_721.32                                                            57   6e-09
Kwal_23.5035                                                           57   7e-09
AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH] complement(4...    57   7e-09
Kwal_14.1611                                                           57   8e-09
KLLA0D04840g 413362..414273 highly similar to sp|P41318 Saccharo...    56   1e-08
KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to ...    56   1e-08
CAGL0M05335g complement(569132..571552) similar to sp|P38129 Sac...    57   1e-08
ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH] complement(...    56   1e-08
CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces cer...    56   1e-08
YLR208W (SEC13) [3609] chr12 (559553..560446) Component of the C...    55   1e-08
YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription...    56   1e-08
AFL038C [3155] [Homologous to ScYGL100W (SEH1) - SH] (367581..36...    55   1e-08
Kwal_23.6240                                                           56   2e-08
KLLA0C08976g 784536..787271 highly similar to sgd|S0000653 Sacch...    56   2e-08
KLLA0F10791g complement(991642..993279) similar to sp|P26309 Sac...    55   2e-08
CAGL0K09284g 914937..917672 highly similar to sp|P25635 Saccharo...    56   2e-08
KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces c...    55   2e-08
YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that ...    55   2e-08
Kwal_26.8776                                                           55   3e-08
YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and...    55   3e-08
Scas_707.22                                                            55   3e-08
YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation facto...    55   3e-08
KLLA0B01958g join(170646..170663,170896..173550) similar to sp|P...    55   3e-08
Kwal_0.212                                                             54   4e-08
AER280C [2782] [Homologous to ScYML102W (CAC2) - SH] (1148956..1...    55   4e-08
CAGL0A02772g complement(289274..290599) similar to sp|P40968 Sac...    54   5e-08
KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces...    55   5e-08
CAGL0H03729g 342948..343859 highly similar to sp|P41318 Saccharo...    54   5e-08
Kwal_26.7570                                                           52   8e-08
AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH] complement...    54   9e-08
Kwal_27.12239                                                          53   1e-07
KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces c...    53   1e-07
YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-bind...    53   1e-07
Kwal_56.23685                                                          53   2e-07
CAGL0M04081g complement(450572..451939) highly similar to sp|P42...    53   2e-07
KLLA0C16643g complement(1457590..1458498) highly similar to sp|Q...    52   2e-07
Sklu_2114.2 YDR128W, Contig c2114 598-4020 reverse complement          53   2e-07
KLLA0D07546g complement(647984..649927) some similarities with s...    53   2e-07
Sklu_2442.2 YNL006W, Contig c2442 3831-4742                            52   3e-07
Sklu_2416.5 YNL317W, Contig c2416 8692-10071                           52   3e-07
KLLA0F22000g complement(2044973..2047354) similar to sp|P42935 S...    52   4e-07
CAGL0J04818g 455846..457810 highly similar to sp|Q06440 Saccharo...    52   4e-07
Sklu_1645.2 YGL116W, Contig c1645 887-2650 reverse complement          52   4e-07
Scas_585.8                                                             52   4e-07
Kwal_14.1710                                                           52   4e-07
Scas_719.52                                                            52   5e-07
ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH] complement(...    51   5e-07
KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777....    51   6e-07
KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces c...    50   8e-07
Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement         51   9e-07
Scas_603.5                                                             50   1e-06
AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH] (1146710..1...    50   1e-06
Scas_673.11                                                            50   1e-06
ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH] complement(1...    50   2e-06
Sklu_2420.2 YPL151C, Contig c2420 3924-5249                            50   2e-06
KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomy...    50   2e-06
CAGL0C00737g complement(75028..77478) similar to tr|Q05946 Sacch...    50   2e-06
Scas_721.7                                                             49   2e-06
CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces c...    49   3e-06
YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative...    49   3e-06
Kwal_33.15591                                                          49   4e-06
KLLA0E24508g complement(2175775..2176758) similar to sp|P38123 S...    48   5e-06
CAGL0B03575g complement(357525..358784) similar to sp|P39984 Sac...    48   6e-06
Scas_680.11                                                            48   6e-06
CAGL0L03201g complement(366795..368534) some similarities with s...    48   7e-06
KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomy...    48   8e-06
Kwal_33.15475                                                          48   9e-06
Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement       47   9e-06
KLLA0C07425g complement(647673..649007) highly similar to sp|Q12...    47   1e-05
AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -...    47   1e-05
CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces cer...    47   1e-05
CAGL0A00605g complement(67281..69203) similar to sp|P53197 Sacch...    47   1e-05
CAGL0F07337g complement(714870..716735) similar to sp|P26309 Sac...    47   2e-05
Scas_558.3                                                             47   2e-05
Scas_658.1                                                             46   2e-05
KLLA0E03982g 371642..372760 similar to sp|P39108 Saccharomyces c...    46   3e-05
AFL056C [3137] [Homologous to ScYPL183C - SH] (329216..332146) [...    46   3e-05
KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces...    45   4e-05
Scas_469.3                                                             45   4e-05
Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement         45   4e-05
CAGL0K00275g complement(25300..27447) similar to sp|P36037 Sacch...    45   4e-05
Sklu_2317.3 YDR142C, Contig c2317 5804-6910                            45   5e-05
Kwal_56.24163                                                          45   5e-05
CAGL0L06952g complement(780793..781836) highly similar to sp|P40...    44   6e-05
YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of...    45   7e-05
AFL007C [3186] [Homologous to ScYGL003C (CDH1) - SH] (424004..42...    45   7e-05
KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417 S...    44   8e-05
YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein...    44   8e-05
Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement          45   9e-05
YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa sub...    45   9e-05
Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement         44   1e-04
Scas_571.4                                                             44   1e-04
CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces c...    43   1e-04
CAGL0C01441g complement(156930..159947) similar to tr|Q08924 Sac...    44   1e-04
Kwal_27.11126                                                          44   2e-04
Kwal_55.21450                                                          43   2e-04
KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1 ...    43   2e-04
ADR176W [1917] [Homologous to ScYOR269W (PAC1) - SH] complement(...    43   2e-04
Scas_442.2*                                                            43   2e-04
Kwal_47.17567                                                          43   2e-04
YMR116C (ASC1) [4073] chr13 complement(499455..499877,500151..50...    42   3e-04
AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH] complement(...    43   3e-04
CAGL0B01529g 137174..138283 highly similar to sp|P39108 Saccharo...    42   3e-04
Scas_670.21                                                            43   3e-04
Scas_693.36                                                            42   3e-04
Scas_465.4                                                             43   3e-04
Scas_717.68                                                            43   3e-04
YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protei...    42   4e-04
CAGL0L04950g complement(562491..564908) highly similar to sp|Q04...    42   4e-04
Scas_605.18                                                            42   4e-04
YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein t...    42   4e-04
AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH] (1107932.....    42   5e-04
Scas_693.22                                                            42   6e-04
ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH] (128830..13...    41   8e-04
Kwal_26.8975                                                           41   8e-04
CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024 Saccha...    41   9e-04
AGL190W [4122] [Homologous to ScYDR142C (PEX7) - SH] complement(...    41   0.001
Kwal_26.7655                                                           41   0.001
CAGL0J06512g complement(620516..622153) similar to sp|Q04199 Sac...    41   0.001
YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protei...    41   0.001
AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH] complement(...    41   0.001
ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH] complement(...    40   0.001
Kwal_56.23895                                                          40   0.002
YDR128W (YDR128W) [975] chr4 (709543..712989) Protein containing...    40   0.002
AGR242C [4553] [Homologous to ScYIR012W (SQT1) - SH] (1203152..1...    40   0.002
YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein req...    40   0.002
KLLA0E11297g complement(994770..996308) similar to sp|P38262 Sac...    40   0.002
AAL009C [178] [Homologous to ScYNL006W (LST8) - SH] (325785..326...    40   0.002
Kwal_34.15818                                                          40   0.002
KLLA0C07513g complement(656060..657379) similar to sp|P39946 Sac...    40   0.002
KLLA0F19734g 1826828..1830229 similar to sgd|S0002535 Saccharomy...    40   0.002
Scas_718.6*                                                            40   0.003
Sklu_1880.3 YDR364C, Contig c1880 4293-5708                            40   0.003
CAGL0L02761g complement(320826..322085) similar to sp|P18851 Sac...    40   0.003
YGR225W (AMA1) [2174] chr7 (945146..946328,946422..946927) Prote...    40   0.003
ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH] (1158218.....    39   0.003
KLLA0A08822g 772565..774313 similar to sp|P53197 Saccharomyces c...    40   0.003
Scas_720.45                                                            40   0.003
Kwal_33.13515                                                          39   0.003
Scas_660.7*                                                            39   0.003
Kwal_56.23035                                                          39   0.004
YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the...    39   0.004
CAGL0M02277g complement(271836..273119) highly similar to sp|Q12...    39   0.004
YDL195W (SEC31) [678] chr4 (107209..111030) Component (p150) of ...    39   0.004
YGL116W (CDC20) [1869] chr7 (289810..291642) Activator of anapha...    39   0.005
YEL056W (HAT2) [1372] chr5 (47168..48373) Histone acetyltransfer...    39   0.005
CAGL0L09647g 1032740..1034029 highly similar to sp|P35184 Saccha...    39   0.005
CAGL0G00704g 65805..67127 similar to sp|P39706 Saccharomyces cer...    39   0.005
Kwal_56.22345                                                          39   0.006
Kwal_0.356                                                             39   0.006
Sklu_675.1 YMR146C, Contig c675 761-1687                               38   0.006
AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C (...    39   0.006
YAR003W (SWD1) [68] chr1 (155009..156289) Component of SET1 and ...    38   0.007
Scas_711.11                                                            39   0.007
AAL119W [68] [Homologous to ScYFR021W (AUT10) - SH] complement(1...    38   0.007
CAGL0K03861g complement(359448..360989) highly similar to sp|Q04...    38   0.009
YDR142C (PEX7) [987] chr4 complement(740467..741594) Peroxisomal...    38   0.009
Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement         38   0.009
Scas_512.3                                                             38   0.009
Kwal_27.12667                                                          38   0.009
Scas_700.27*                                                           38   0.010
YBR195C (MSI1) [378] chr2 complement(610571..611839) Chromatin a...    38   0.010
Scas_712.34                                                            38   0.010
YMR146C (TIF34) [4102] chr13 complement(557480..558523) Translat...    38   0.010
YMR131C (RRB1) [4088] chr13 complement(533162..534697) Protein i...    38   0.012
YOR272W (YTM1) [5058] chr15 (832810..834192) Microtubule-associa...    37   0.013
Kwal_26.8628                                                           37   0.014
Kwal_47.17827                                                          37   0.014
Kwal_27.9840                                                           37   0.014
CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces c...    37   0.015
AGR367C [4678] [Homologous to ScYDR324C - SH] (1408366..1410681)...    37   0.016
Kwal_47.17572                                                          37   0.017
Kwal_14.884                                                            37   0.018
Sklu_2291.4 YPL183C, Contig c2291 6003-8996 reverse complement         37   0.019
Sklu_2139.2 YFR021W, Contig c2139 1540-3165 reverse complement         37   0.019
ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH] complement...    37   0.019
CAGL0B00748g 65727..68165 similar to sp|P25569 Saccharomyces cer...    37   0.020
YMR049C (ERB1) [4011] chr13 complement(368093..370516) Protein w...    37   0.020
Sklu_2382.2 YDL195W, Contig c2382 2146-5931 reverse complement         37   0.021
KLLA0B14410g 1264616..1266736 similar to sp|P36037 Saccharomyces...    37   0.022
Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement      37   0.024
YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in...    37   0.025
Kwal_33.15136                                                          36   0.029
CAGL0J03564g 338044..341133 similar to sp|P25365 Saccharomyces c...    36   0.036
Scas_684.7                                                             36   0.036
Scas_692.29                                                            36   0.037
KLLA0F21406g complement(1996260..1998377) similar to sp|P47025 S...    36   0.042
Scas_607.8                                                             36   0.046
KLLA0F15598g 1439610..1441046 highly similar to sp|P33750 Saccha...    35   0.054
AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516...    35   0.057
KLLA0F26653g 2461876..2464251 similar to sp|Q04660 Saccharomyces...    35   0.057
Scas_692.25                                                            35   0.059
CAGL0K10692g 1039413..1040930 similar to sp|P43601 Saccharomyces...    35   0.061
ABR101C [693] [Homologous to ScYMR049C (ERB1) - SH] (567357..569...    35   0.061
Sklu_2364.5 YAR003W, Contig c2364 9220-10515 reverse complement        35   0.067
Sklu_2435.13 YPR137W, Contig c2435 18346-20073                         35   0.074
YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in...    35   0.077
ADR090W [1831] [Homologous to ScYDL195W (SEC31) - SH] complement...    35   0.085
AER439W [2939] [Homologous to ScYGL213C (SKI8) - SH] complement(...    35   0.088
KLLA0D04664g 397818..399320 similar to sp|P43601 Saccharomyces c...    35   0.096
CAGL0D02090g join(214357..214893,215564..215860) highly similar ...    34   0.098
YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component o...    35   0.10 
AAR102C [288] [Homologous to ScYPR137W (RRP9) - SH] (526057..527...    35   0.10 
CAGL0J11286g 1095788..1097374 similar to sp|P53877 Saccharomyces...    35   0.11 
YFR021W (ATG18) [1701] chr6 (194800..196302) Protein that plays ...    34   0.13 
YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in t...    34   0.14 
Kwal_23.6290                                                           34   0.14 
Sklu_2233.2 YMR049C, Contig c2233 5630-8059 reverse complement         34   0.14 
CAGL0J07854g complement(765463..766761) similar to sp|P53851 Sac...    34   0.14 
Kwal_56.24478                                                          34   0.15 
Scas_649.10                                                            34   0.15 
Kwal_55.21144                                                          34   0.18 
Sklu_1048.1 YIR012W, Contig c1048 895-2196                             34   0.18 
KLLA0D15873g 1334131..1335426 similar to sp|P35184 Saccharomyces...    33   0.20 
ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH] complement...    33   0.22 
Scas_705.2                                                             33   0.28 
CAGL0B02013g 184252..187614 highly similar to tr|Q03897 Saccharo...    33   0.29 
YPR137W (RRP9) [5555] chr16 (802353..804074) Protein component o...    33   0.30 
Scas_715.22                                                            33   0.30 
Scas_657.13                                                            33   0.34 
AGR067W [4377] [Homologous to ScYDR128W - SH] complement(842182....    33   0.35 
KLLA0D13222g complement(1132067..1134277) similar to sgd|S000273...    33   0.36 
Kwal_33.14971                                                          33   0.37 
Kwal_27.12586                                                          33   0.37 
CAGL0K07095g 698028..699143 highly similar to sp|P38328 Saccharo...    33   0.38 
ABL024W [568] [Homologous to ScYMR102C - SH; ScYKL121W - SH] com...    33   0.38 
Scas_719.7*                                                            33   0.38 
CAGL0G03399g complement(325879..326988) highly similar to sp|P40...    33   0.38 
YBR234C (ARC40) [413] chr2 complement(685395..686549) Component ...    33   0.39 
Sklu_2430.9 YMR102C, Contig c2430 15497-18397                          33   0.45 
KLLA0E20779g complement(1841092..1842207) similar to sp|P40066 S...    32   0.45 
YMR093W (UTP15) [4051] chr13 (454014..455555) Protein component ...    33   0.46 
KLLA0C08723g 762625..765501 gi|7578634|gb|AAF64114.1|AF216585_1 ...    33   0.48 
KLLA0B11077g complement(970761..972464) similar to sgd|S0006341 ...    32   0.50 
KLLA0D00814g complement(76687..77913) similar to sp|P39984 Sacch...    32   0.51 
KLLA0F07403g 697593..698636 similar to sp|P40217 Saccharomyces c...    32   0.58 
KLLA0F13772g 1276532..1278094 highly similar to sp|Q04305 Saccha...    32   0.60 
CAGL0I07073g complement(681102..682283) similar to sp|Q02793 Sac...    32   0.62 
Sklu_1659.2 YMR092C, Contig c1659 410-2251                             32   0.62 
AFL022W [3171] [Homologous to ScYBR234C (ARC40) - SH] complement...    32   0.67 
KLLA0A08800g 770989..772308 similar to sp|P39706 Saccharomyces c...    32   0.67 
YML102W (CAC2) [3869] chr13 (68294..69700) Chromatin assembly co...    32   0.79 
Sklu_2371.4 YDR030C, Contig c2371 8070-9506 reverse complement         32   0.79 
Scas_660.8                                                             32   0.80 
Sklu_2133.4 YBR234C, Contig c2133 6409-7530                            32   0.85 
CAGL0A00561g complement(63710..64948) similar to sp|P53196 Sacch...    32   0.90 
CAGL0J03806g 361174..362436 similar to sp|Q12363 Saccharomyces c...    32   0.92 
Scas_677.32                                                            32   0.93 
YGL004C (RPN14) [1968] chr7 complement(490705..491958) Protein c...    31   1.1  
Kwal_26.8953                                                           31   1.1  
YER066W (YER066W) [1497] chr5 (290240..290797) Protein containin...    30   1.2  
Sklu_2226.6 YNL035C, Contig c2226 6858-8054 reverse complement         31   1.3  
KLLA0F13750g complement(1274110..1275972) similar to sp|P46680 S...    31   1.3  
AFL006C [3187] [Homologous to ScYAR003W (SWD1) - SH] (425925..42...    31   1.4  
Sklu_2167.5 YGL213C, Contig c2167 8275-9186                            31   1.5  
Kwal_0.49                                                              31   1.5  
KLLA0E15972g 1419922..1420941 weakly similar to sp|P50079 Saccha...    31   1.6  
Kwal_47.17555                                                          31   1.7  
Scas_642.1                                                             31   1.8  
Kwal_27.10785                                                          30   1.8  
CAGL0K03377g complement(306529..309465) similar to sp|Q03177 Sac...    31   1.9  
AEL153W [2353] [Homologous to ScYJL069C - SH] complement(343247....    30   2.0  
AFL009C [3184] [Homologous to ScYGL004C - SH] (420007..421248) [...    30   2.1  
Scas_659.9                                                             30   2.1  
Scas_701.45                                                            30   2.2  
YOR038C (HIR2) [4850] chr15 complement(402760..405387) Histone t...    30   2.2  
CAGL0J08998g 882655..886500 highly similar to sp|P38968 Saccharo...    30   2.2  
ABL044C [548] [Homologous to ScYMR093W - SH] (312378..313934) [1...    30   2.4  
Kwal_0.40                                                              30   2.5  
CAGL0J03344g complement(322226..323857) highly similar to sp|P40...    30   2.6  
Kwal_26.8700                                                           30   2.8  
CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces...    30   2.8  
YGR223C (HSV2) [2172] chr7 complement(940870..942216) Protein of...    30   2.9  
AER323W [2824] [Homologous to ScYDR443C (SSN2) - SH] complement(...    30   3.0  
Kwal_27.12070                                                          30   3.1  
KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces c...    30   3.4  
ACL034W [1015] [Homologous to ScYER082C (KRE31) - SH] complement...    30   3.4  
ADR242C [1983] [Homologous to ScYMR131C (RRB1) - SH] (1126443..1...    30   3.5  
CAGL0J01287g 120215..122047 similar to sp|P46680 Saccharomyces c...    30   3.5  
KLLA0C09262g 805512..807188 similar to sp|P40055 Saccharomyces c...    30   3.6  
Kwal_14.1675                                                           30   3.8  
KLLA0F10615g 978492..979604 similar to sp|P38328 Saccharomyces c...    29   4.5  
AEL154C [2352] [Homologous to ScYBR281C - SH] (339962..342628) [...    30   4.5  
AFR634W [3826] [Homologous to ScYNL253W - SH] complement(1593772...    29   4.6  
Kwal_26.7738                                                           29   4.9  
Scas_652.7                                                             29   5.4  
YDL156W (YDL156W) [714] chr4 (174919..176487) Protein containing...    29   5.6  
CAGL0J03960g complement(373177..374484) similar to sp|Q12206 Sac...    29   5.6  
Scas_585.6                                                             28   6.5  
Scas_397.2                                                             29   6.7  
YMR092C (AIP1) [4050] chr13 complement(451631..453478) Actin int...    29   7.2  
ADL186C [1555] [Homologous to ScYOL138C - SH] (369322..373407) [...    29   7.6  
CAGL0D04884g 475678..477369 highly similar to tr|Q06506 Saccharo...    29   7.6  
KLLA0F05159g 506007..509702 similar to sp|P38968 Saccharomyces c...    29   7.9  
Scas_670.22                                                            28   8.9  
Sklu_2332.7 YER107C, Contig c2332 14211-15314 reverse complement       28   9.1  
CAGL0E01485g complement(138830..142840) similar to tr|Q08281 Sac...    28   9.7  

>CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces
           cerevisiae YDR267c, start by similarity
          Length = 337

 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/332 (100%), Positives = 332/332 (100%)

Query: 1   MPLQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKK 60
           MPLQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKK
Sbjct: 1   MPLQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKK 60

Query: 61  AVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWS 120
           AVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWS
Sbjct: 61  AVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWS 120

Query: 121 QDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDT 180
           QDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDT
Sbjct: 121 QDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDT 180

Query: 181 VRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQ 240
           VRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQ
Sbjct: 181 VRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQ 240

Query: 241 QEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYKEKQNDSEVSEWEISATYKA 300
           QEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYKEKQNDSEVSEWEISATYKA
Sbjct: 241 QEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYKEKQNDSEVSEWEISATYKA 300

Query: 301 AHTVYEINTVKWVNIDGKEMLITAGDDGRVNL 332
           AHTVYEINTVKWVNIDGKEMLITAGDDGRVNL
Sbjct: 301 AHTVYEINTVKWVNIDGKEMLITAGDDGRVNL 332

>Scas_615.11
          Length = 349

 Score =  457 bits (1176), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 234/346 (67%), Positives = 273/346 (78%), Gaps = 16/346 (4%)

Query: 1   MPLQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKN---GKENLLDVLDDTV 57
           M ++LAKSLKL NDK+WS+D+    GLLATGSTDR IK++ + N   G+ +L+DVLDDTV
Sbjct: 1   MGIKLAKSLKLQNDKLWSLDYS--HGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTV 58

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGA---------KLEMELLAIIE 108
           HKKA+R VAWRPHS+LLAAGSFDST+SIWT+ D   EE            LEM+LLAIIE
Sbjct: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTREDDLEEEEDDDEGEGTTNSLEMDLLAIIE 118

Query: 109 GHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTK 168
           GHENEVKGI+WS DG LL++CSRDKSVWIWETD+ GEEYECISVLQEHSQDVKHVVWH +
Sbjct: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPE 178

Query: 169 HNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEED--PIRLCSGSDDST 226
             LLASSSYDDT+R+WKDYDDDWECAAVL GHEGT+WCSDF K ++   IRLCSGSDDST
Sbjct: 179 LPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDST 238

Query: 227 VRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYKEKQND 286
           VRVW+YI DDED QQEW+CE+ LP  H  QIY V+WS +G IAS G+DG LAVYKE  N 
Sbjct: 239 VRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDGTLAVYKEVSNG 298

Query: 287 SEVSEWEISATYKAAHTVYEINTVKWVNIDGKEMLITAGDDGRVNL 332
            +  +WE+ A  +  H VYE N VKW++I+G  ML T GDDG VNL
Sbjct: 299 DDEHDWEVIAKQELCHGVYEANIVKWIDINGNMMLATGGDDGCVNL 344

>YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Protein
           containing seven WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to WD40 protein Ciao1 (human CIAO1), which
           binds and inhibits Wilms tumor suppressor protein (human
           WT1) transactivation activity [993 bp, 330 aa]
          Length = 330

 Score =  456 bits (1173), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 227/333 (68%), Positives = 261/333 (78%), Gaps = 14/333 (4%)

Query: 2   PLQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKA 61
            + L KSLKL+ +K+WS DF   +G+LATGSTDR IK++ +K     L+DVLD+T HKKA
Sbjct: 3   SINLIKSLKLYKEKIWSFDFS--QGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKA 60

Query: 62  VRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGA--KLEMELLAIIEGHENEVKGISW 119
           +RSVAWRPH+ LLAAGSFDST+SIW +     EE A    EM+LLAIIEGHENEVKG++W
Sbjct: 61  IRSVAWRPHTSLLAAGSFDSTVSIWAK-----EESADRTFEMDLLAIIEGHENEVKGVAW 115

Query: 120 SQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDD 179
           S DG  LATCSRDKSVWIWETDE+GEEYECISVLQEHSQDVKHV+WH    LLASSSYDD
Sbjct: 116 SNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDD 175

Query: 180 TVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDD 239
           TVRIWKDYDDDWEC AVL GHEGT+W SDF K E   RLCSGSDDSTVRVWKY+GDDEDD
Sbjct: 176 TVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDD 235

Query: 240 QQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYKEKQNDSEVSEWEISATYK 299
           QQEWVCE+ LP+ H+ Q+Y VAW  +G IASVGADGVLAVY+E        EW++ A   
Sbjct: 236 QQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLAVYEEVDG-----EWKVFAKRA 290

Query: 300 AAHTVYEINTVKWVNIDGKEMLITAGDDGRVNL 332
             H VYEIN VKW+ ++GK +L T GDDG VN 
Sbjct: 291 LCHGVYEINVVKWLELNGKTILATGGDDGIVNF 323

>ACR091W [1138] [Homologous to ScYDR267C - SH]
           complement(520609..521595) [987 bp, 328 aa]
          Length = 328

 Score =  411 bits (1056), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 210/334 (62%), Positives = 251/334 (75%), Gaps = 14/334 (4%)

Query: 1   MP-LQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHK 59
           MP L L +SLKLH D+ WS+D    +GLLATGS DR IK++ ++N K  L++ LDDT HK
Sbjct: 1   MPNLHLVRSLKLHGDRCWSVDIS--KGLLATGSADRKIKLVDVRNFK--LVEELDDTAHK 56

Query: 60  KAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISW 119
           KAVRSVAWRPH ++LAAGSFD+T+SIW + D D       E ELLA+IEGHENEVK ++W
Sbjct: 57  KAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSG----ETELLAVIEGHENEVKSVAW 112

Query: 120 SQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDD 179
           S DG  LATCSRDKSVWIWE DE  EE+EC SVLQEHSQDVKH+VWH    LLASSSYDD
Sbjct: 113 SHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDD 172

Query: 180 TVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDED- 238
           TVRIW + DDDWECAAVL+GH GT+WCSDF + E  IRLCSGSDD+TVR+W+ + DD D 
Sbjct: 173 TVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADV 232

Query: 239 DQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYKEKQNDSEVSEWEISATY 298
             +EW+ E+ LP  H   +Y V+WS  G IASVG+DGVLAVYKE Q       WE+ A  
Sbjct: 233 FDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGSDGVLAVYKEVQ----AGRWEVVARV 288

Query: 299 KAAHTVYEINTVKWVNIDGKEMLITAGDDGRVNL 332
             AHTVYEIN VKW+ +DG+ +L+T GDDG VN+
Sbjct: 289 DCAHTVYEINVVKWLALDGRVLLVTGGDDGCVNV 322

>KLLA0E21879g complement(1944865..1945866) similar to sgd|S0002675
           Saccharomyces cerevisiae YDR267c, start by similarity
          Length = 333

 Score =  397 bits (1020), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 203/332 (61%), Positives = 245/332 (73%), Gaps = 10/332 (3%)

Query: 3   LQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAV 62
           L+L KSL LH+DK WS+D     G++ATGSTDR IK++ +++ +  +++ LDDT HKK V
Sbjct: 4   LKLLKSLALHDDKCWSVDVNN-GGIMATGSTDRKIKLVDIRSFQ--IIEELDDTAHKKTV 60

Query: 63  RSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQD 122
           RSVAWRPHS++LAAGSFDST+SIW + D    +   LE ELLAIIEGHENE+K ++WS D
Sbjct: 61  RSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHD 120

Query: 123 GCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVR 182
           G LLATCSRDKSVWIWE DE GEE+ECISVLQEHSQDVKHV+WH    LLASSSYDDTVR
Sbjct: 121 GELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVR 180

Query: 183 IWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQE 242
           IWKD DDDWEC AVL GHEGT+W SDF K    +RLCSGSDD TVR+W    D+ + +QE
Sbjct: 181 IWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQE 240

Query: 243 WVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYKEKQNDSEVSEWEISATYKAAH 302
           W+ ES LP AH   +Y V WSP G IAS G+DG L +YKE ++      W +   ++  H
Sbjct: 241 WIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDG-----WIVECIHELTH 295

Query: 303 TVYEINTVKWVNIDGKE--MLITAGDDGRVNL 332
            VYE N VKWV    K+  +LITAGDDG VN+
Sbjct: 296 GVYETNMVKWVEYGSKDVILLITAGDDGHVNV 327

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 69/144 (47%), Gaps = 16/144 (11%)

Query: 9   LKLHNDKVWSIDFEPVRG--LLATGSTDRAIKV--LQLKNG---KENLLDVLDDTVHKKA 61
           L  H   VWS DFE       L +GS D  +++  L+  NG   +E + + +    H +A
Sbjct: 195 LNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRA 254

Query: 62  VRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEG--HENEVKGISW 119
           V SV W P   + + GS D  + I+ +S    E+G  +E  +  +  G    N VK + +
Sbjct: 255 VYSVNWSPKGYIASTGS-DGRLVIYKES----EDGWIVEC-IHELTHGVYETNMVKWVEY 308

Query: 120 -SQDGCLLATCSRDKSVWIWETDE 142
            S+D  LL T   D  V +W+ DE
Sbjct: 309 GSKDVILLITAGDDGHVNVWKFDE 332

>Kwal_55.21559
          Length = 351

 Score =  386 bits (992), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 192/321 (59%), Positives = 238/321 (74%), Gaps = 6/321 (1%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHS 71
           H DK+WSID    +GL+AT S+DR IK++ LKN    L++ LDD+ HKK+VRSV++RPHS
Sbjct: 32  HTDKLWSIDCS--KGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHS 89

Query: 72  DLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSR 131
            +LAAGSFDSTISIW + +    +    E ELLAIIEGHENEVK +SWS  G  LA+CSR
Sbjct: 90  SILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSR 149

Query: 132 DKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDW 191
           DKSVWIWE DE GEEYEC+SVLQEH+QDVKHVVWH++ +LLASSSYDDT+R+WK+  DDW
Sbjct: 150 DKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDW 209

Query: 192 ECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPN 251
           ECAAVL GH+GT+WCSDF K E  +RL S SDDSTVRVW Y+ ++E+ +  W  E+ LPN
Sbjct: 210 ECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPN 269

Query: 252 AHRSQIYGVAWSPSGRIASVGADGVLAVYKEKQNDSEVSEWEISATYKAAHTVYEINTVK 311
            H   +Y V+WS  G IASVG+DG+L VYKE +      EWE+      AH +YEIN VK
Sbjct: 270 VHSRAVYSVSWSLDGYIASVGSDGLLVVYKEVKK----GEWEVVVQQHEAHGIYEINVVK 325

Query: 312 WVNIDGKEMLITAGDDGRVNL 332
           W  +D   +L+T GDDG  N+
Sbjct: 326 WATVDDSVLLLTGGDDGCANI 346

>Sklu_1710.1 YDR267C, Contig c1710 17-739
          Length = 240

 Score =  327 bits (837), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 160/236 (67%), Positives = 193/236 (81%), Gaps = 4/236 (1%)

Query: 97  AKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEH 156
           +++E ELLAI+EGHENEVK +SWS  G  LATCSRDKSVWIWE DE GEE+ECISVLQEH
Sbjct: 5   SEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEH 64

Query: 157 SQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPI 216
           SQDVKHVVWH+  +LLASSSYDDT+RIWKD+DDDW+CAAVL GHEGT+WCSDF K E  +
Sbjct: 65  SQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSL 124

Query: 217 RLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGV 276
           RLCSGSDD+TVR+WKYI D+EDD+Q W  +S LP+AH   +Y V+WSP+G IAS G+DG+
Sbjct: 125 RLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSDGL 184

Query: 277 LAVYKEKQNDSEVSEWEISATYKAAHTVYEINTVKWVNIDGKEMLITAGDDGRVNL 332
           LA+Y+EK    E  +WEI A ++ AH VYE N VKW  IDG+ +L+T GDDG VN+
Sbjct: 185 LAIYQEK----EEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNI 236

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 66/243 (27%), Positives = 110/243 (45%), Gaps = 23/243 (9%)

Query: 1   MPLQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENL--LDVLDDTVH 58
           M  +L   ++ H ++V S+ +      LAT S D+++ + +     E    + VL +  H
Sbjct: 7   METELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQE--H 64

Query: 59  KKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEV--KG 116
            + V+ V W     LLA+ S+D TI IW   D D         +  A++ GHE  V    
Sbjct: 65  SQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDD--------WQCAAVLNGHEGTVWCSD 116

Query: 117 ISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQE-----HSQDVKHVVWHTKHNL 171
              S+    L + S D +V IW+  E  E+ E +  LQ      HS+ V  V W +   L
Sbjct: 117 FEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSW-SPTGL 175

Query: 172 LASSSYDDTVRIWKDYDD-DWECAAVLTGHEGTIWCS--DFSKEEDPIRLCSGSDDSTVR 228
           +AS+  D  + I+++ ++  WE  A      G    +   +++ +    L +G DD  V 
Sbjct: 176 IASTGSDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVN 235

Query: 229 VWK 231
           +WK
Sbjct: 236 IWK 238

>Kwal_23.5351
          Length = 474

 Score = 86.7 bits (213), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 76/262 (29%), Positives = 112/262 (42%), Gaps = 35/262 (13%)

Query: 56  TVHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEG-HENEV 114
            V  + V  VA  P    LAAGS++  + I     L          E++  ++G H++++
Sbjct: 179 VVFSRPVSQVARSPDGASLAAGSWNGDVKILHPQSL----------EVVRSLDGAHDDKI 228

Query: 115 KGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLAS 174
            G++WS D  LLAT   D  V IW             VL+ H   V  V +H     +AS
Sbjct: 229 GGVAWSSDSQLLATGGADNLVKIWNPQAQSHSEASRVVLRGHEARVSKVKFHPSDRFVAS 288

Query: 175 SSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIG 234
           +S+D T R+W D + + E   +  GH   ++C DF  + D   LCS   DS   VW    
Sbjct: 289 ASFDMTWRLW-DVERETEL-QLQEGHAKEVYCLDF--QCDGSLLCSAGLDSVGHVW---- 340

Query: 235 DDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYKEKQNDSEVSEWEI 294
           D    +   V E      H   IYGV+WSP+G   + G+            D  V  W+I
Sbjct: 341 DMRTGRSLMVLE-----GHAKPIYGVSWSPNGHHVATGS-----------GDGTVQVWDI 384

Query: 295 SATYKAAHTVYEINTVKWVNID 316
               K +  +   + V  VN +
Sbjct: 385 RKANKPSSILAHNSIVSEVNFE 406

 Score = 72.4 bits (176), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 72/264 (27%), Positives = 117/264 (44%), Gaps = 46/264 (17%)

Query: 3   LQLAKSL-KLHNDKVWSIDFEPVRGLLATGSTDRAIKV--LQLKNGKENLLDVLDDTVHK 59
           L++ +SL   H+DK+  + +     LLATG  D  +K+   Q ++  E    VL    H+
Sbjct: 214 LEVVRSLDGAHDDKIGGVAWSSDSQLLATGGADNLVKIWNPQAQSHSEASRVVLRG--HE 271

Query: 60  KAVRSVAWRPHSDLLAAGSFDSTISIW---TQSDLDLEEGAKLEM--------------- 101
             V  V + P    +A+ SFD T  +W    +++L L+EG   E+               
Sbjct: 272 ARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQLQEGHAKEVYCLDFQCDGSLLCSA 331

Query: 102 --------------ELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEY 147
                           L ++EGH   + G+SWS +G  +AT S D +V +W+  +A +  
Sbjct: 332 GLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGSGDGTVQVWDIRKANKPS 391

Query: 148 ECISVLQEHSQDVKHVVWHTKH-NLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWC 206
             ++    H+  V  V +  ++ N L SSSYD T+ ++      W   A L GH   I  
Sbjct: 392 SILA----HNSIVSEVNFEKENGNFLVSSSYDRTIGVFA--TGSWIKLASLQGHTDKILS 445

Query: 207 SDFSKEEDPIRLCSGSDDSTVRVW 230
            D S+      L S   D +V++W
Sbjct: 446 VDISR--GGANLWSSGWDRSVKIW 467

 Score = 54.7 bits (130), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 51/205 (24%), Positives = 90/205 (43%), Gaps = 21/205 (10%)

Query: 28  LATGSTDRAIKVLQLKNGKENLLDVLD--DTVHKKAVRSVAWRPHSDLLAAGSFDSTISI 85
           LA GS +  +K+L  ++     L+V+   D  H   +  VAW   S LLA G  D+ + I
Sbjct: 197 LAAGSWNGDVKILHPQS-----LEVVRSLDGAHDDKIGGVAWSSDSQLLATGGADNLVKI 251

Query: 86  WTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGE 145
           W        E +++      ++ GHE  V  + +      +A+ S D +  +W+ +   E
Sbjct: 252 WNPQAQSHSEASRV------VLRGHEARVSKVKFHPSDRFVASASFDMTWRLWDVERETE 305

Query: 146 EYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIW 205
               + + + H+++V  + +    +LL S+  D    +W           VL GH   I+
Sbjct: 306 ----LQLQEGHAKEVYCLDFQCDGSLLCSAGLDSVGHVWDMRTG--RSLMVLEGHAKPIY 359

Query: 206 CSDFSKEEDPIRLCSGSDDSTVRVW 230
              +S     +   +GS D TV+VW
Sbjct: 360 GVSWSPNGHHV--ATGSGDGTVQVW 382

>Scas_679.28
          Length = 815

 Score = 75.1 bits (183), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 53/184 (28%), Positives = 85/184 (46%), Gaps = 18/184 (9%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGI 117
           H+K + ++A  P+  + A  S+D T  IW     DLE G     EL A +  H+  +  +
Sbjct: 490 HEKDINALAISPNDSIFATASYDKTCKIW-----DLENG-----ELTATLSNHKRGLWDV 539

Query: 118 SWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSY 177
           ++ Q   L+ATCS DK++ IW  D     +  +  L+ H+  V+  ++  K   L SS  
Sbjct: 540 AFCQYDKLIATCSGDKTIKIWSLD----TFSVMKTLEGHTNAVQRCMFINKQLQLVSSGA 595

Query: 178 DDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDE 237
           D  ++IW     D  C   L GH+  IW    ++  D   + S   D   + WK   + E
Sbjct: 596 DGLIKIWDCSTGD--CLKTLDGHDNRIWA--LTEINDGDMIVSADADGVFQFWKDCTELE 651

Query: 238 DDQQ 241
            +Q 
Sbjct: 652 KEQN 655

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 56/122 (45%), Gaps = 9/122 (7%)

Query: 69  PHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLAT 128
           P+ D LA  +   T+ I      + EE   + +E+    EGHE+ +  +  + DG  +AT
Sbjct: 348 PNHDKLALATNSPTLRIIPVPSSEQEE-LPINVEMY---EGHEDLLNSLDTTDDGLWMAT 403

Query: 129 CSRDKSVWIWETDEAGEEYECISVLQEHSQDV-----KHVVWHTKHNLLASSSYDDTVRI 183
            S+D +  +W+ +    +++       HS  V      +V+       L ++S D T++ 
Sbjct: 404 ASKDHTAIVWKYNSIINKFQPYVKFIGHSATVTAVGLPNVMLRGYPEFLLTASNDLTIKK 463

Query: 184 WK 185
           WK
Sbjct: 464 WK 465

 Score = 34.7 bits (78), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 57/136 (41%), Gaps = 14/136 (10%)

Query: 4   QLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVR 63
           +L  +L  H   +W + F     L+AT S D+ IK+  L     +++  L+   H  AV+
Sbjct: 524 ELTATLSNHKRGLWDVAFCQYDKLIATCSGDKTIKIWSLDTF--SVMKTLEG--HTNAVQ 579

Query: 64  SVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDG 123
              +      L +   D  I IW     D   G     + L  ++GH+N +  ++   DG
Sbjct: 580 RCMFINKQLQLVSSGADGLIKIW-----DCSTG-----DCLKTLDGHDNRIWALTEINDG 629

Query: 124 CLLATCSRDKSVWIWE 139
            ++ +   D     W+
Sbjct: 630 DMIVSADADGVFQFWK 645

 Score = 28.9 bits (63), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 38/181 (20%), Positives = 77/181 (42%), Gaps = 8/181 (4%)

Query: 59  KKAVRSVAWRP---HSDLLAAGSFDSTI-SIWTQSDLDLEEGAKLEMELLAIIEGHENEV 114
           K + +S   RP    S  +A  S D T+ +     D+++      +  L +I    E E+
Sbjct: 4   KTSYQSTTLRPIYAGSSAIATVSADGTVLATPILDDIEIISLTTPQRRLHSIANDDEQEI 63

Query: 115 KGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLAS 174
             +  + D   L+  S+++ + I++ D+  ++   I    + S     +   +   L+A 
Sbjct: 64  TALKLTPDAQYLSFISQNQLLKIFKLDQEKKDQGKIIRSMKMSSPCYIMDCDSTSTLVAL 123

Query: 175 SSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPI--RLCSGSDDSTVRVWKY 232
              D ++ +  D ++ +   + L GH  TI    F  + +     LCSG  +  V+VW  
Sbjct: 124 GGTDGSITVV-DIENGFITHS-LKGHGATISALKFFGQANSNVWLLCSGDTNGMVKVWDL 181

Query: 233 I 233
           +
Sbjct: 182 V 182

>ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH]
           (843171..846785) [3615 bp, 1204 aa]
          Length = 1204

 Score = 73.9 bits (180), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 52/175 (29%), Positives = 79/175 (45%), Gaps = 24/175 (13%)

Query: 63  RSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQD 122
           +++A+ P    +    F STI +W     D   G      LL   E HE  V+G+ +   
Sbjct: 15  KAIAFHPSRPWVLVALFSSTIQLW-----DYRMGV-----LLHRFEEHEGPVRGVDFHPT 64

Query: 123 GCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVR 182
             L  +   D S+ +W        ++C+  L  H   V+ V +HT+   + S+S D T+R
Sbjct: 65  QPLFVSAGDDYSIKVWSL----STHKCLFTLNGHLDYVRTVFFHTELPWIISASDDQTIR 120

Query: 183 IWKDYDDDWEC---AAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIG 234
           IW     +W+     A LTGH   + C+ F   ED +   S S D TVR+W   G
Sbjct: 121 IW-----NWQNRREIACLTGHNHFVMCAQFHPTEDLV--VSASLDETVRIWDISG 168

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 83/199 (41%), Gaps = 30/199 (15%)

Query: 8   SLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAW 67
           +L  H D V ++ F      + + S D+ I++   +N +E    +   T H   V    +
Sbjct: 90  TLNGHLDYVRTVFFHTELPWIISASDDQTIRIWNWQNRRE----IACLTGHNHFVMCAQF 145

Query: 68  RPHSDLLAAGSFDSTISIWTQSDL----------DLEEGAKLEMELL----------AII 107
            P  DL+ + S D T+ IW  S L            EE    +  L            I+
Sbjct: 146 HPTEDLVVSASLDETVRIWDISGLRKRHSAPGSQSFEEQMITQQNLFDGGFGDCVVKFIL 205

Query: 108 EGHENEVKGISWSQDGCLLATCSRDKSVWIWE--TDEAGEEYECISVLQEHSQDVKHVVW 165
           EGH   V   S+     L+ + S D+ V +W   + +A E   C    + H+ +V  V++
Sbjct: 206 EGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSSTKAWEVDTC----RGHTNNVDSVIF 261

Query: 166 HTKHNLLASSSYDDTVRIW 184
           H   NL+ S   D T+R+W
Sbjct: 262 HPFQNLIISVGEDSTIRVW 280

 Score = 35.0 bits (79), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 5/72 (6%)

Query: 21  FEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHSDLLAAGSFD 80
           F P   L+ +GS DR +K+ ++ + K   +D      H   V SV + P  +L+ +   D
Sbjct: 217 FHPTLPLIVSGSDDRQVKLWRMSSTKAWEVDTCRG--HTNNVDSVIFHPFQNLIISVGED 274

Query: 81  STISIWTQSDLD 92
           STI +W   DLD
Sbjct: 275 STIRVW---DLD 283

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 32/157 (20%), Positives = 59/157 (37%), Gaps = 34/157 (21%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKV-----LQLKNG-------------KENLLDV- 52
           HN  V    F P   L+ + S D  +++     L+ ++              ++NL D  
Sbjct: 136 HNHFVMCAQFHPTEDLVVSASLDETVRIWDISGLRKRHSAPGSQSFEEQMITQQNLFDGG 195

Query: 53  LDDTV-------HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLA 105
             D V       H + V   ++ P   L+ +GS D  + +W  S     E        + 
Sbjct: 196 FGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSSTKAWE--------VD 247

Query: 106 IIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDE 142
              GH N V  + +     L+ +   D ++ +W+ D+
Sbjct: 248 TCRGHTNNVDSVIFHPFQNLIISVGEDSTIRVWDLDK 284

>AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH]
           (134760..136127) [1368 bp, 455 aa]
          Length = 455

 Score = 72.4 bits (176), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 67/233 (28%), Positives = 104/233 (44%), Gaps = 43/233 (18%)

Query: 9   LKLHNDKVWSIDFEPVRGLLATGSTD---------RAIKVLQLKNGKENLLDVLDDTVHK 59
           L+ H  +V  +   P   L A+ S D         R ++ LQL+ G            H 
Sbjct: 252 LRGHAGRVSRVKVHPSGRLAASASFDLTWILWDLERKVE-LQLQEG------------HS 298

Query: 60  KAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISW 119
           KAV ++A++    LLA+   D+  +IW     DL  G     E +  +EGH   + G+ W
Sbjct: 299 KAVYTIAFQSDGALLASAGLDAVCAIW-----DLRSG-----EPIMKLEGHAGAISGVDW 348

Query: 120 SQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHN--LLASSSY 177
           S +G  LAT   D +V +W+    G E   ++  Q  + DVK      K+N   L S  +
Sbjct: 349 SPNGYQLATAGADGTVRVWDIRNVGTESALLA-HQVAALDVK----FKKNNGTFLVSCGH 403

Query: 178 DDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
           D  V I+    D+W+  A L GH   ++  D +  ED   + SG  D +++ W
Sbjct: 404 DRLVNIFN--ADNWQKLASLEGHTDRVFTVDIT--EDGSTIYSGGKDRSLKQW 452

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 73/278 (26%), Positives = 117/278 (42%), Gaps = 40/278 (14%)

Query: 57  VHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKG 116
           V  K V  VA       LA G +  +I + +   L + +         +I   HE ++ G
Sbjct: 170 VADKHVSQVAVHRDGQQLATGCWGGSIKVVSCETLGIAK---------SIDAAHEGKIGG 220

Query: 117 ISWSQDGCLLATCSRDKSVWIWE-TDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASS 175
           + W  DG  L +   D  V +W+ T  + EE      L+ H+  V  V  H    L AS+
Sbjct: 221 LDWHPDGNHLLSGGGDNLVKLWDMTSNSFEE------LRGHAGRVSRVKVHPSGRLAASA 274

Query: 176 SYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGD 235
           S+D T  +W D +   E   +  GH   ++   F  + D   L S   D+   +W     
Sbjct: 275 SFDLTWILW-DLERKVELQ-LQEGHSKAVYTIAF--QSDGALLASAGLDAVCAIWDLRSG 330

Query: 236 DEDDQQEWVCESTLPNAHRSQIYGVAWSPSG-RIASVGADGVLAVYKEKQNDSEVSEWEI 294
           +   + E          H   I GV WSP+G ++A+ GADG + V+  +   +E      
Sbjct: 331 EPIMKLE---------GHAGAISGVDWSPNGYQLATAGADGTVRVWDIRNVGTE------ 375

Query: 295 SATYKAAHTVYEINTVKWVNIDGKEMLITAGDDGRVNL 332
             +   AH V  ++ VK+   +G   L++ G D  VN+
Sbjct: 376 --SALLAHQVAALD-VKFKKNNGT-FLVSCGHDRLVNI 409

 Score = 54.3 bits (129), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 73/176 (41%), Gaps = 19/176 (10%)

Query: 55  DTVHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEV 114
           D  H+  +  + W P  + L +G  D+ + +W  +    EE           + GH   V
Sbjct: 211 DAAHEGKIGGLDWHPDGNHLLSGGGDNLVKLWDMTSNSFEE-----------LRGHAGRV 259

Query: 115 KGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLAS 174
             +     G L A+ S D +  +W+ +   E    + + + HS+ V  + + +   LLAS
Sbjct: 260 SRVKVHPSGRLAASASFDLTWILWDLERKVE----LQLQEGHSKAVYTIAFQSDGALLAS 315

Query: 175 SSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
           +  D    IW       E    L GH G I   D+S   +  +L +   D TVRVW
Sbjct: 316 AGLDAVCAIWDLRSG--EPIMKLEGHAGAISGVDWSP--NGYQLATAGADGTVRVW 367

>CAGL0I03718g complement(317565..321170) highly similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 Coatomer alpha
           subunit, start by similarity
          Length = 1201

 Score = 72.8 bits (177), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 77/175 (44%), Gaps = 24/175 (13%)

Query: 63  RSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQD 122
           + +A+ P         F STI +W     D   G      LL   EGHE  V+ + +   
Sbjct: 15  KGIAFHPSRPWALVALFSSTIQLW-----DYRMGT-----LLHRFEGHEGPVRAVDFHPT 64

Query: 123 GCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVR 182
             +  +   D S+ +W      E   C+  L  H   V+ V +H++   + S+S D TVR
Sbjct: 65  QPIFVSAGDDASIKVWSL----ETNRCLYTLTGHLDYVRTVFFHSELPWVISASDDQTVR 120

Query: 183 IWKDYDDDWECA---AVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIG 234
           IW     +W+     A LTGH   + C+ F + ED +   S S D TVRVW   G
Sbjct: 121 IW-----NWQNRKELACLTGHNHFVMCAQFHQTEDLV--VSASLDETVRVWDISG 168

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 88/199 (44%), Gaps = 30/199 (15%)

Query: 8   SLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAW 67
           +L  H D V ++ F      + + S D+ +++   +N KE  L  L  T H   V    +
Sbjct: 90  TLTGHLDYVRTVFFHSELPWVISASDDQTVRIWNWQNRKE--LACL--TGHNHFVMCAQF 145

Query: 68  RPHSDLLAAGSFDSTISIWTQSDL--------------------DLEEGAKLEMELLAII 107
               DL+ + S D T+ +W  S L                    +L +GA  + ++  I+
Sbjct: 146 HQTEDLVVSASLDETVRVWDISGLRKKHSAPGVTSYEDSLASQQNLLDGAFGDCKVKFIL 205

Query: 108 EGHENEVKGISWSQDGCLLATCSRDKSVWIWE--TDEAGEEYECISVLQEHSQDVKHVVW 165
           EGH   V   S+     L+ T   D+ V +W   +++A E   C    + H+ +V  VV+
Sbjct: 206 EGHTRGVNWASFHPTLPLIVTGGDDRQVKLWRMSSNKAWEVDTC----RGHTNNVDCVVF 261

Query: 166 HTKHNLLASSSYDDTVRIW 184
           H   NL+ S + D T+RIW
Sbjct: 262 HPDQNLILSVAEDKTLRIW 280

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 58/248 (23%), Positives = 104/248 (41%), Gaps = 48/248 (19%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHS 71
           H   V ++DF P + +  +   D +IKV  L+  +   L  L  T H   VR+V +  HS
Sbjct: 52  HEGPVRAVDFHPTQPIFVSAGDDASIKVWSLETNR--CLYTL--TGHLDYVRTVFF--HS 105

Query: 72  DL--LAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATC 129
           +L  + + S D T+ IW   +           + LA + GH + V    + Q   L+ + 
Sbjct: 106 ELPWVISASDDQTVRIWNWQN----------RKELACLTGHNHFVMCAQFHQTEDLVVSA 155

Query: 130 SRDKSVWIWET--------------------------DEAGEEYECISVLQEHSQDVKHV 163
           S D++V +W+                           D A  + +   +L+ H++ V   
Sbjct: 156 SLDETVRVWDISGLRKKHSAPGVTSYEDSLASQQNLLDGAFGDCKVKFILEGHTRGVNWA 215

Query: 164 VWHTKHNLLASSSYDDTVRIWK-DYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGS 222
            +H    L+ +   D  V++W+   +  WE      GH   + C  F  +++ I   S +
Sbjct: 216 SFHPTLPLIVTGGDDRQVKLWRMSSNKAWEVDTC-RGHTNNVDCVVFHPDQNLI--LSVA 272

Query: 223 DDSTVRVW 230
           +D T+R+W
Sbjct: 273 EDKTLRIW 280

 Score = 32.7 bits (73), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 47/113 (41%), Gaps = 2/113 (1%)

Query: 21  FEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHSDLLAAGSFD 80
           F P   L+ TG  DR +K+ ++ + K   +D      H   V  V + P  +L+ + + D
Sbjct: 217 FHPTLPLIVTGGDDRQVKLWRMSSNKAWEVDTCRG--HTNNVDCVVFHPDQNLILSVAED 274

Query: 81  STISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDK 133
            T+ IW        +  K E +   +I  H N     +    G ++    R++
Sbjct: 275 KTLRIWDLDKRTPVKQFKRENDRFWLIRSHPNMSLFGAAHDSGIMIFKLDRER 327

 Score = 32.0 bits (71), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 61/159 (38%), Gaps = 38/159 (23%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKV-----LQLKNG-------------KENLLD-- 51
           HN  V    F     L+ + S D  ++V     L+ K+              ++NLLD  
Sbjct: 136 HNHFVMCAQFHQTEDLVVSASLDETVRVWDISGLRKKHSAPGVTSYEDSLASQQNLLDGA 195

Query: 52  --------VLDDTVHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMEL 103
                   +L+   H + V   ++ P   L+  G  D  + +W  S     E        
Sbjct: 196 FGDCKVKFILEG--HTRGVNWASFHPTLPLIVTGGDDRQVKLWRMSSNKAWE-------- 245

Query: 104 LAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDE 142
           +    GH N V  + +  D  L+ + + DK++ IW+ D+
Sbjct: 246 VDTCRGHTNNVDCVVFHPDQNLILSVAEDKTLRIWDLDK 284

 Score = 29.6 bits (65), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 7/41 (17%)

Query: 91  LDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSR 131
            D+++G K       + + H   VK +SWSQDG  LA  S+
Sbjct: 479 FDVQQGKK-------VAQMHVKNVKYVSWSQDGQYLAMMSK 512

>Kwal_56.24526
          Length = 1210

 Score = 72.8 bits (177), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 78/175 (44%), Gaps = 24/175 (13%)

Query: 63  RSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQD 122
           + +A+ P    +    F S+I +W     D   G      LL   E HE  V+GI +   
Sbjct: 15  KGLAFHPSRPWVLVALFSSSIQLW-----DYRMGT-----LLHKFEDHEGPVRGIDFHPT 64

Query: 123 GCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVR 182
             L  +   D ++ +W  D      +C+  L  H   V+ V +H +   + S+S D T+R
Sbjct: 65  QPLFVSAGDDYTIKVWSLDTK----KCLFTLNGHLDYVRTVFFHRELPWIISASDDQTIR 120

Query: 183 IWKDYDDDWEC---AAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIG 234
           IW     +W+     A LTGH   + C+DF   ED +   S S D TVRVW   G
Sbjct: 121 IW-----NWQNRKEIACLTGHNHFVMCADFHPTEDLV--VSASLDETVRVWDISG 168

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 84/199 (42%), Gaps = 30/199 (15%)

Query: 8   SLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAW 67
           +L  H D V ++ F      + + S D+ I++   +N KE    +   T H   V    +
Sbjct: 90  TLNGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKE----IACLTGHNHFVMCADF 145

Query: 68  RPHSDLLAAGSFDSTISIWTQSDL----------DLEEGAKLEMELL----------AII 107
            P  DL+ + S D T+ +W  S L           LE+    +  LL           I+
Sbjct: 146 HPTEDLVVSASLDETVRVWDISGLRKRHSAPSTYTLEDQIAAQQNLLDGGFGDCVVKFIL 205

Query: 108 EGHENEVKGISWSQDGCLLATCSRDKSVWIWE--TDEAGEEYECISVLQEHSQDVKHVVW 165
           EGH   V   S+     L+ +   D+ V +W   + +A E   C    + H+ +V  V++
Sbjct: 206 EGHSRGVNWASFHPTLPLIVSGGDDRQVKLWRMSSTKAWEVDTC----RGHTNNVDSVIF 261

Query: 166 HTKHNLLASSSYDDTVRIW 184
           H   NL+ S   D TVR+W
Sbjct: 262 HPHQNLIISVGEDKTVRVW 280

 Score = 37.0 bits (84), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 47/233 (20%), Positives = 88/233 (37%), Gaps = 46/233 (19%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKV-----LQLKN-------------GKENLLDV- 52
           HN  V   DF P   L+ + S D  ++V     L+ ++              ++NLLD  
Sbjct: 136 HNHFVMCADFHPTEDLVVSASLDETVRVWDISGLRKRHSAPSTYTLEDQIAAQQNLLDGG 195

Query: 53  LDDTV-------HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLA 105
             D V       H + V   ++ P   L+ +G  D  + +W  S     E        + 
Sbjct: 196 FGDCVVKFILEGHSRGVNWASFHPTLPLIVSGGDDRQVKLWRMSSTKAWE--------VD 247

Query: 106 IIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVW 165
              GH N V  + +     L+ +   DK+V +W+ D+       +   +  +     V  
Sbjct: 248 TCRGHTNNVDSVIFHPHQNLIISVGEDKTVRVWDLDKRTP----VKQFKRENDRFWLVRA 303

Query: 166 HTKHNLLASSSYDDTVRIWKDYDDDWECAA------VLTGHEGTIWCSDFSKE 212
           H   NL   +++D  + ++K  D +  C+       +    E  +   D++K+
Sbjct: 304 HPNINLFG-AAHDSGIMVFK-LDRERPCSVINQNQLIFVNKEKQVQSFDYNKK 354

>KLLA0F04884g complement(478044..481682) similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 coatomer complex
           alpha chain of secretory pathway vesicles, start by
           similarity
          Length = 1212

 Score = 72.0 bits (175), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 54/175 (30%), Positives = 77/175 (44%), Gaps = 24/175 (13%)

Query: 63  RSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQD 122
           + +A+ P    +    F STI +W     D   G      LL   E HE  V+GI +   
Sbjct: 15  KGIAFHPSRPWVLVALFSSTIQLW-----DYRMGV-----LLHRFEDHEGPVRGIDFHPT 64

Query: 123 GCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVR 182
             L  +   D ++ +W      E  +C+  L  H   V+ V +H +   + SSS D T+R
Sbjct: 65  QPLFVSAGDDYTIKVWSL----ESNKCLFTLDGHLDYVRTVFFHHELPWIISSSDDQTIR 120

Query: 183 IWKDYDDDWEC---AAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIG 234
           IW     +W+     A LTGH   + C+ F   ED +   S S D TVRVW   G
Sbjct: 121 IW-----NWQNRKEIACLTGHNHFVMCAQFHPVEDLV--VSASLDETVRVWDISG 168

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 84/193 (43%), Gaps = 26/193 (13%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHS 71
           H D V ++ F      + + S D+ I++   +N KE    +   T H   V    + P  
Sbjct: 94  HLDYVRTVFFHHELPWIISSSDDQTIRIWNWQNRKE----IACLTGHNHFVMCAQFHPVE 149

Query: 72  DLLAAGSFDSTISIWTQSDL----------DLEEGAKLEMELL----------AIIEGHE 111
           DL+ + S D T+ +W  S L            EE  + +  LL           I+EGH 
Sbjct: 150 DLVVSASLDETVRVWDISGLRKRHSAPGTQSFEEQMRQQQNLLDGGFGDCVVKFILEGHT 209

Query: 112 NEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNL 171
             V   S+     L+ + S D+ V +W    A + +E +   + H+ +V  V++H + NL
Sbjct: 210 RGVNWASFHPTLPLIVSGSDDRQVKLWRM-SATKAWE-VDTCRGHTNNVDSVIFHPQQNL 267

Query: 172 LASSSYDDTVRIW 184
           + S   D TVR+W
Sbjct: 268 IISVGEDKTVRVW 280

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 65/308 (21%), Positives = 113/308 (36%), Gaps = 57/308 (18%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKV-----LQLKNG-------------KENLLDV- 52
           HN  V    F PV  L+ + S D  ++V     L+ ++              ++NLLD  
Sbjct: 136 HNHFVMCAQFHPVEDLVVSASLDETVRVWDISGLRKRHSAPGTQSFEEQMRQQQNLLDGG 195

Query: 53  LDDTV-------HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLA 105
             D V       H + V   ++ P   L+ +GS D  + +W  S     E        + 
Sbjct: 196 FGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWE--------VD 247

Query: 106 IIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVW 165
              GH N V  + +     L+ +   DK+V +W+ D+       I   +  +     V  
Sbjct: 248 TCRGHTNNVDSVIFHPQQNLIISVGEDKTVRVWDLDKRTP----IKQFKRENDRFWLVRA 303

Query: 166 HTKHNLLASSSYDDTVRIWKDYDDDWECAAV------LTGHEGTIWCSDFSKEEDPIRLC 219
           H   NL   +++D  + I+K  D +    A+          E  +   D+ K    +   
Sbjct: 304 HPNLNLFG-AAHDSGIMIFK-LDRERPPTAINQNQLFFINREKQVQMFDYHKRITSLPYL 361

Query: 220 S----GSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIAS---VG 272
           S    G   S+ R   Y       Q   +  S+   A+R  +  +   PSG + +   + 
Sbjct: 362 SLKNIGKTWSSFRSMSY----NPSQHSVLVNSSEKEANRFSLCVLPKQPSGAVEASNVIS 417

Query: 273 ADGVLAVY 280
            DG  A++
Sbjct: 418 DDGSFAIF 425

>Scas_630.6
          Length = 621

 Score = 72.0 bits (175), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 66/240 (27%), Positives = 105/240 (43%), Gaps = 33/240 (13%)

Query: 9   LKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWR 68
           LK H   ++S+D+ P    L +GS DR+I++  LK G+ +L   ++D      V +VA  
Sbjct: 379 LKGHEQDIYSLDYFPDGQKLVSGSGDRSIRIWDLKTGQCSLTLSIED-----GVTTVAVS 433

Query: 69  PH-SDLLAAGSFDSTISIWTQS--------DLDLEEGAKLEMELLAIIEGHENEVKGISW 119
           P+   L+AAGS D ++ IW  S        D D E G            GH++ V  +++
Sbjct: 434 PNEGKLIAAGSLDRSVRIWDSSTGFLVERLDSDNESG-----------NGHQDSVYSVAF 482

Query: 120 SQDGCLLATCSRDKSVWIWET-DEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYD 178
           ++DG  + + S D++V +W   D      +C      H   V  V        + S S D
Sbjct: 483 TKDGQHVVSGSLDRTVKLWNLGDTQSGTGKCEVTYIGHKDFVLSVATSNDDKYIFSGSKD 542

Query: 179 DTVRIWKDYDDDWECAAVLTGHEGTIWC-----SDFSKEEDPIRLCSGSDDSTVRVWKYI 233
             V IW    D      +L GH  ++       S+    ++     +GS D   R+WKY 
Sbjct: 543 RGVIIWD--KDSGNPILMLQGHRKSVISVATVNSNVDDGKNYKLFATGSGDCKARIWKYF 600

 Score = 71.6 bits (174), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 72/278 (25%), Positives = 119/278 (42%), Gaps = 51/278 (18%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKA---------- 61
           H+  V  + F      LATG  +R  ++  +  G E  + +LDDTV+             
Sbjct: 278 HDSVVCCVKFSQDGKYLATGC-NRTTQIFDVATG-ELYVKLLDDTVNTAIVTTTTENNET 335

Query: 62  --------VRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENE 113
                   +RS+ + P  + LA G+ D  I IW             E +++ +++GHE +
Sbjct: 336 VTTTADLYIRSICFSPDGEFLATGAEDKLIRIWNIK----------ERKIVMVLKGHEQD 385

Query: 114 VKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLA 173
           +  + +  DG  L + S D+S+ IW+        +C   L          V   +  L+A
Sbjct: 386 IYSLDYFPDGQKLVSGSGDRSIRIWDLKTG----QCSLTLSIEDGVTTVAVSPNEGKLIA 441

Query: 174 SSSYDDTVRIW--------KDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDS 225
           + S D +VRIW        +  D D E      GH+ +++   F+K  D   + SGS D 
Sbjct: 442 AGSLDRSVRIWDSSTGFLVERLDSDNESG---NGHQDSVYSVAFTK--DGQHVVSGSLDR 496

Query: 226 TVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWS 263
           TV++W  +GD +    +  CE T    H+  +  VA S
Sbjct: 497 TVKLWN-LGDTQSGTGK--CEVTYI-GHKDFVLSVATS 530

>AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH]
           (172849..175296) [2448 bp, 815 aa]
          Length = 815

 Score = 70.1 bits (170), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 66/218 (30%), Positives = 94/218 (43%), Gaps = 31/218 (14%)

Query: 71  SDLLAAGSFDSTISIW----TQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLL 126
           S L+AAG  DS I +W    T  +  L   AK     + +I GH   V  +S+S D   L
Sbjct: 499 SRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTLI-GHSGPVYSVSFSPDNRYL 557

Query: 127 ATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLL----ASSSYDDTVR 182
            + S DK+V +W  D     Y C+   + H+    H VW  K + L    A+ S+D T R
Sbjct: 558 VSASEDKTVRLWSLD----TYTCLVSYKGHN----HPVWDVKFSPLGHYFATGSHDQTAR 609

Query: 183 IWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQE 242
           +W    D      +  GH   + C  F    +   + +GS D T R+W     D      
Sbjct: 610 LWS--CDHIYPLRIFAGHLNDVDCVTF--HPNGTYVLTGSSDKTCRMWDIQTGD------ 659

Query: 243 WVCESTLPNAHRSQIYGVAWSPSGRIASVGA-DGVLAV 279
                 L   H + +  VA SP GR  + G+ DGV+ V
Sbjct: 660 ---SVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIV 694

 Score = 57.8 bits (138), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 68/277 (24%), Positives = 114/277 (41%), Gaps = 41/277 (14%)

Query: 15  KVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHSDLL 74
           K+WS+D  P+   L + + D +  V  +               H   V SV++ P +  L
Sbjct: 512 KLWSLDGTPLESQLPSKAKDASNTVTLIG--------------HSGPVYSVSFSPDNRYL 557

Query: 75  AAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKS 134
            + S D T+ +W+   LD           L   +GH + V  + +S  G   AT S D++
Sbjct: 558 VSASEDKTVRLWS---LD-------TYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQT 607

Query: 135 VWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECA 194
             +W  D        + +   H  DV  V +H     + + S D T R+W     D    
Sbjct: 608 ARLWSCD----HIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGD--SV 661

Query: 195 AVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHR 254
            +  GH  ++     S   D   L +GS+D  + VW  IG  +  +Q       +    +
Sbjct: 662 RLFLGHTASVVSVAVS--PDGRWLTTGSEDGVIIVWD-IGTGKRIKQ-------MRGHGK 711

Query: 255 SQIYGVAWSPSGRI-ASVGADGVLAVYKEKQNDSEVS 290
           S +Y ++++  G I  S GAD  + V+  K+  +E S
Sbjct: 712 SAVYSLSFNKEGNILVSGGADQSVRVWDLKKFTNEPS 748

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 79/178 (44%), Gaps = 19/178 (10%)

Query: 8   SLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAW 67
           S K HN  VW + F P+    ATGS D+  ++       +++  +     H   V  V +
Sbjct: 579 SYKGHNHPVWDVKFSPLGHYFATGSHDQTARLWSC----DHIYPLRIFAGHLNDVDCVTF 634

Query: 68  RPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLA 127
            P+   +  GS D T  +W     D++ G  + + L     GH   V  ++ S DG  L 
Sbjct: 635 HPNGTYVLTGSSDKTCRMW-----DIQTGDSVRLFL-----GHTASVVSVAVSPDGRWLT 684

Query: 128 TCSRDKSVWIWETDEAGEEYECISVLQEHSQD-VKHVVWHTKHNLLASSSYDDTVRIW 184
           T S D  + +W+        + I  ++ H +  V  + ++ + N+L S   D +VR+W
Sbjct: 685 TGSEDGVIIVWDIGTG----KRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVW 738

>CAGL0J03476g 331933..333486 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 517

 Score = 69.3 bits (168), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 75/279 (26%), Positives = 116/279 (41%), Gaps = 49/279 (17%)

Query: 58  HKKAVRSVAWRPH-SDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKG 116
           H   +   A+ PH S  +  G  D+T  IW   D D +            + GH N V  
Sbjct: 144 HGATILCSAFAPHTSSRVVTGGGDNTARIW---DCDTQTPK-------VTLNGHRNWVLC 193

Query: 117 ISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNL----- 171
           +SWS DG ++AT S D ++ +W+  E+G+       L+ HS+ +  + W   H +     
Sbjct: 194 VSWSADGEVIATGSMDNTIRLWDA-ESGKPLG--DALRGHSKWITSLTWEPIHLVEPGSK 250

Query: 172 --LASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRV 229
             LAS+S D T+RIW        C   L GH  ++ C  +  E     L SGS D TVR 
Sbjct: 251 PRLASASKDGTIRIWDSSRR--VCLMTLGGHTNSVSCVKWGGEG---ILYSGSHDKTVRA 305

Query: 230 WKYIGDDEDDQQEWVCESTL-PNAHRSQIYGVAWSPSGRIASVGADGVLAVYKEKQNDSE 288
           W       D +Q   C + L  +AH      ++   + R+ +    GV     ++  D  
Sbjct: 306 W-------DMKQNGKCINILKSHAHWVNHLSLSTDYALRVGAFDYTGVKPANAKEARDKA 358

Query: 289 VSEWEISATYKAAHTVYEINTVKWVNIDGKEMLITAGDD 327
           +  +E  A     H               +E+++TA DD
Sbjct: 359 LQNYEKVARKNGKH---------------EELMVTASDD 382

 Score = 64.7 bits (156), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 94/363 (25%), Positives = 147/363 (40%), Gaps = 91/363 (25%)

Query: 17  WSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRP------- 69
           WS D E    ++ATGS D  I++   ++GK  L D L    H K + S+ W P       
Sbjct: 196 WSADGE----VIATGSMDNTIRLWDAESGKP-LGDALRG--HSKWITSLTWEPIHLVEPG 248

Query: 70  HSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATC 129
               LA+ S D TI IW  S              L  + GH N V  + W  +G +L + 
Sbjct: 249 SKPRLASASKDGTIRIWDSS----------RRVCLMTLGGHTNSVSCVKWGGEG-ILYSG 297

Query: 130 SRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHT---------------------- 167
           S DK+V  W+  + G   +CI++L+ H+  V H+   T                      
Sbjct: 298 SHDKTVRAWDMKQNG---KCINILKSHAHWVNHLSLSTDYALRVGAFDYTGVKPANAKEA 354

Query: 168 ----------------KH-NLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFS 210
                           KH  L+ ++S D T+ +W       +  + +TGH+  +    FS
Sbjct: 355 RDKALQNYEKVARKNGKHEELMVTASDDFTMFLWNPLKGT-KPISRMTGHQKLVNHVAFS 413

Query: 211 KEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGR-IA 269
              D   + S S D+++++W        D +E    ST    H + +Y VAWS   R + 
Sbjct: 414 --PDGKYIVSASFDNSIKLW--------DGKEGTFLSTF-RGHVASVYQVAWSSDCRLLV 462

Query: 270 SVGADGVLAVYKEKQNDSEVSEWEISATYKAAHTVYEINTVKWVNIDGKEMLITAGDDGR 329
           S   D  L V+       +V   ++S          E+ TV W ++DGK  + + G D  
Sbjct: 463 SCSKDTTLKVW-------DVKTRKLSVDLPGHQD--EVYTVDW-SVDGKR-VCSGGKDKM 511

Query: 330 VNL 332
           + L
Sbjct: 512 MRL 514

 Score = 64.3 bits (155), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 56/208 (26%), Positives = 98/208 (47%), Gaps = 28/208 (13%)

Query: 32  STDRAIKV-------LQLKNGKENLLDVLDDTVHKKAVRSVAWRPHSDLLAAGSFDSTIS 84
           STD A++V       ++  N KE     L +  ++K  R      H +L+   S D T+ 
Sbjct: 331 STDYALRVGAFDYTGVKPANAKEARDKALQN--YEKVARKNG--KHEELMVTASDDFTMF 386

Query: 85  IWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAG 144
           +W     +  +G K     ++ + GH+  V  +++S DG  + + S D S+ +W+    G
Sbjct: 387 LW-----NPLKGTKP----ISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLWD----G 433

Query: 145 EEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTI 204
           +E   +S  + H   V  V W +   LL S S D T+++W       + +  L GH+  +
Sbjct: 434 KEGTFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTR--KLSVDLPGHQDEV 491

Query: 205 WCSDFSKEEDPIRLCSGSDDSTVRVWKY 232
           +  D+S   D  R+CSG  D  +R+W +
Sbjct: 492 YTVDWS--VDGKRVCSGGKDKMMRLWTH 517

 Score = 58.2 bits (139), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 86/194 (44%), Gaps = 39/194 (20%)

Query: 15  KVWSIDFEPVRGLLATGSTDRAIK---VLQLKNGK--ENLLDVLDD-------------- 55
           +V + D+  V+   A  + D+A++    +  KNGK  E ++   DD              
Sbjct: 337 RVGAFDYTGVKPANAKEARDKALQNYEKVARKNGKHEELMVTASDDFTMFLWNPLKGTKP 396

Query: 56  ----TVHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHE 111
               T H+K V  VA+ P    + + SFD++I +W     D +EG       L+   GH 
Sbjct: 397 ISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLW-----DGKEGT-----FLSTFRGHV 446

Query: 112 NEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISV-LQEHSQDVKHVVWHTKHN 170
             V  ++WS D  LL +CS+D ++ +W+      +   +SV L  H  +V  V W     
Sbjct: 447 ASVYQVAWSSDCRLLVSCSKDTTLKVWDV-----KTRKLSVDLPGHQDEVYTVDWSVDGK 501

Query: 171 LLASSSYDDTVRIW 184
            + S   D  +R+W
Sbjct: 502 RVCSGGKDKMMRLW 515

 Score = 53.5 bits (127), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 63/262 (24%), Positives = 115/262 (43%), Gaps = 45/262 (17%)

Query: 26  GLLATGSTDRAIKVLQLK-NGKENLLDVLDDTVHKKAVRSVAWRPHSDL-----LAAGSF 79
           G+L +GS D+ ++   +K NGK   +++L    H        W  H  L     L  G+F
Sbjct: 292 GILYSGSHDKTVRAWDMKQNGK--CINILKSHAH--------WVNHLSLSTDYALRVGAF 341

Query: 80  DSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWE 139
           D T  +   +  +  + A    E +A   G   E           L+ T S D ++++W 
Sbjct: 342 DYT-GVKPANAKEARDKALQNYEKVARKNGKHEE-----------LMVTASDDFTMFLWN 389

Query: 140 TDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTG 199
             +  +    IS +  H + V HV +      + S+S+D+++++W   +  +   +   G
Sbjct: 390 PLKGTKP---ISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLWDGKEGTF--LSTFRG 444

Query: 200 HEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYG 259
           H  +++   +S   D   L S S D+T++VW        D +       LP  H+ ++Y 
Sbjct: 445 HVASVYQVAWS--SDCRLLVSCSKDTTLKVW--------DVKTRKLSVDLP-GHQDEVYT 493

Query: 260 VAWSPSG-RIASVGADGVLAVY 280
           V WS  G R+ S G D ++ ++
Sbjct: 494 VDWSVDGKRVCSGGKDKMMRLW 515

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 41/80 (51%), Gaps = 10/80 (12%)

Query: 194 AAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAH 253
           ++ + GH  TI CS F+      R+ +G  D+T R+W     D D Q   V   TL N H
Sbjct: 138 SSAIAGHGATILCSAFAPHTSS-RVVTGGGDNTARIW-----DCDTQTPKV---TL-NGH 187

Query: 254 RSQIYGVAWSPSGRIASVGA 273
           R+ +  V+WS  G + + G+
Sbjct: 188 RNWVLCVSWSADGEVIATGS 207

>Scas_720.95
          Length = 515

 Score = 68.9 bits (167), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 96/372 (25%), Positives = 155/372 (41%), Gaps = 87/372 (23%)

Query: 8   SLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAW 67
           +L  H + V  + + P   ++ATGS D  I++   K+GK  L D L    H K + S+AW
Sbjct: 181 TLTGHFNWVLCVSYCPNGEVIATGSMDNTIRLWDSKDGKP-LGDALRG--HLKWITSLAW 237

Query: 68  RP-------HSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWS 120
            P        S  LA+ S D TI IW     D+          L  + GH N V  I WS
Sbjct: 238 EPIHLVKPGESPRLASASKDGTIRIW-----DITRRV-----CLYTMSGHTNSVSCIKWS 287

Query: 121 QDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKH----------- 169
             G ++ + S DK+V +W+ +  G   +CI++L+ H+  V H+   T +           
Sbjct: 288 GQG-IIYSGSHDKTVRVWDMNADG---KCINILKSHAHWVNHLSLSTDYALRVGAFDHTG 343

Query: 170 ----------------------------NLLASSSYDDTVRIWKDYDDDWECAAVLTGHE 201
                                        L+ ++S D T+ +W     + +  A +TGH+
Sbjct: 344 AQPASAKDARDKALANYEKVVKKNGKLEELMVTASDDFTMFLWNPLKSN-KPIARMTGHQ 402

Query: 202 GTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVA 261
             +    FS   D   + S S D+++++W        D ++    ST    H + +Y VA
Sbjct: 403 KLVNHVAFS--PDGRYIVSASFDNSIKLW--------DGRDGKFISTF-RGHVASVYQVA 451

Query: 262 WSPSGR-IASVGADGVLAVYKEKQNDSEVSEWEISATYKAAHTVYEINTVKWVNIDGKEM 320
           WS   R + S   D  L V+       +V   ++S          E+ TV W ++DGK  
Sbjct: 452 WSADCRLLVSCSKDTTLKVW-------DVRTRKLSVDLPGHKD--EVYTVDW-SVDGKR- 500

Query: 321 LITAGDDGRVNL 332
           + + G D  V +
Sbjct: 501 VCSGGKDKMVRI 512

 Score = 63.2 bits (152), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 76/161 (47%), Gaps = 17/161 (10%)

Query: 72  DLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSR 131
           +L+   S D T+ +W     +         + +A + GH+  V  +++S DG  + + S 
Sbjct: 372 ELMVTASDDFTMFLWNPLKSN---------KPIARMTGHQKLVNHVAFSPDGRYIVSASF 422

Query: 132 DKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDW 191
           D S+ +W+    G + + IS  + H   V  V W     LL S S D T+++W       
Sbjct: 423 DNSIKLWD----GRDGKFISTFRGHVASVYQVAWSADCRLLVSCSKDTTLKVWDVRTR-- 476

Query: 192 ECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKY 232
           + +  L GH+  ++  D+S   D  R+CSG  D  VR+W +
Sbjct: 477 KLSVDLPGHKDEVYTVDWS--VDGKRVCSGGKDKMVRIWTH 515

 Score = 57.4 bits (137), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 61/130 (46%), Gaps = 16/130 (12%)

Query: 56  TVHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVK 115
           T H+K V  VA+ P    + + SFD++I +W     D  +G     + ++   GH   V 
Sbjct: 399 TGHQKLVNHVAFSPDGRYIVSASFDNSIKLW-----DGRDG-----KFISTFRGHVASVY 448

Query: 116 GISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISV-LQEHSQDVKHVVWHTKHNLLAS 174
            ++WS D  LL +CS+D ++ +W+          +SV L  H  +V  V W      + S
Sbjct: 449 QVAWSADCRLLVSCSKDTTLKVWDV-----RTRKLSVDLPGHKDEVYTVDWSVDGKRVCS 503

Query: 175 SSYDDTVRIW 184
              D  VRIW
Sbjct: 504 GGKDKMVRIW 513

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 86/188 (45%), Gaps = 26/188 (13%)

Query: 58  HKKAVRSVAWRPH-SDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKG 116
           H   +   A+ P+ S  +  G+ D+T  IW   D D +          A + GH N V  
Sbjct: 142 HGSTILCSAFAPNTSSRMVTGAGDNTARIW---DCDTQTPK-------ATLTGHFNWVLC 191

Query: 117 ISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNL----- 171
           +S+  +G ++AT S D ++ +W++ +     +    L+ H + +  + W   H +     
Sbjct: 192 VSYCPNGEVIATGSMDNTIRLWDSKDGKPLGD---ALRGHLKWITSLAWEPIHLVKPGES 248

Query: 172 --LASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRV 229
             LAS+S D T+RIW        C   ++GH  ++ C  +S +     + SGS D TVRV
Sbjct: 249 PRLASASKDGTIRIWDITRR--VCLYTMSGHTNSVSCIKWSGQG---IIYSGSHDKTVRV 303

Query: 230 WKYIGDDE 237
           W    D +
Sbjct: 304 WDMNADGK 311

 Score = 53.9 bits (128), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 61/262 (23%), Positives = 113/262 (43%), Gaps = 43/262 (16%)

Query: 25  RGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHSDL-----LAAGSF 79
           +G++ +GS D+ ++V  + N     +++L    H        W  H  L     L  G+F
Sbjct: 289 QGIIYSGSHDKTVRVWDM-NADGKCINILKSHAH--------WVNHLSLSTDYALRVGAF 339

Query: 80  DSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWE 139
           D T      S  D  + A    E +    G   E           L+ T S D ++++W 
Sbjct: 340 DHT-GAQPASAKDARDKALANYEKVVKKNGKLEE-----------LMVTASDDFTMFLWN 387

Query: 140 TDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTG 199
             ++ +    I+ +  H + V HV +      + S+S+D+++++W   D  +   +   G
Sbjct: 388 PLKSNKP---IARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKF--ISTFRG 442

Query: 200 HEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYG 259
           H  +++   +S   D   L S S D+T++VW        D +       LP  H+ ++Y 
Sbjct: 443 HVASVYQVAWS--ADCRLLVSCSKDTTLKVW--------DVRTRKLSVDLP-GHKDEVYT 491

Query: 260 VAWSPSG-RIASVGADGVLAVY 280
           V WS  G R+ S G D ++ ++
Sbjct: 492 VDWSVDGKRVCSGGKDKMVRIW 513

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 60/127 (47%), Gaps = 14/127 (11%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHS 71
           H   V  + F P    + + S D +IK+   ++GK   +       H  +V  VAW    
Sbjct: 401 HQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGK--FISTFRG--HVASVYQVAWSADC 456

Query: 72  DLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSR 131
            LL + S D+T+ +W     D+    KL ++L     GH++EV  + WS DG  + +  +
Sbjct: 457 RLLVSCSKDTTLKVW-----DVRT-RKLSVDL----PGHKDEVYTVDWSVDGKRVCSGGK 506

Query: 132 DKSVWIW 138
           DK V IW
Sbjct: 507 DKMVRIW 513

 Score = 37.0 bits (84), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 42/80 (52%), Gaps = 10/80 (12%)

Query: 194 AAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAH 253
           ++ + GH  TI CS F+      R+ +G+ D+T R+W     D D Q     ++TL   H
Sbjct: 136 SSAIAGHGSTILCSAFAPNTSS-RMVTGAGDNTARIW-----DCDTQTP---KATL-TGH 185

Query: 254 RSQIYGVAWSPSGRIASVGA 273
            + +  V++ P+G + + G+
Sbjct: 186 FNWVLCVSYCPNGEVIATGS 205

>YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer
           (COPI) complex alpha chain (alpha-COP) of secretory
           pathway vesicles required for retrograde Golgi to
           endoplasmic reticulum transport, member of WD (WD-40)
           repeat family [3606 bp, 1201 aa]
          Length = 1201

 Score = 68.6 bits (166), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 77/175 (44%), Gaps = 24/175 (13%)

Query: 63  RSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQD 122
           + +A+ P    +    F STI +W     D   G      LL   E HE  V+G+ +   
Sbjct: 15  KGIAFHPSRPWVLVALFSSTIQLW-----DYRMGT-----LLHRFEDHEGPVRGLDFHPT 64

Query: 123 GCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVR 182
             +  +   D ++ +W  D      +C+  L  H   V+ V +H +   + S+S D T+R
Sbjct: 65  QPIFVSAGDDYTIKVWSLDTN----KCLYTLTGHLDYVRTVFFHRELPWIISASDDQTIR 120

Query: 183 IWKDYDDDWEC---AAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIG 234
           IW     +W+     A LTGH   + C+ F   +D I   S S D T+R+W   G
Sbjct: 121 IW-----NWQNRKEIACLTGHNHFVMCAQFHPTDDLI--VSASLDETIRIWDISG 168

 Score = 57.0 bits (136), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 84/197 (42%), Gaps = 26/197 (13%)

Query: 8   SLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAW 67
           +L  H D V ++ F      + + S D+ I++   +N KE    +   T H   V    +
Sbjct: 90  TLTGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKE----IACLTGHNHFVMCAQF 145

Query: 68  RPHSDLLAAGSFDSTISIWTQSDL----------DLEEGAKLEMELL----------AII 107
            P  DL+ + S D TI IW  S L            EE    +  LL           I+
Sbjct: 146 HPTDDLIVSASLDETIRIWDISGLRKRHSAPGTSSFEEQMSAQQNLLDGSLGDCVVKFIL 205

Query: 108 EGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHT 167
           EGH   V   S+     L+ + S D+ V +W    A + +E +   + H+ +V  V++H 
Sbjct: 206 EGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMS-ATKAWE-VDTCRGHTNNVDSVIFHP 263

Query: 168 KHNLLASSSYDDTVRIW 184
             NL+ S   D T+R+W
Sbjct: 264 HQNLIISVGEDKTLRVW 280

 Score = 37.0 bits (84), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 44/227 (19%), Positives = 87/227 (38%), Gaps = 43/227 (18%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLK------------------NGKENLLD-V 52
           HN  V    F P   L+ + S D  I++  +                   + ++NLLD  
Sbjct: 136 HNHFVMCAQFHPTDDLIVSASLDETIRIWDISGLRKRHSAPGTSSFEEQMSAQQNLLDGS 195

Query: 53  LDDTV-------HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLA 105
           L D V       H + V   ++ P   L+ +GS D  + +W  S     E        + 
Sbjct: 196 LGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWE--------VD 247

Query: 106 IIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVW 165
              GH N V  + +     L+ +   DK++ +W+ D+       +   +  +     +  
Sbjct: 248 TCRGHTNNVDSVIFHPHQNLIISVGEDKTLRVWDLDKRTP----VKQFKRENDRFWLIAA 303

Query: 166 HTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKE 212
           H   NL   +++D  + ++K  D +  C+ +   H+  ++  +  K+
Sbjct: 304 HPHINLFG-AAHDSGIMVFK-LDRERPCSFI---HQNQLFFVNAEKQ 345

>YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein of
           unknown function, member of WD (WD-40) repeat family
           [1548 bp, 515 aa]
          Length = 515

 Score = 68.2 bits (165), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 86/182 (47%), Gaps = 28/182 (15%)

Query: 58  HKKAVRSVAWRPH-SDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKG 116
           H   +   A+ PH S  +  G+ D+T  IW   D D +         +  ++GH N V  
Sbjct: 142 HGSTILCSAFAPHTSSRMVTGAGDNTARIW---DCDTQTP-------MHTLKGHYNWVLC 191

Query: 117 ISWSQDGCLLATCSRDKSVWIWETDEAGEEYECIS-VLQEHSQDVKHVVWHTKHNL---- 171
           +SWS DG ++AT S D ++ +W+        +C+   L+ HS+ +  + W   H +    
Sbjct: 192 VSWSPDGEVIATGSMDNTIRLWDPKSG----QCLGDALRGHSKWITSLSWEPIHLVKPGS 247

Query: 172 ---LASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVR 228
              LASSS D T++IW        C   ++GH  ++ C  +  +     L SGS D TVR
Sbjct: 248 KPRLASSSKDGTIKIWDTVSR--VCQYTMSGHTNSVSCVKWGGQG---LLYSGSHDRTVR 302

Query: 229 VW 230
           VW
Sbjct: 303 VW 304

 Score = 63.5 bits (153), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 92/372 (24%), Positives = 150/372 (40%), Gaps = 87/372 (23%)

Query: 8   SLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAW 67
           +LK H + V  + + P   ++ATGS D  I++   K+G + L D L    H K + S++W
Sbjct: 181 TLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKSG-QCLGDALRG--HSKWITSLSW 237

Query: 68  RP-------HSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWS 120
            P           LA+ S D TI IW            +       + GH N V  + W 
Sbjct: 238 EPIHLVKPGSKPRLASSSKDGTIKIWDT----------VSRVCQYTMSGHTNSVSCVKWG 287

Query: 121 QDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNL--------- 171
             G LL + S D++V +W+ +  G    CI++L+ H+  V H+   T + L         
Sbjct: 288 GQG-LLYSGSHDRTVRVWDINSQG---RCINILKSHAHWVNHLSLSTDYALRIGAFDHTG 343

Query: 172 ------------------------------LASSSYDDTVRIWKDYDDDWECAAVLTGHE 201
                                         + ++S D T+ +W       +  A +TGH+
Sbjct: 344 KKPSTPEEAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKST-KPIARMTGHQ 402

Query: 202 GTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVA 261
             +    FS   D   + S S D+++++W        D ++    ST    H + +Y VA
Sbjct: 403 KLVNHVAFS--PDGRYIVSASFDNSIKLW--------DGRDGKFISTF-RGHVASVYQVA 451

Query: 262 WSPSGR-IASVGADGVLAVYKEKQNDSEVSEWEISATYKAAHTVYEINTVKWVNIDGKEM 320
           WS   R + S   D  L V+       +V   ++S          E+ TV W ++DGK  
Sbjct: 452 WSSDCRLLVSCSKDTTLKVW-------DVRTRKLSVDLPGHKD--EVYTVDW-SVDGKR- 500

Query: 321 LITAGDDGRVNL 332
           + + G D  V L
Sbjct: 501 VCSGGKDKMVRL 512

 Score = 62.4 bits (150), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 61/244 (25%), Positives = 103/244 (42%), Gaps = 53/244 (21%)

Query: 25  RGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHSDL-----LAAGSF 79
           +GLL +GS DR ++V  + N +   +++L    H        W  H  L     L  G+F
Sbjct: 289 QGLLYSGSHDRTVRVWDI-NSQGRCINILKSHAH--------WVNHLSLSTDYALRIGAF 339

Query: 80  DST------------ISIWTQSDLDLEEGAKLEMEL-------------------LAIIE 108
           D T             ++     +  + G   EM +                   +A + 
Sbjct: 340 DHTGKKPSTPEEAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMT 399

Query: 109 GHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTK 168
           GH+  V  +++S DG  + + S D S+ +W+    G + + IS  + H   V  V W + 
Sbjct: 400 GHQKLVNHVAFSPDGRYIVSASFDNSIKLWD----GRDGKFISTFRGHVASVYQVAWSSD 455

Query: 169 HNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVR 228
             LL S S D T+++W       + +  L GH+  ++  D+S   D  R+CSG  D  VR
Sbjct: 456 CRLLVSCSKDTTLKVWDVRTR--KLSVDLPGHKDEVYTVDWS--VDGKRVCSGGKDKMVR 511

Query: 229 VWKY 232
           +W +
Sbjct: 512 LWTH 515

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 39/84 (46%), Gaps = 18/84 (21%)

Query: 194 AAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLP--- 250
           ++ + GH  TI CS F+      R+ +G+ D+T R+W              C++  P   
Sbjct: 136 SSAIAGHGSTILCSAFAPHTSS-RMVTGAGDNTARIWD-------------CDTQTPMHT 181

Query: 251 -NAHRSQIYGVAWSPSGRIASVGA 273
              H + +  V+WSP G + + G+
Sbjct: 182 LKGHYNWVLCVSWSPDGEVIATGS 205

>KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA
           Kluyveromyces lactis Transcriptional repressor TUP1,
           start by similarity
          Length = 682

 Score = 68.2 bits (165), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 103/238 (43%), Gaps = 20/238 (8%)

Query: 4   QLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVR 63
           ++  +LK H   ++S+D+ P    L +GS DR +++  L  G  +L   ++D      V 
Sbjct: 439 KIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDLTTGTCSLTLSIED-----GVT 493

Query: 64  SVAWRP-HSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQD 122
           +VA  P     +AAGS D T+ +W      L E    E EL     GH + V  + +++D
Sbjct: 494 TVAVSPGEGKFIAAGSLDRTVRVWDSDTGFLVERLDSENELGT---GHRDSVYSVVFTRD 550

Query: 123 GCLLATCSRDKSVWIWETDE-AGEE--YECISVLQEHSQDVKHVVWHTKHNLLASSSYDD 179
           G  + + S D+SV +W  +  +G++   EC      H   V  V        + S S D 
Sbjct: 551 GKGVVSGSLDRSVKLWNLNGLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDR 610

Query: 180 TVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIR-----LCSGSDDSTVRVWKY 232
            V  W     +     +L GH  ++     +    P+        +GS D   R+WKY
Sbjct: 611 GVLFWDTKSGN--PLLMLQGHRNSVISVTVANGH-PLGPEYGVFATGSGDCKARIWKY 665

 Score = 58.2 bits (139), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/157 (29%), Positives = 71/157 (45%), Gaps = 16/157 (10%)

Query: 114 VKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLA 173
           ++ + +S DG  LAT + DK + IW+     E  + +  L+ H QD+  + +    N L 
Sbjct: 409 IRSVCFSPDGKFLATGAEDKLIRIWDL----ETKKIVMTLKGHEQDIYSLDYFPSGNKLV 464

Query: 174 SSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYI 233
           S S D TVRIW        C+  L+  +G    +    E   I   +GS D TVRVW   
Sbjct: 465 SGSGDRTVRIWD--LTTGTCSLTLSIEDGVTTVAVSPGEGKFI--AAGSLDRTVRVW--- 517

Query: 234 GDDEDDQ---QEWVCESTLPNAHRSQIYGVAWSPSGR 267
             D D     +    E+ L   HR  +Y V ++  G+
Sbjct: 518 --DSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGK 552

>Scas_631.17
          Length = 474

 Score = 67.4 bits (163), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 81/336 (24%), Positives = 139/336 (41%), Gaps = 47/336 (13%)

Query: 1   MPLQLAKSLK-LHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHK 59
           +P  + +S+K L + K  +++F+  + +      ++ ++ +QL         V    V  
Sbjct: 136 LPYSIDRSMKRLQSMKERALNFDIGKEINTRRQLNQHLEKMQL---------VGSQIVSI 186

Query: 60  KAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISW 119
           + +  V     + L A GS+   I I     LD+  G         I  GH+ ++ G++W
Sbjct: 187 RPISKVCLMSDNALCATGSWAGDIKILDTKTLDVISG---------IENGHDGKIGGLAW 237

Query: 120 SQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDD 179
           +     L + + D  V I   D   +  + ++ LQ H+  V +V +H     +AS+S+D 
Sbjct: 238 NSTNTHLVSGADDCLVKIHSFDPDVKIIKELTALQGHTGRVVNVDFHPSGRFVASASFDM 297

Query: 180 TVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDD 239
           T R+W D + + E      GH   ++   F  + D   LCSG  D+   VW        D
Sbjct: 298 TWRLW-DIESETEL-QFQEGHGKEVYSLSF--QNDGALLCSGGLDNAAIVW--------D 345

Query: 240 QQEWVCESTLPNAHRSQIYGVAWSPSG-RIASVGADGVLAVYKEKQNDSEVSEWEISATY 298
            +       L   H   IY V WSP G  IA+ G DGV+ +            W+I  T 
Sbjct: 346 VRTGKSIMNL-QGHAKPIYSVDWSPDGYHIATGGGDGVINI------------WDIRKTT 392

Query: 299 KAAHTVYEINTVKWVNIDGK--EMLITAGDDGRVNL 332
           +    +   N V  V         L++ G D ++ +
Sbjct: 393 ETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRI 428

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/161 (21%), Positives = 67/161 (41%), Gaps = 37/161 (22%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHS 71
           H  +V+S+ F+    LL +G  D A  V  ++ GK     +++   H K + SV W P  
Sbjct: 316 HGKEVYSLSFQNDGALLCSGGLDNAAIVWDVRTGKS----IMNLQGHAKPIYSVDWSPDG 371

Query: 72  DLLAAGSFDSTISIW-----TQSDL-----DLEEGAKLEMEL------------------ 103
             +A G  D  I+IW     T++       ++  G + +                     
Sbjct: 372 YHIATGGGDGVINIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSS 431

Query: 104 -----LAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWE 139
                +  +EGH +++  +  S+D  L+ +   D+S+ +W+
Sbjct: 432 DNWIQVKTLEGHTDKILDVDISEDAQLIVSSGWDRSLKLWK 472

>Scas_674.20
          Length = 297

 Score = 66.2 bits (160), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 67/233 (28%), Positives = 102/233 (43%), Gaps = 34/233 (14%)

Query: 74  LAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQD--GCLLATCSR 131
           LA  S D TI I      ++E     E+   A +EGH+  V  + W+    G +LA+CS 
Sbjct: 24  LATCSSDKTIKI-----FEVEGETHKEV---ATLEGHDGPVWRVDWAHPKFGTILASCSY 75

Query: 132 DKSVWIWETDEAGEEYECISVLQEHSQDVKHVVW--HTKHNLLASSSYDDTVRIWKDYDD 189
           D  V IW+  E    +  I+    HS  V  V W  H    LL ++S D  V + +  ++
Sbjct: 76  DGKVLIWK--EENGRWSQIACHAVHSASVNSVQWAPHEYGALLLAASSDGKVSVVEFKEN 133

Query: 190 DWECAAVLTGHEGTI----WCSDFSKEEDPI-------RLCSGSDDSTVRVWKYIGDDED 238
                 ++  H   +    W     +E  P        R  +G  D+ V++WKY     +
Sbjct: 134 GTLTPIIIDAHNIGVNSASWAPATLQENKPTKSPEESRRFVTGGADNLVKIWKY----NN 189

Query: 239 DQQEWVCESTLPNAHRSQIYGVAWSPS----GRIASVGADGVLAVYKEKQNDS 287
           + Q ++ E TL   H   +  VAWSPS      IASV  D    ++ ++ NDS
Sbjct: 190 ESQTYLLEDTL-QGHSDWVRDVAWSPSVLLRSYIASVSQDKTCIIWTQENNDS 241

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 65/247 (26%), Positives = 106/247 (42%), Gaps = 35/247 (14%)

Query: 8   SLKLHNDKVWSIDF-EPVRG-LLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSV 65
           +L+ H+  VW +D+  P  G +LA+ S D  + + + +NG+ +   +    VH  +V SV
Sbjct: 48  TLEGHDGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWS--QIACHAVHSASVNSV 105

Query: 66  AWRPH--SDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWS--- 120
            W PH    LL A S D  +S+     ++ +E   L      II+ H   V   SW+   
Sbjct: 106 QWAPHEYGALLLAASSDGKVSV-----VEFKENGTLTP---IIIDAHNIGVNSASWAPAT 157

Query: 121 ----------QDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTK-- 168
                     ++     T   D  V IW+ +   + Y     LQ HS  V+ V W     
Sbjct: 158 LQENKPTKSPEESRRFVTGGADNLVKIWKYNNESQTYLLEDTLQGHSDWVRDVAWSPSVL 217

Query: 169 -HNLLASSSYDDTVRIWKDYDDD--WECAAVLT-GHEGTIWCSDFSKEEDPIRLCSGSDD 224
             + +AS S D T  IW   ++D  W+   +        +W + +S   + + L  G  D
Sbjct: 218 LRSYIASVSQDKTCIIWTQENNDSSWKKTELQKERFPDVLWRASWSLSGNILALSGG--D 275

Query: 225 STVRVWK 231
           + V +WK
Sbjct: 276 NKVTLWK 282

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/206 (26%), Positives = 90/206 (43%), Gaps = 30/206 (14%)

Query: 11  LHNDKVWSIDFEP--VRGLLATGSTDRAIKVLQLK-NGKENLLDVLDDTVHKKAVRSVAW 67
           +H+  V S+ + P     LL   S+D  + V++ K NG   L  ++ D  H   V S +W
Sbjct: 97  VHSASVNSVQWAPHEYGALLLAASSDGKVSVVEFKENG--TLTPIIID-AHNIGVNSASW 153

Query: 68  RP-------------HSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEV 114
            P              S     G  D+ + IW  ++   E    L   L   ++GH + V
Sbjct: 154 APATLQENKPTKSPEESRRFVTGGADNLVKIWKYNN---ESQTYL---LEDTLQGHSDWV 207

Query: 115 KGISWSQDGCL---LATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVK-HVVWHTKHN 170
           + ++WS    L   +A+ S+DK+  IW  +     ++   + +E   DV     W    N
Sbjct: 208 RDVAWSPSVLLRSYIASVSQDKTCIIWTQENNDSSWKKTELQKERFPDVLWRASWSLSGN 267

Query: 171 LLASSSYDDTVRIWK-DYDDDWECAA 195
           +LA S  D+ V +WK + + +WE A 
Sbjct: 268 ILALSGGDNKVTLWKENLEGNWEPAG 293

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 65/141 (46%), Gaps = 10/141 (7%)

Query: 150 ISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDF 209
           +++   H+  +   V       LA+ S D T++I++   +  +  A L GH+G +W  D+
Sbjct: 2   VAIANAHNDLIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKEVATLEGHDGPVWRVDW 61

Query: 210 SKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSP---SG 266
           +  +    L S S D  V +WK   ++     +  C +     H + +  V W+P     
Sbjct: 62  AHPKFGTILASCSYDGKVLIWK---EENGRWSQIACHAV----HSASVNSVQWAPHEYGA 114

Query: 267 RIASVGADGVLAVYKEKQNDS 287
            + +  +DG ++V + K+N +
Sbjct: 115 LLLAASSDGKVSVVEFKENGT 135

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 54/119 (45%), Gaps = 17/119 (14%)

Query: 217 RLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGR---IASVGA 273
           RL + S D T+++++  G+          E      H   ++ V W+       +AS   
Sbjct: 23  RLATCSSDKTIKIFEVEGETHK-------EVATLEGHDGPVWRVDWAHPKFGTILASCSY 75

Query: 274 DGVLAVYKEKQNDSEVSEWEISATYKAAHTVYEINTVKWVNIDGKEMLITAGDDGRVNL 332
           DG + ++KE     E   W   A + A H+   +N+V+W   +   +L+ A  DG+V++
Sbjct: 76  DGKVLIWKE-----ENGRWSQIACH-AVHSA-SVNSVQWAPHEYGALLLAASSDGKVSV 127

>YLR222C (UTP13) [3622] chr12 complement(579320..581773) Component
           of U3 snoRNP (also called small subunit processome),
           which is required for 18S rRNA biogenesis,
           overproduction causes chromosome instability and
           increased mitotic recombination, contains WD (WD-40)
           repeats [2454 bp, 817 aa]
          Length = 817

 Score = 67.4 bits (163), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 76/174 (43%), Gaps = 18/174 (10%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGI 117
           H+K + +++  P+  + A  S+D T  IW     +LE G     EL A +  H+  +  +
Sbjct: 490 HEKDINALSVSPNDSIFATASYDKTCKIW-----NLENG-----ELEATLANHKRGLWDV 539

Query: 118 SWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSY 177
           S+ Q   LLAT S DK+V IW  D     +  +  L+ H+  V+   +  K   L S   
Sbjct: 540 SFCQYDKLLATSSGDKTVKIWSLD----TFSVMKTLEGHTNAVQRCSFINKQKQLISCGA 595

Query: 178 DDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWK 231
           D  ++IW       EC   L GH   +W    S   D   + S   D   + WK
Sbjct: 596 DGLIKIWD--CSSGECLKTLDGHNNRLWA--LSTMNDGDMIVSADADGVFQFWK 645

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 58/121 (47%), Gaps = 7/121 (5%)

Query: 69  PHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLAT 128
           P  + LA  +   ++ I    DL   E A L +++  I EGHE+ +  +  ++DG  +AT
Sbjct: 348 PELNKLALATNSPSLRIIPVPDLSGPE-ASLPLDV-EIYEGHEDLLNSLDATEDGLWIAT 405

Query: 129 CSRDKSVWIWETDEAGEEYECISVLQEHSQDV-----KHVVWHTKHNLLASSSYDDTVRI 183
            S+D +  +W  +E   +++  +    HS  V      ++V       L ++S D T++ 
Sbjct: 406 ASKDNTAIVWRYNENSCKFDIYAKYIGHSAAVTAVGLPNIVSKGYPEFLLTASNDLTIKK 465

Query: 184 W 184
           W
Sbjct: 466 W 466

 Score = 37.4 bits (85), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 57/136 (41%), Gaps = 14/136 (10%)

Query: 4   QLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVR 63
           +L  +L  H   +W + F     LLAT S D+ +K+  L     +++  L+   H  AV+
Sbjct: 524 ELEATLANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTF--SVMKTLEG--HTNAVQ 579

Query: 64  SVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDG 123
             ++      L +   D  I IW     D   G     E L  ++GH N +  +S   DG
Sbjct: 580 RCSFINKQKQLISCGADGLIKIW-----DCSSG-----ECLKTLDGHNNRLWALSTMNDG 629

Query: 124 CLLATCSRDKSVWIWE 139
            ++ +   D     W+
Sbjct: 630 DMIVSADADGVFQFWK 645

>AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH]
           complement(257969..259858) [1890 bp, 629 aa]
          Length = 629

 Score = 67.0 bits (162), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 61/233 (26%), Positives = 100/233 (42%), Gaps = 18/233 (7%)

Query: 8   SLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAW 67
           +L+ H   ++S+D+ P    L +GS DR +++  L+ G+ +L   ++D      V +VA 
Sbjct: 389 TLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSLTLSIED-----GVTTVAV 443

Query: 68  RPH-SDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLL 126
            P     +AAGS D T+ +W      L E    E EL     GH++ V  + +++DG  +
Sbjct: 444 SPGDGKYIAAGSLDRTVRVWDSETGFLVERLDSENELST---GHKDSVYSVVFTRDGQGV 500

Query: 127 ATCSRDKSVWIWE---TDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRI 183
            + S D+SV +W+    +       C      H   V  V        + S S D  V  
Sbjct: 501 ISGSLDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLF 560

Query: 184 WKDYDDDWECAAVLTGHEGTIW----CSDFSKEEDPIRLCSGSDDSTVRVWKY 232
           W     +     +L GH  ++      + F    D     +GS D   R+WKY
Sbjct: 561 WDTASGN--PLLMLQGHRNSVISVAVVNGFPLGPDVGVFATGSGDCKARIWKY 611

 Score = 61.6 bits (148), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 65/260 (25%), Positives = 109/260 (41%), Gaps = 38/260 (14%)

Query: 10  KLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRP 69
           +L +D V  ++ E   G    G+ D         NG EN   +   +     +RSV + P
Sbjct: 312 RLSDDSVAGVNNEASTGPANNGTAD---------NGGENSATIQPASSSDLYIRSVCFSP 362

Query: 70  HSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATC 129
               LA G+ D  I IW   DL  +       ++L  ++GHE ++  + +   G  L + 
Sbjct: 363 DGKYLATGAEDKLIRIW---DLTTK-------KILMTLQGHEQDIYSLDYFPAGDKLVSG 412

Query: 130 SRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIW----- 184
           S D++V IW+        +C   L          V       +A+ S D TVR+W     
Sbjct: 413 SGDRTVRIWDLRTG----QCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETG 468

Query: 185 ---KDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQ 241
              +  D + E +   TGH+ +++   F++  D   + SGS D +V++W   G +   + 
Sbjct: 469 FLVERLDSENELS---TGHKDSVYSVVFTR--DGQGVISGSLDRSVKLWDLRGLN-GQKS 522

Query: 242 EWVCESTLPNAHRSQIYGVA 261
              CE T    H+  +  VA
Sbjct: 523 HATCEVTY-TGHKDFVLSVA 541

>AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH]
           (328838..331645) [2808 bp, 935 aa]
          Length = 935

 Score = 67.0 bits (162), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 60/232 (25%), Positives = 95/232 (40%), Gaps = 30/232 (12%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVR-------- 63
           H   +WS+D       L T S D+ +K    K  +E +   LD  V K  +         
Sbjct: 466 HTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLG 525

Query: 64  ----SVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISW 119
                V   P    LA    D+T+ ++    LD        M+    + GH+  V  +  
Sbjct: 526 EDLWCVKISPEDRFLAVSLLDNTVKVFF---LD-------SMKFFLSLYGHKLPVLSMDI 575

Query: 120 SQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDD 179
           S D  L+ T S DK++ IW  D      +C   L  H   + +V +  + +   S S D 
Sbjct: 576 SHDSKLIITSSADKNIKIWGLDFG----DCHKSLFAHQDSIMNVKFLPESHNFFSCSKDG 631

Query: 180 TVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWK 231
           TV+ W    + ++C   L GH+G +W    S +   +   S S D ++RVW+
Sbjct: 632 TVKYWD--GNSFDCIQKLYGHQGEVWALAVSSDGQAV--VSVSHDRSIRVWE 679

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 74/174 (42%), Gaps = 18/174 (10%)

Query: 16  VWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHSDLLA 75
           +W +   P    LA    D  +KV  L + K      L    HK  V S+     S L+ 
Sbjct: 528 LWCVKISPEDRFLAVSLLDNTVKVFFLDSMKF----FLSLYGHKLPVLSMDISHDSKLII 583

Query: 76  AGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSV 135
             S D  I IW    LD  +  K    L A    H++ +  + +  +     +CS+D +V
Sbjct: 584 TSSADKNIKIW---GLDFGDCHK---SLFA----HQDSIMNVKFLPESHNFFSCSKDGTV 633

Query: 136 WIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDD 189
             W+    G  ++CI  L  H  +V  +   +    + S S+D ++R+W++ +D
Sbjct: 634 KYWD----GNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWEETED 683

 Score = 44.7 bits (104), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 63/142 (44%), Gaps = 18/142 (12%)

Query: 3   LQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKV--LQLKNGKENLLDVLDDTVHKK 60
           ++   SL  H   V S+D      L+ T S D+ IK+  L   +  ++L        H+ 
Sbjct: 557 MKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLF------AHQD 610

Query: 61  AVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWS 120
           ++ +V + P S    + S D T+  W  +  D           +  + GH+ EV  ++ S
Sbjct: 611 SIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDC----------IQKLYGHQGEVWALAVS 660

Query: 121 QDGCLLATCSRDKSVWIWETDE 142
            DG  + + S D+S+ +WE  E
Sbjct: 661 SDGQAVVSVSHDRSIRVWEETE 682

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 80/190 (42%), Gaps = 30/190 (15%)

Query: 26  GLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRP----------HSDLLA 75
           G + TG+ +  +K  ++K G+  LL  + D +   A+ + A +P           + +LA
Sbjct: 35  GQVITGALEE-VKCWEIKTGE--LLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILA 91

Query: 76  AGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSV 135
            G  D TI IW     D++        +L +   H + +  + + Q G  L + SRD ++
Sbjct: 92  VGYADGTIKIW-----DMQTQT-----VLIVFHSHSSAITILRFDQTGTRLISGSRDATI 141

Query: 136 WIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAA 195
            +W  D   E   C   L+ H +D    +W    + L S S D  +++W       +C  
Sbjct: 142 ILW--DLVAETGLC--KLRSH-KDAITGIWCENDDWLISVSKDGLIKLWD--MKVHQCVE 194

Query: 196 VLTGHEGTIW 205
               H G  W
Sbjct: 195 THMAHTGECW 204

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 79/200 (39%), Gaps = 30/200 (15%)

Query: 91  LDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGE----- 145
            DL     LE     I E H   +  +  + DG  L T S DK+V  W+     E     
Sbjct: 451 FDLASSTMLE----NIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGT 506

Query: 146 ---EYECISVLQEHSQDVKHVVWHTK----HNLLASSSYDDTVRIWKDYDDDWECAAVLT 198
                  + ++ + + D+   +W  K       LA S  D+TV+++  + D  +    L 
Sbjct: 507 LDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVF--FLDSMKFFLSLY 564

Query: 199 GHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIY 258
           GH+  +   D S   D   + + S D  +++W   G D  D     C  +L  AH+  I 
Sbjct: 565 GHKLPVLSMDIS--HDSKLIITSSADKNIKIW---GLDFGD-----CHKSL-FAHQDSIM 613

Query: 259 GVAWSP-SGRIASVGADGVL 277
            V + P S    S   DG +
Sbjct: 614 NVKFLPESHNFFSCSKDGTV 633

 Score = 32.3 bits (72), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 57/132 (43%), Gaps = 19/132 (14%)

Query: 155 EHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLT---GHEGTIWCSDFSK 211
           E   +  ++ +H +  +LA    D T++IW     D +   VL     H   I    F  
Sbjct: 73  EKPAEATYLQYHEETFILAVGYADGTIKIW-----DMQTQTVLIVFHSHSSAITILRF-- 125

Query: 212 EEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASV 271
           ++   RL SGS D+T+ +W  +       +  +C+     +H+  I G+       + SV
Sbjct: 126 DQTGTRLISGSRDATIILWDLVA------ETGLCKL---RSHKDAITGIWCENDDWLISV 176

Query: 272 GADGVLAVYKEK 283
             DG++ ++  K
Sbjct: 177 SKDGLIKLWDMK 188

>AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH]
           (799876..800298,800493..801074) [1005 bp, 334 aa]
          Length = 334

 Score = 65.9 bits (159), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 61/225 (27%), Positives = 95/225 (42%), Gaps = 30/225 (13%)

Query: 58  HKKAVRSVAWRP-HSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKG 116
           H   V S++  P   ++L +GS D T+  W  +  D + G  +        +GH + V+ 
Sbjct: 32  HNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRS-----FKGHSHIVQD 86

Query: 117 ISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSS 176
            + + DG    + S DK++ +W+        +CI     H  DV  V    +   + S+S
Sbjct: 87  CTVTHDGKYALSASWDKTLRLWDLQSG----KCIKRFVGHKSDVMSVSIDPRATQIVSAS 142

Query: 177 YDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFS-----KEEDPIRLCSGSDDSTVRVWK 231
            D TV++W    D   C   L GH    W S+       K +D + + S   D  V+VW 
Sbjct: 143 RDKTVKVWNTVGD---CVVTLLGHND--WVSNVRIAPSEKSDDAVTVISAGMDKVVKVW- 196

Query: 232 YIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRI-ASVGADG 275
                  D Q +  E+     H + +  V  SP G I AS G DG
Sbjct: 197 -------DLQSFTIEADFI-GHNNYVTTVTPSPDGSIFASAGKDG 233

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 63/154 (40%), Gaps = 25/154 (16%)

Query: 3   LQLAKSLKL---HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHK 59
           LQ  K +K    H   V S+  +P    + + S D+ +KV       + ++ +L    H 
Sbjct: 110 LQSGKCIKRFVGHKSDVMSVSIDPRATQIVSASRDKTVKVWNTVG--DCVVTLLG---HN 164

Query: 60  KAVRSVAWRP--HSD----LLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENE 113
             V +V   P   SD    +++AG  D  + +W      +E          A   GH N 
Sbjct: 165 DWVSNVRIAPSEKSDDAVTVISAG-MDKVVKVWDLQSFTIE----------ADFIGHNNY 213

Query: 114 VKGISWSQDGCLLATCSRDKSVWIWETDEAGEEY 147
           V  ++ S DG + A+  +D  + +W  +E    Y
Sbjct: 214 VTTVTPSPDGSIFASAGKDGQIILWNLNEKTALY 247

 Score = 28.9 bits (63), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 56/135 (41%), Gaps = 14/135 (10%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHS 71
           HN+ V ++   P   + A+   D  I +  L   ++  L  LD    K  V +VA+ P+ 
Sbjct: 210 HNNYVTTVTPSPDGSIFASAGKDGQIILWNLN--EKTALYTLD---AKDEVFAVAFSPNR 264

Query: 72  DLLAAGSFDSTISIWTQSDLDLEEGA---KLEMELLAIIEGHENEVKGISWSQDGCLLAT 128
             L A +  S I I+     DLEE      L+ E     +  +     ++WS DG  L  
Sbjct: 265 YWLTAAT-ASGIKIF-----DLEERTIVDDLKPEFAGYNKAQDPHAVSLAWSADGQTLFA 318

Query: 129 CSRDKSVWIWETDEA 143
              D  + +W+   A
Sbjct: 319 GYTDNIIRVWQVMTA 333

>KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces
           cerevisiae YBR198c TAF90 TFIID and SAGA subunit, start
           by similarity
          Length = 826

 Score = 67.0 bits (162), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 71/256 (27%), Positives = 109/256 (42%), Gaps = 43/256 (16%)

Query: 40  LQLKNGKENLLDVLDDTVHKKA--VRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGA 97
           +QLKN + +   V   T H     +  V +   + L AAG  DSTI +W    LD   G+
Sbjct: 477 IQLKNLQTSAPSVCMYTFHNTNGNMTCVEFSDDARLTAAGFQDSTIKVWY---LD---GS 530

Query: 98  KLEMELL---------AIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYE 148
            L+  L          A + GH   V  +++S D   L + S DK+V +W  D     + 
Sbjct: 531 PLQSILPSKAKDQSNSATLVGHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLD----TFT 586

Query: 149 CISVLQEHSQDVKHVVWHTKHNLLA----SSSYDDTVRIWKDYDDDWECAAVLTGHEGTI 204
           C+   + H+    H VW+ K + L     ++S+D T R+W    D      + +GH   +
Sbjct: 587 CLVCYKGHN----HPVWYVKFSPLGHYFITASHDQTARLWS--CDHIYPLRIFSGHLNDV 640

Query: 205 WCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSP 264
            CS F    +   + +GS D T R+W     D            L   H S +  +  SP
Sbjct: 641 DCSTF--HPNGCYVFTGSSDKTCRMWDIQTGD---------SVRLFLGHTSPVTALEVSP 689

Query: 265 SGRIASVGA-DGVLAV 279
            GR  + G+ DG + V
Sbjct: 690 DGRWLTTGSEDGTIIV 705

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 76/182 (41%), Gaps = 31/182 (17%)

Query: 10  KLHNDKVWSIDFEPVRGLLATGSTDRAIK------VLQLKNGKENLLDVLDDTVHKKAVR 63
           K HN  VW + F P+     T S D+  +      +  L+    +L DV   T H     
Sbjct: 592 KGHNHPVWYVKFSPLGHYFITASHDQTARLWSCDHIYPLRIFSGHLNDVDCSTFH----- 646

Query: 64  SVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDG 123
                P+   +  GS D T  +W     D++ G  + + L     GH + V  +  S DG
Sbjct: 647 -----PNGCYVFTGSSDKTCRMW-----DIQTGDSVRLFL-----GHTSPVTALEVSPDG 691

Query: 124 CLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQD-VKHVVWHTKHNLLASSSYDDTVR 182
             L T S D ++ +W+          I  ++ H ++ +  + ++ + N L +   D +VR
Sbjct: 692 RWLTTGSEDGTIIVWDIGTGKR----IKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVR 747

Query: 183 IW 184
           +W
Sbjct: 748 VW 749

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 64/133 (48%), Gaps = 19/133 (14%)

Query: 21  FEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHSDLLAAGSFD 80
           F P    + TGS+D+  ++  ++ G    L +     H   V ++   P    L  GS D
Sbjct: 645 FHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFL----GHTSPVTALEVSPDGRWLTTGSED 700

Query: 81  STISIWTQSDLDLEEGAKLEMELLAIIEGH-ENEVKGISWSQDGCLLATCSRDKSVWIWE 139
            TI +W     D+  G +++      ++GH +N +  I+++++G  L T   D+SV +W+
Sbjct: 701 GTIIVW-----DIGTGKRIKQ-----MKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWD 750

Query: 140 ----TDEAGEEYE 148
               T+E G E E
Sbjct: 751 IKRFTNEPGMEPE 763

>Kwal_23.6429
          Length = 750

 Score = 66.2 bits (160), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 108/243 (44%), Gaps = 25/243 (10%)

Query: 4   QLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVR 63
           ++  +L+ H   ++S+D+ P    L +GS DR +++  L+ G+ +L   ++D      V 
Sbjct: 503 RIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIED-----GVT 557

Query: 64  SVAWRPH-SDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQD 122
           +VA  P    L+AAGS D T+ IW      L E    E EL     GH++ V  + +++D
Sbjct: 558 TVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSENELGT---GHKDSVYSVVFTRD 614

Query: 123 GCLLATCSRDKSVWIWE-------TDEAGEEYECISVLQEHSQDVKHVVWHTKHN-LLAS 174
           G  + + S D+SV +W        T E         V     +D    V  T+++  + S
Sbjct: 615 GHGVVSGSLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFVLSVATTQNDEFILS 674

Query: 175 SSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIR-----LCSGSDDSTVRV 229
            S D  V  W     +     +L GH  ++     + +  P+        +GS D   R+
Sbjct: 675 GSKDRGVLFWDTPSGNPLL--MLQGHRNSVISVAVANDH-PLGPEYGVFATGSGDCKARI 731

Query: 230 WKY 232
           WKY
Sbjct: 732 WKY 734

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 78/177 (44%), Gaps = 27/177 (15%)

Query: 62  VRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQ 121
           +RSV + P    LA G+ D  I IW     DL         ++  ++GHE ++  + +  
Sbjct: 473 IRSVCFSPDGKFLATGAEDKLIRIW-----DLA-----TRRIVMTLQGHEQDIYSLDYFP 522

Query: 122 DGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTV 181
            G  L + S D++V IW+        +C   L          V      L+A+ S D TV
Sbjct: 523 SGDKLVSGSGDRTVRIWDLRTG----QCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTV 578

Query: 182 RIW--------KDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
           RIW        +  D + E     TGH+ +++   F++  D   + SGS D +V++W
Sbjct: 579 RIWDSETGFLVERLDSENELG---TGHKDSVYSVVFTR--DGHGVVSGSLDRSVKLW 630

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 70/158 (44%), Gaps = 20/158 (12%)

Query: 114 VKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLA 173
           ++ + +S DG  LAT + DK + IW+          +  LQ H QD+  + +    + L 
Sbjct: 473 IRSVCFSPDGKFLATGAEDKLIRIWDL----ATRRIVMTLQGHEQDIYSLDYFPSGDKLV 528

Query: 174 SSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYI 233
           S S D TVRIW       +C+  L+  +G    +      D   + +GS D TVR+W   
Sbjct: 529 SGSGDRTVRIWDLR--TGQCSLTLSIEDGVTTVA--VSPGDGKLIAAGSLDRTVRIW--- 581

Query: 234 GDDEDDQQEWVC-----ESTLPNAHRSQIYGVAWSPSG 266
               D +  ++      E+ L   H+  +Y V ++  G
Sbjct: 582 ----DSETGFLVERLDSENELGTGHKDSVYSVVFTRDG 615

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 62/231 (26%), Positives = 101/231 (43%), Gaps = 35/231 (15%)

Query: 16  VWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHSDLLA 75
           + S+ F P    LATG+ D+ I++  L   +     V+    H++ + S+ + P  D L 
Sbjct: 473 IRSVCFSPDGKFLATGAEDKLIRIWDLATRR----IVMTLQGHEQDIYSLDYFPSGDKLV 528

Query: 76  AGSFDSTISIWTQSDLDLEEG-AKLEMELLAIIEGHENEVKGISWSQ-DGCLLATCSRDK 133
           +GS D T+ IW     DL  G   L + +       E+ V  ++ S  DG L+A  S D+
Sbjct: 529 SGSGDRTVRIW-----DLRTGQCSLTLSI-------EDGVTTVAVSPGDGKLIAAGSLDR 576

Query: 134 SVWIWETDEAGEEYECISVLQE----HSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDD 189
           +V IW++ E G   E +    E    H   V  VV+    + + S S D +V++W     
Sbjct: 577 TVRIWDS-ETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSA 635

Query: 190 DWECA----------AVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
           +   A             TGH+  +     ++ ++ I   SGS D  V  W
Sbjct: 636 NGGTAEGKANTAASEVTYTGHKDFVLSVATTQNDEFI--LSGSKDRGVLFW 684

>YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741)
           Coatomer (COPI) complex beta' chain (beta'-COP) of
           secretory pathway vesicles, required for retrograde
           transport from Golgi to endoplasmic reticulum, member of
           the WD (WD-40) repeat family [2670 bp, 889 aa]
          Length = 889

 Score = 66.2 bits (160), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 64/263 (24%), Positives = 119/263 (45%), Gaps = 30/263 (11%)

Query: 7   KSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVA 66
           +S+++    V +  F   +  +  GS D  I+V     G++    V+D   H   +RS+A
Sbjct: 49  RSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEK----VVDFEAHPDYIRSIA 104

Query: 67  WRPHSDLLAAGSFDSTISIWT-QSDLDLEEGAKLEMELLAIIEGHENEVKGISWS-QDGC 124
             P    + +GS D T+ +W  +++  LE+            EGHE+ V  ++++ +D  
Sbjct: 105 VHPTKPYVLSGSDDLTVKLWNWENNWALEQ----------TFEGHEHFVMCVAFNPKDPS 154

Query: 125 LLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIW 184
             A+   D++V +W   ++   +   +  +     V +     K  ++ +S  D T++IW
Sbjct: 155 TFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASD-DLTIKIW 213

Query: 185 KDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWV 244
            DY     C A L GH   +  + F     PI + SGS+D T+++W        +   + 
Sbjct: 214 -DYQTK-SCVATLEGHMSNVSFAVFHPTL-PI-IISGSEDGTLKIW--------NSSTYK 261

Query: 245 CESTLPNAHRSQIYGVAWSPSGR 267
            E TL N    + + +A  P+GR
Sbjct: 262 VEKTL-NVGLERSWCIATHPTGR 283

>Scas_713.50
          Length = 983

 Score = 65.9 bits (159), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 63/245 (25%), Positives = 104/245 (42%), Gaps = 30/245 (12%)

Query: 4   QLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKA-- 61
           Q+A   + H+  +WS+D       L TGS D+++K    +  +E +    D  V K    
Sbjct: 502 QIANIEEAHDAAIWSLDLTSDGKRLITGSADKSVKFWNFQLEQELVPGTSDKFVPKLGLH 561

Query: 62  ----------VRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHE 111
                     + SV   P    LA    D+T+ ++    LD        M+    + GH+
Sbjct: 562 HDTTLELSDDILSVRVSPEDKFLAVSLLDNTVKVFF---LD-------SMKFFLSLYGHK 611

Query: 112 NEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNL 171
             V  I  S D  ++ T S DK++ IW  D  G+ ++ +   Q+   +VK V     HN 
Sbjct: 612 LPVLSIDISFDSKMIITSSADKNIKIWGLD-FGDCHKSLFAHQDSIMNVKFV--PESHNF 668

Query: 172 LASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWK 231
             S S D  ++ W    D +EC   L  H+  +W    +   D   + S S D ++R+W+
Sbjct: 669 F-SCSKDGIIKYWD--GDKFECIQKLAAHQSEVWA--LAIANDASFVVSSSHDHSIRIWE 723

Query: 232 YIGDD 236
              D+
Sbjct: 724 ETEDE 728

 Score = 37.7 bits (86), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 31/70 (44%), Gaps = 4/70 (5%)

Query: 166 HTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDS 225
           H + NLLA    D  V++W  Y     C   L GH   I    F  +    RL SGS DS
Sbjct: 115 HKETNLLAVGYNDGVVKVWDLYSKTVLCN--LNGHSSAITALKF--DTSGTRLISGSRDS 170

Query: 226 TVRVWKYIGD 235
            + VW  + +
Sbjct: 171 NIIVWDLVSE 180

 Score = 32.7 bits (73), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 71/172 (41%), Gaps = 33/172 (19%)

Query: 71  SDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCS 130
           ++LLA G  D  + +W     DL         +L  + GH + +  + +   G  L + S
Sbjct: 118 TNLLAVGYNDGVVKVW-----DLYSKT-----VLCNLNGHSSAITALKFDTSGTRLISGS 167

Query: 131 RDKSVWIWE-TDEAGEEYECISVLQEHSQDVKHVVW---HTKHNL-------LASSSYDD 179
           RD ++ +W+   E G     +  L+ H +D    +W    T +N        L S+S D 
Sbjct: 168 RDSNIIVWDLVSEVG-----LYKLRSH-KDAITGIWCNEVTNNNQEENELDWLISTSKDG 221

Query: 180 TVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWK 231
            ++IW D     +C      H G  W    +   D +   + S DS V+ W+
Sbjct: 222 LIKIW-DLKIQ-QCVETHIAHTGECWS--LAVRNDLV--ITTSSDSQVKFWQ 267

>Kwal_23.6324
          Length = 514

 Score = 65.5 bits (158), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 84/181 (46%), Gaps = 26/181 (14%)

Query: 58  HKKAVRSVAWRPH-SDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKG 116
           H   +   A+ PH S  +  GS D+T  IW     D      +       ++GH N V  
Sbjct: 141 HGSTILCSAFAPHTSGRMVTGSGDNTARIW-----DCNTNTPMY-----TLKGHFNWVLC 190

Query: 117 ISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNL----- 171
           ++W  DG L+AT S D ++ +W++++ GE Y     L+ H++ +  + W   H +     
Sbjct: 191 VAWCPDGELIATGSMDNTIRLWDSNK-GESYG--EALRGHAKWITSLTWEPMHLVKAGDQ 247

Query: 172 --LASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRV 229
             LAS+S D T++IW        C   L+GH  ++ C  +        L SGS D T+R 
Sbjct: 248 PRLASASKDGTIKIWDTTRR--VCVLTLSGHTNSVSCVKWGGRGI---LYSGSHDKTIRA 302

Query: 230 W 230
           W
Sbjct: 303 W 303

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 62/130 (47%), Gaps = 16/130 (12%)

Query: 56  TVHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVK 115
           T H+K V  VA+ P    + + SFD++I +W     D   G       +A   GH   V 
Sbjct: 398 TGHQKLVNHVAFSPDGRYIVSASFDNSIKLW-----DGRNGT-----FIATFRGHVASVY 447

Query: 116 GISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISV-LQEHSQDVKHVVWHTKHNLLAS 174
            ++WS D  LL +CS+D ++ +W+        + +SV L  H+ +V  V W      + S
Sbjct: 448 QVAWSSDCRLLVSCSKDTTLKVWDV-----RTKKLSVDLPGHNDEVYTVDWSVDGKRVCS 502

Query: 175 SSYDDTVRIW 184
           +  D  VRIW
Sbjct: 503 AGKDKMVRIW 512

 Score = 57.4 bits (137), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 74/161 (45%), Gaps = 17/161 (10%)

Query: 72  DLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSR 131
           +L+   S D T+ +W     D  + +K     +  + GH+  V  +++S DG  + + S 
Sbjct: 371 ELMVTASDDFTMYLW-----DPLKASKP----ITRMTGHQKLVNHVAFSPDGRYIVSASF 421

Query: 132 DKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDW 191
           D S+ +W+    G     I+  + H   V  V W +   LL S S D T+++W       
Sbjct: 422 DNSIKLWD----GRNGTFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTK-- 475

Query: 192 ECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKY 232
           + +  L GH   ++  D+S   D  R+CS   D  VR+W +
Sbjct: 476 KLSVDLPGHNDEVYTVDWS--VDGKRVCSAGKDKMVRIWTH 514

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 64/262 (24%), Positives = 113/262 (43%), Gaps = 43/262 (16%)

Query: 25  RGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHSDL-----LAAGSF 79
           RG+L +GS D+ I+   +  G +  +++L    H        W  H  L     L  G+F
Sbjct: 288 RGILYSGSHDKTIRAWDMAAGGK-CINILKSHAH--------WINHLSLNTDYALRVGAF 338

Query: 80  DSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWE 139
           D T      S  +    A    E +A   G   E           L+ T S D ++++W+
Sbjct: 339 DHTGEK-PSSPEEARAKALKNYEKIAKKNGQLEE-----------LMVTASDDFTMYLWD 386

Query: 140 TDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTG 199
             +A +    I+ +  H + V HV +      + S+S+D+++++W   +  +   A   G
Sbjct: 387 PLKASKP---ITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRNGTF--IATFRG 441

Query: 200 HEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYG 259
           H  +++   +S   D   L S S D+T++VW        D +       LP  H  ++Y 
Sbjct: 442 HVASVYQVAWS--SDCRLLVSCSKDTTLKVW--------DVRTKKLSVDLP-GHNDEVYT 490

Query: 260 VAWSPSG-RIASVGADGVLAVY 280
           V WS  G R+ S G D ++ ++
Sbjct: 491 VDWSVDGKRVCSAGKDKMVRIW 512

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 53/122 (43%), Gaps = 25/122 (20%)

Query: 194 AAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLP--- 250
           ++ + GH  TI CS F+      R+ +GS D+T R+W              C +  P   
Sbjct: 135 SSAIAGHGSTILCSAFAPHTSG-RMVTGSGDNTARIWD-------------CNTNTPMYT 180

Query: 251 -NAHRSQIYGVAWSPSGRIASVGA-DGVLAVYKEKQNDSEV------SEWEISATYKAAH 302
              H + +  VAW P G + + G+ D  + ++   + +S        ++W  S T++  H
Sbjct: 181 LKGHFNWVLCVAWCPDGELIATGSMDNTIRLWDSNKGESYGEALRGHAKWITSLTWEPMH 240

Query: 303 TV 304
            V
Sbjct: 241 LV 242

>CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP, hypothetical start
          Length = 500

 Score = 65.1 bits (157), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 101/225 (44%), Gaps = 22/225 (9%)

Query: 3   LQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTV--HKK 60
           L++ ++L+ H+ KV  I +     +L TG  D  I V    +G+     +  +++  H+ 
Sbjct: 244 LEVTQTLQNHDGKVGGIAWTSNDSVLITGGEDHLITVSNRSDGEF----ITSNSIGGHEG 299

Query: 61  AVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWS 120
            +  +   P    +   SFDST  +W     D+E+  +L ++     EGH  E+  +++ 
Sbjct: 300 RITDLQVHPSGKFIGTSSFDSTWRLW-----DIEKQKQLLLQ-----EGHSKELYCLAFQ 349

Query: 121 QDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDT 180
            DG L++T   DK+  IW+        + +S LQ H++ +  + W    + LA+   D  
Sbjct: 350 ADGALVSTAGTDKTAIIWDLRSG----KAVSQLQGHAKTIYCMDWSIDGHTLATGGGDGV 405

Query: 181 VRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDS 225
           + IW     D      +T H+  +    F K  D   + SG D S
Sbjct: 406 ITIWDLRKSD--KLTKITEHKSIVTSLKFDKANDHNLISSGYDRS 448

>Kwal_56.23920
          Length = 937

 Score = 65.5 bits (158), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 64/241 (26%), Positives = 99/241 (41%), Gaps = 34/241 (14%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENL----------LDVLDDTVHKKA 61
           H+  +WS+D       L TGS D+ +     +  +E +          L +  DT  +  
Sbjct: 466 HSGAIWSLDMTTDGKRLVTGSADKTVCFWDFQVEQEPVPGTTDKFNPKLKMFHDTTLELN 525

Query: 62  --VRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISW 119
             V +V   P + LLA    D+T+ ++              M+    + GH+  V  I  
Sbjct: 526 DDVLAVKISPDNRLLAVSLLDNTVKVFFMD----------SMKFFLSLYGHKLPVLSIDI 575

Query: 120 SQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDD 179
           S D  LL T S DK++ IW  D      +C   L  H+  +  VV+  + +   S S D 
Sbjct: 576 SFDSKLLITSSADKNIKIWGLDFG----DCHRSLFAHNDSIMKVVFVPESHNFFSCSKDA 631

Query: 180 TVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDD 239
            V+ W    D +EC   L  H+  +W    S   D   + S S D ++RVW     + DD
Sbjct: 632 LVKYWD--GDKFECIQKLAAHQKEVWTLAIS--SDGRFVVSASHDQSIRVW----SETDD 683

Query: 240 Q 240
           Q
Sbjct: 684 Q 684

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 73/166 (43%), Gaps = 21/166 (12%)

Query: 65  VAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGC 124
           + + P + LLA G  D  I IW     DL     L   +L    GH++ +  +++ Q G 
Sbjct: 81  LQYHPETRLLAVGYNDGAIKIW-----DL-----LSKSVLISFNGHKSAITILTFDQTGT 130

Query: 125 LLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIW 184
            L + SRD  + +W  D  GE    +  L+ H   +   +W      L S+S D  +++W
Sbjct: 131 RLISGSRDSDIIVW--DLVGE--VGLYKLRSHKDSITG-LWCEGEEWLISTSKDGLIKVW 185

Query: 185 KDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
            D     +C      H G  W       ED + + +G+D+  +++W
Sbjct: 186 -DLKVQ-QCVETHVAHVGECWS--MGVHEDLV-ITAGADNQ-IKLW 225

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 63/143 (44%), Gaps = 19/143 (13%)

Query: 3   LQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKV--LQLKNGKENLLDVLDDTVHKK 60
           ++   SL  H   V SID      LL T S D+ IK+  L   +   +L        H  
Sbjct: 557 MKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHRSLF------AHND 610

Query: 61  AVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWS 120
           ++  V + P S    + S D+ +  W        +G K   E +  +  H+ EV  ++ S
Sbjct: 611 SIMKVVFVPESHNFFSCSKDALVKYW--------DGDKF--ECIQKLAAHQKEVWTLAIS 660

Query: 121 QDGCLLATCSRDKSVWIW-ETDE 142
            DG  + + S D+S+ +W ETD+
Sbjct: 661 SDGRFVVSASHDQSIRVWSETDD 683

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 54/133 (40%), Gaps = 24/133 (18%)

Query: 107 IEGHENEVKGISWSQDGCLLATCSRDK-SVWIWETDEAGEEYECISVLQ-EHSQDVKHVV 164
           I GH ++V+ I  S D  LLAT S     +W  +T+     +EC   L  +       VV
Sbjct: 381 IRGHRSDVRAIDISGDNKLLATASNGTLKIWNIKTNSCIRTFECGYALACKFLPGGALVV 440

Query: 165 WHTKHN-----LLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLC 219
             TK        LASS+  +T+                  H G IW  D +   D  RL 
Sbjct: 441 LGTKTGDLHLYDLASSTLLNTIE---------------GAHSGAIWSLDMT--TDGKRLV 483

Query: 220 SGSDDSTVRVWKY 232
           +GS D TV  W +
Sbjct: 484 TGSADKTVCFWDF 496

 Score = 34.3 bits (77), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 38/80 (47%), Gaps = 10/80 (12%)

Query: 159 DVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVL---TGHEGTIWCSDFSKEEDP 215
           +  ++ +H +  LLA    D  ++IW     D    +VL    GH+  I    F  ++  
Sbjct: 77  ETSYLQYHPETRLLAVGYNDGAIKIW-----DLLSKSVLISFNGHKSAITILTF--DQTG 129

Query: 216 IRLCSGSDDSTVRVWKYIGD 235
            RL SGS DS + VW  +G+
Sbjct: 130 TRLISGSRDSDIIVWDLVGE 149

>CAGL0M04279g 469040..471862 highly similar to sp|Q12220
           Saccharomyces cerevisiae YLR129w DIP2 DOM34P-interacting
           protein, start by similarity
          Length = 940

 Score = 65.1 bits (157), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 58/232 (25%), Positives = 94/232 (40%), Gaps = 30/232 (12%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLK----------NGKENLLDVLDDTVHK-- 59
           H+  +WS+D       L TGS D+ ++    +          N    +L +  DT  +  
Sbjct: 469 HDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELD 528

Query: 60  KAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISW 119
             + SV   P    +A    D+T+ ++    LD        M+    + GH+  V  +  
Sbjct: 529 DDILSVVISPDDKFIAVSLLDNTVKVFF---LD-------SMKFFLSLYGHKLPVLSMDI 578

Query: 120 SQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDD 179
           S D  L+ TCS DK++ IW  D      +C   L  H   + +V +  +     S S D 
Sbjct: 579 SYDSKLIVTCSADKNIKIWGLDFG----DCHKSLFAHQDSIMNVKFLPESYNFFSCSKDA 634

Query: 180 TVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWK 231
           TV+ W      +EC   L  H+  +W    S   D   + S   D ++RVW+
Sbjct: 635 TVKYWD--GQKFECIQKLAAHQSEVW--SISVSNDGTFVISTGHDHSIRVWE 682

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 83/191 (43%), Gaps = 20/191 (10%)

Query: 1   MP-LQLAKSLKLH-NDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVH 58
           MP LQL     L  +D + S+   P    +A    D  +KV  L + K      L    H
Sbjct: 514 MPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKF----FLSLYGH 569

Query: 59  KKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGIS 118
           K  V S+     S L+   S D  I IW    LD  +  K    L A    H++ +  + 
Sbjct: 570 KLPVLSMDISYDSKLIVTCSADKNIKIW---GLDFGDCHK---SLFA----HQDSIMNVK 619

Query: 119 WSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYD 178
           +  +     +CS+D +V  W+    G+++ECI  L  H  +V  +        + S+ +D
Sbjct: 620 FLPESYNFFSCSKDATVKYWD----GQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHD 675

Query: 179 DTVRIWKDYDD 189
            ++R+W++ +D
Sbjct: 676 HSIRVWEETED 686

 Score = 51.2 bits (121), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 74/167 (44%), Gaps = 21/167 (12%)

Query: 65  VAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGC 124
           + + P ++LLAAG  D  I IW   DL       +   +L    GH++ +  +++   G 
Sbjct: 85  LKYHPETNLLAAGYADGVIKIW---DL-------ISKTVLISFNGHKSAITVLAFDTTGT 134

Query: 125 LLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIW 184
            L + S+D  + +W  D  GE    +  L+ H +D    +W    N L S+S D  V+IW
Sbjct: 135 RLISASKDSDIIVW--DLVGE--SGLYKLRSH-KDAITGLWCEDENWLISTSKDGLVKIW 189

Query: 185 KDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWK 231
            D     +C      H G  W       ED    CS   DS V++WK
Sbjct: 190 -DLKSQ-QCVETHLAHTGECW--SLGIIEDMAVTCSA--DSQVKLWK 230

 Score = 35.8 bits (81), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 73/175 (41%), Gaps = 37/175 (21%)

Query: 19  IDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTV------HKKAVRSVAWRPHSD 72
           + + P   LLA G  D  IK+           D++  TV      HK A+  +A+     
Sbjct: 85  LKYHPETNLLAAGYADGVIKIW----------DLISKTVLISFNGHKSAITVLAFDTTGT 134

Query: 73  LLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRD 132
            L + S DS I +W   DL  E G       L  +  H++ + G+ W +D   L + S+D
Sbjct: 135 RLISASKDSDIIVW---DLVGESG-------LYKLRSHKDAITGL-WCEDENWLISTSKD 183

Query: 133 KSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTK--HNLLASSSYDDTVRIWK 185
             V IW+     +  +C+     H+ +     W      ++  + S D  V++WK
Sbjct: 184 GLVKIWDL----KSQQCVETHLAHTGE----CWSLGIIEDMAVTCSADSQVKLWK 230

 Score = 33.9 bits (76), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 34/74 (45%), Gaps = 10/74 (13%)

Query: 165 WHTKHNLLASSSYDDTVRIWKDYDDDWECAAVL---TGHEGTIWCSDFSKEEDPIRLCSG 221
           +H + NLLA+   D  ++IW     D     VL    GH+  I    F  +    RL S 
Sbjct: 87  YHPETNLLAAGYADGVIKIW-----DLISKTVLISFNGHKSAITVLAF--DTTGTRLISA 139

Query: 222 SDDSTVRVWKYIGD 235
           S DS + VW  +G+
Sbjct: 140 SKDSDIIVWDLVGE 153

>CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces
           cerevisiae YCR084c TUP1 general transcription repressor,
           hypothetical start
          Length = 643

 Score = 64.7 bits (156), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 62/248 (25%), Positives = 112/248 (45%), Gaps = 43/248 (17%)

Query: 3   LQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLL-DVLDDTVHKKA 61
           ++L ++L LH+  V  + F      LATG  ++  K+ ++  G  NL+ +++DDT     
Sbjct: 309 IELHRTL-LHDSVVCCVKFSNNGEYLATGC-NKTTKIFEVATG--NLVTELVDDTKTGTE 364

Query: 62  -----------VRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGH 110
                      +RSV + P    LA G+ D  I IW     D+ +      +++ ++ GH
Sbjct: 365 DANSASSADLYIRSVCFSPDGKFLATGAEDKLIRIW-----DIAQ-----RKIVMVLRGH 414

Query: 111 ENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHN 170
           E ++  + + Q G  L + S D+++ IW+        +C   L          V     N
Sbjct: 415 EQDIYSLDYFQSGNKLVSGSGDRTIRIWDLHTG----QCSLTLSIEDGVTTVAVSPGNGN 470

Query: 171 LLASSSYDDTVRIW--------KDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGS 222
            +A+ S D TVR+W        +  D + E      GH+ +++   F++  D   + SGS
Sbjct: 471 YVAAGSLDRTVRVWDSNSGFLVERLDSEGETGV---GHKDSVYSVVFTR--DGKNIVSGS 525

Query: 223 DDSTVRVW 230
            D +V++W
Sbjct: 526 LDRSVKLW 533

 Score = 32.0 bits (71), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 55/143 (38%), Gaps = 25/143 (17%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTV---------HKKAV 62
           H D V+S+ F      + +GS DR++K+  L+N           T          HK  V
Sbjct: 505 HKDSVYSVVFTRDGKNIVSGSLDRSVKLWNLRNINGASTSPQPKTEGNCEMTYIGHKDFV 564

Query: 63  RSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQD 122
            SV    +   + +GS D  +  W     D   G  L M     ++GH N V  ++ +  
Sbjct: 565 LSVTTTENDQYILSGSKDRGVIFW-----DKVSGVPLLM-----LQGHRNSVISVAVANG 614

Query: 123 GCL------LATCSRDKSVWIWE 139
             L       AT S D    IW+
Sbjct: 615 KPLGANYNVFATGSGDCKAKIWK 637

>KLLA0C08547g 749737..751284 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 515

 Score = 64.7 bits (156), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 54/181 (29%), Positives = 85/181 (46%), Gaps = 26/181 (14%)

Query: 58  HKKAVRSVAWRPH-SDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKG 116
           H   +   A+ P+ S  +  G+ D+T  IW   D D +         +  ++GH N V  
Sbjct: 142 HGSTILCSAFAPNTSSRMVTGAGDNTACIW---DCDTQT-------RMCTLQGHHNWVLC 191

Query: 117 ISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNL----- 171
            SWS DG L+AT S D ++ +WE+ + G+ Y     L+ HS+ +  + W   H +     
Sbjct: 192 CSWSPDGELIATGSMDNTIRLWESSK-GKPYG--DALRGHSKWITSLSWEPIHLVKPGDK 248

Query: 172 --LASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRV 229
             LA++S D T++IW        C   L GH  ++ C  +  +     L SGS D T+R 
Sbjct: 249 PRLATASKDGTIKIWDTTRR--VCLLTLCGHTSSVSCVKWGGKN---VLYSGSHDKTIRC 303

Query: 230 W 230
           W
Sbjct: 304 W 304

 Score = 60.5 bits (145), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 75/161 (46%), Gaps = 17/161 (10%)

Query: 72  DLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSR 131
           +L+   S D T+ +W               + +  + GH+  V  +++S DG  + + S 
Sbjct: 372 ELMVTASDDFTMYLWNPLK---------STKPITRMTGHQKLVNHVAFSPDGRYIVSASF 422

Query: 132 DKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDW 191
           D S+ +W+    G + + +S  + H   V  V W +   LL S S D T+++W       
Sbjct: 423 DNSIKLWD----GRDGKFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTR-- 476

Query: 192 ECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKY 232
           + +  L GH+  ++  D+S   D  R+CSG  D  VR+W +
Sbjct: 477 KLSVDLPGHQDEVYTVDWS--VDGKRVCSGGKDKMVRIWTH 515

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/166 (29%), Positives = 76/166 (45%), Gaps = 22/166 (13%)

Query: 20  DFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHSDLLAAGSF 79
           DFE    L+ T S D     + L N  ++   +   T H+K V  VA+ P    + + SF
Sbjct: 369 DFEE---LMVTASDDF---TMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRYIVSASF 422

Query: 80  DSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWE 139
           D++I +W     D  +G     + L+   GH   V  ++WS D  LL +CS+D ++ +W+
Sbjct: 423 DNSIKLW-----DGRDG-----KFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWD 472

Query: 140 TDEAGEEYECISV-LQEHSQDVKHVVWHTKHNLLASSSYDDTVRIW 184
                 +   +SV L  H  +V  V W      + S   D  VRIW
Sbjct: 473 V-----KTRKLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKMVRIW 513

 Score = 53.9 bits (128), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 87/372 (23%), Positives = 146/372 (39%), Gaps = 87/372 (23%)

Query: 8   SLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAW 67
           +L+ H++ V    + P   L+ATGS D  I++ +   GK    D L    H K + S++W
Sbjct: 181 TLQGHHNWVLCCSWSPDGELIATGSMDNTIRLWESSKGKP-YGDALRG--HSKWITSLSW 237

Query: 68  RP-------HSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWS 120
            P           LA  S D TI IW  +              L  + GH + V  + W 
Sbjct: 238 EPIHLVKPGDKPRLATASKDGTIKIWDTT----------RRVCLLTLCGHTSSVSCVKWG 287

Query: 121 QDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKH----------- 169
               +L + S DK++  W+ +  G   +CI++L+ H+  V H+   T +           
Sbjct: 288 GKN-VLYSGSHDKTIRCWDMNLNG---KCINILKSHAHWVNHLSLSTDYALRLGAFDHKG 343

Query: 170 ----------------------------NLLASSSYDDTVRIWKDYDDDWECAAVLTGHE 201
                                        L+ ++S D T+ +W       +    +TGH+
Sbjct: 344 ETPASPEEAQQKALKNYEKVAKRKGDFEELMVTASDDFTMYLWNPLKST-KPITRMTGHQ 402

Query: 202 GTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVA 261
             +    FS   D   + S S D+++++W        D ++    ST    H + +Y VA
Sbjct: 403 KLVNHVAFS--PDGRYIVSASFDNSIKLW--------DGRDGKFLSTF-RGHVASVYQVA 451

Query: 262 WSPSGR-IASVGADGVLAVYKEKQNDSEVSEWEISATYKAAHTVYEINTVKWVNIDGKEM 320
           WS   R + S   D  L V+       +V   ++S          E+ TV W ++DGK  
Sbjct: 452 WSSDCRLLVSCSKDTTLKVW-------DVKTRKLSVDLPGHQD--EVYTVDW-SVDGKR- 500

Query: 321 LITAGDDGRVNL 332
           + + G D  V +
Sbjct: 501 VCSGGKDKMVRI 512

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 71/320 (22%), Positives = 132/320 (41%), Gaps = 77/320 (24%)

Query: 8   SLKLHNDKVWSIDFEPV-------RGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKK 60
           +L+ H+  + S+ +EP+       +  LAT S D  IK+          + +L    H  
Sbjct: 224 ALRGHSKWITSLSWEPIHLVKPGDKPRLATASKDGTIKIWD----TTRRVCLLTLCGHTS 279

Query: 61  AVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWS 120
           +V  V W    ++L +GS D TI  W   D++L        + + I++ H + V  +S S
Sbjct: 280 SVSCVKWG-GKNVLYSGSHDKTIRCW---DMNLNG------KCINILKSHAHWVNHLSLS 329

Query: 121 QDGCL---------------------------------------LATCSRDKSVWIWETD 141
            D  L                                       + T S D ++++W   
Sbjct: 330 TDYALRLGAFDHKGETPASPEEAQQKALKNYEKVAKRKGDFEELMVTASDDFTMYLWNPL 389

Query: 142 EAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHE 201
           ++ +    I+ +  H + V HV +      + S+S+D+++++W   D  +   +   GH 
Sbjct: 390 KSTKP---ITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKF--LSTFRGHV 444

Query: 202 GTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVA 261
            +++   +S   D   L S S D+T++VW        D +       LP  H+ ++Y V 
Sbjct: 445 ASVYQVAWS--SDCRLLVSCSKDTTLKVW--------DVKTRKLSVDLP-GHQDEVYTVD 493

Query: 262 WSPSG-RIASVGADGVLAVY 280
           WS  G R+ S G D ++ ++
Sbjct: 494 WSVDGKRVCSGGKDKMVRIW 513

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 64/146 (43%), Gaps = 26/146 (17%)

Query: 194 AAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAH 253
           ++ + GH  TI CS F+      R+ +G+ D+T  +W      + D Q  +C  TL   H
Sbjct: 136 SSAIAGHGSTILCSAFAPNTSS-RMVTGAGDNTACIW------DCDTQTRMC--TL-QGH 185

Query: 254 RSQIYGVAWSPSGRIASVGA-DGVLAVYKEKQNDSEV------SEWEISATYKAAHTVYE 306
            + +   +WSP G + + G+ D  + +++  +           S+W  S +++  H V  
Sbjct: 186 HNWVLCCSWSPDGELIATGSMDNTIRLWESSKGKPYGDALRGHSKWITSLSWEPIHLVKP 245

Query: 307 INTVKWVNIDGKEMLITAGDDGRVNL 332
            +         K  L TA  DG + +
Sbjct: 246 GD---------KPRLATASKDGTIKI 262

>CAGL0H08932g join(871668..871685,872089..874779) highly similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
          Length = 902

 Score = 64.7 bits (156), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 67/266 (25%), Positives = 118/266 (44%), Gaps = 30/266 (11%)

Query: 4   QLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVR 63
           Q  +S+++ +  V +  F   +  +  GS D  ++V     G++    V D   H   +R
Sbjct: 46  QEVRSIQVTDTPVRAGKFITRKNWIVVGSDDNKVRVFNYNTGEK----VADFVAHPDYIR 101

Query: 64  SVAWRPHSDLLAAGSFDSTISIWT-QSDLDLEEGAKLEMELLAIIEGHENEVKGISWS-Q 121
           S+A  P    +  GS D T+ +W  ++D  LE+  K          GHE+ V  ++++ +
Sbjct: 102 SIAVHPSKPYILTGSDDLTVKLWNWENDWSLEQTFK----------GHEHFVMCVAFNPK 151

Query: 122 DGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTV 181
           D  + A+   D  V +W   ++   +   +  ++    V +     K  ++ SS  D TV
Sbjct: 152 DPNVFASGCLDHKVKVWSLGQSTPNFTLHTGQEKGVNYVDYYPLPDKPYMITSSD-DTTV 210

Query: 182 RIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQ 241
           +I+ DY     C A L GH   +  + F     PI + SGS+D TV++W        +  
Sbjct: 211 KIF-DYQTK-SCVATLEGHMSNVSFAVFHPTL-PI-IISGSEDGTVKLW--------NSS 258

Query: 242 EWVCESTLPNAHRSQIYGVAWSPSGR 267
            +  E TL N    + + +A  P GR
Sbjct: 259 TYKLEKTL-NLGLERSWCIATHPVGR 283

>Scas_624.11
          Length = 1205

 Score = 64.3 bits (155), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 76/175 (43%), Gaps = 24/175 (13%)

Query: 63  RSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQD 122
           + +A+ P    +    F STI +W     D   G      LL   E HE  V+ + +   
Sbjct: 15  KGIAFHPSRPWVLVALFSSTIQLW-----DYRMGT-----LLHRFEDHEGPVRSVDFHPT 64

Query: 123 GCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVR 182
             +  +   D ++ +W      E  +C+  L  H   ++ V +H +   + S+S D T+R
Sbjct: 65  QPIFVSGGDDYTIKVWSL----ETNKCLYTLNGHLDYIRTVFFHKELPWIISASDDQTIR 120

Query: 183 IWKDYDDDWEC---AAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIG 234
           IW     +W+     A LTGH   + C+ F   +D +   S S D T+RVW   G
Sbjct: 121 IW-----NWQNRKEIACLTGHNHFVMCAQFHPTDDLV--VSASLDETIRVWDISG 168

 Score = 63.2 bits (152), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 71/291 (24%), Positives = 122/291 (41%), Gaps = 58/291 (19%)

Query: 19  IDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHSDLLAAGS 78
           I F P R  +        I++   + G   LL   +D  H+  VRSV + P   +  +G 
Sbjct: 17  IAFHPSRPWVLVALFSSTIQLWDYRMG--TLLHRFED--HEGPVRSVDFHPTQPIFVSGG 72

Query: 79  FDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIW 138
            D TI +W+     LE       + L  + GH + ++ + + ++   + + S D+++ IW
Sbjct: 73  DDYTIKVWS-----LETN-----KCLYTLNGHLDYIRTVFFHKELPWIISASDDQTIRIW 122

Query: 139 ETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIW-------------- 184
                 E    I+ L  H+  V    +H   +L+ S+S D+T+R+W              
Sbjct: 123 NWQNRKE----IACLTGHNHFVMCAQFHPTDDLVVSASLDETIRVWDISGLRKKHSAPGT 178

Query: 185 KDYDDDW------------ECAA--VLTGH-EGTIWCSDFSKEEDPIRLCSGSDDSTVRV 229
             +DD              +C    +L GH  G  W S       P+ + SGSDD  V++
Sbjct: 179 STFDDQMAAQQNLLDGGFGDCVVKFILEGHTRGVNWAS--FHPTLPM-IVSGSDDRQVKL 235

Query: 230 WKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGR-IASVGADGVLAV 279
           WKY     +  + W  ++     H + +  V + P+ + I SVG D  L +
Sbjct: 236 WKY-----NSTKAWEVDTC--RGHTNNVDCVIFHPTQKFILSVGEDKTLRI 279

 Score = 33.5 bits (75), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 50/243 (20%), Positives = 90/243 (37%), Gaps = 50/243 (20%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKV-----LQLKN-------------GKENLLDV- 52
           HN  V    F P   L+ + S D  I+V     L+ K+              ++NLLD  
Sbjct: 136 HNHFVMCAQFHPTDDLVVSASLDETIRVWDISGLRKKHSAPGTSTFDDQMAAQQNLLDGG 195

Query: 53  LDDTV-------HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLA 105
             D V       H + V   ++ P   ++ +GS D  + +W  +     E        + 
Sbjct: 196 FGDCVVKFILEGHTRGVNWASFHPTLPMIVSGSDDRQVKLWKYNSTKAWE--------VD 247

Query: 106 IIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKH--V 163
              GH N V  + +      + +   DK++ IW+ D+       I V Q   ++ +   +
Sbjct: 248 TCRGHTNNVDCVIFHPTQKFILSVGEDKTLRIWDLDKR------IPVKQFKRENDRFWLI 301

Query: 164 VWHTKHNLLASSSYDDTVRIWKDYDDDWECAA------VLTGHEGTIWCSDFSKEEDPIR 217
             H   NL   +++D  + ++K  D +  C        +    E  +   DF K+   + 
Sbjct: 302 ASHPNINLFG-AAHDAGIMVFK-LDRERPCNVIYQNQLIFVNKEKHVQMFDFQKKVASLP 359

Query: 218 LCS 220
             S
Sbjct: 360 FAS 362

>Kwal_27.12053
          Length = 755

 Score = 64.3 bits (155), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 60/214 (28%), Positives = 90/214 (42%), Gaps = 27/214 (12%)

Query: 73  LLAAGSFDSTISIWT------QSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLL 126
           L AAG  DS I IW+      ++ L  ++G +   E L    GH   V   S+S D   L
Sbjct: 441 LAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETLV---GHSGTVYSTSFSPDNRYL 497

Query: 127 ATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKD 186
            + S DK+V +W TD     Y  +   + H+  +  V +    +  A++S+D T R+W  
Sbjct: 498 LSASEDKTVRLWSTD----TYTSLVNYKGHNHPIWDVAFSPLGHYFATASHDQTARLWS- 552

Query: 187 YDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCE 246
             D      +  GH   +    F    +   + +GS D T R+W     D          
Sbjct: 553 -CDHIYPLRIFAGHLNDVDTVSF--HPNGTYVFTGSSDKTCRMWDITSGD---------S 600

Query: 247 STLPNAHRSQIYGVAWSPSGRIASVGA-DGVLAV 279
             L   H + +   A SP GR  S G+ DGV+ V
Sbjct: 601 VRLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINV 634

 Score = 61.2 bits (147), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 74/307 (24%), Positives = 125/307 (40%), Gaps = 48/307 (15%)

Query: 15  KVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHSDLL 74
           K+WS+D EP++  L +   +R           E L+       H   V S ++ P +  L
Sbjct: 452 KIWSLDGEPLKNKLPSKQGERT--------NNETLVG------HSGTVYSTSFSPDNRYL 497

Query: 75  AAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKS 134
            + S D T+ +W+                L   +GH + +  +++S  G   AT S D++
Sbjct: 498 LSASEDKTVRLWSTD----------TYTSLVNYKGHNHPIWDVAFSPLGHYFATASHDQT 547

Query: 135 VWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECA 194
             +W  D        + +   H  DV  V +H     + + S D T R+W     D    
Sbjct: 548 ARLWSCD----HIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGD--SV 601

Query: 195 AVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHR 254
            +  GH   +  +  S   D   L +GS+D  + VW  IG  +  +Q       +    +
Sbjct: 602 RLFLGHTAPVTSTAVS--PDGRWLSTGSEDGVINVWD-IGTGKRLKQ-------MRGHGK 651

Query: 255 SQIYGVAWSPSGRI-ASVGADGVLAVYKEKQNDSEV-SEWEISATYKAAHTVYEINTVKW 312
           + +Y +++S  G +  S GAD  + V+  K++ +E  SE E         T Y  +    
Sbjct: 652 NAVYSLSYSKEGHVLISGGADHSVRVWDVKKSTAEPGSEPE------QPFTGYSGDVTSS 705

Query: 313 VNIDGKE 319
           VN D KE
Sbjct: 706 VNQDIKE 712

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/203 (22%), Positives = 87/203 (42%), Gaps = 23/203 (11%)

Query: 10  KLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRP 69
           K HN  +W + F P+    AT S D+  ++       +++  +     H   V +V++ P
Sbjct: 521 KGHNHPIWDVAFSPLGHYFATASHDQTARLWSC----DHIYPLRIFAGHLNDVDTVSFHP 576

Query: 70  HSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATC 129
           +   +  GS D T  +W     D+  G  + + L     GH   V   + S DG  L+T 
Sbjct: 577 NGTYVFTGSSDKTCRMW-----DITSGDSVRLFL-----GHTAPVTSTAVSPDGRWLSTG 626

Query: 130 SRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKH-NLLASSSYDDTVRIW---- 184
           S D  + +W+        + +  ++ H ++  + + ++K  ++L S   D +VR+W    
Sbjct: 627 SEDGVINVWDIGTG----KRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDVKK 682

Query: 185 KDYDDDWECAAVLTGHEGTIWCS 207
              +   E     TG+ G +  S
Sbjct: 683 STAEPGSEPEQPFTGYSGDVTSS 705

>Sklu_2173.2 YCR072C, Contig c2173 2732-4279
          Length = 515

 Score = 63.9 bits (154), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 85/181 (46%), Gaps = 26/181 (14%)

Query: 58  HKKAVRSVAWRPH-SDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKG 116
           H   +   A+ PH S  +  G+ D+T  IW   D + +         ++ ++GH N V  
Sbjct: 142 HGSTILCSAFAPHTSSRMITGAGDNTARIW---DCNTQTP-------MSTLKGHFNWVLC 191

Query: 117 ISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNL----- 171
           +SWS DG L+AT S D ++ +WE ++     +    L+ H + +  + W   H +     
Sbjct: 192 VSWSPDGELIATGSMDNTIRLWEGNKGQPVGD---ALRGHGKWITSLSWEPIHLVKPGQK 248

Query: 172 --LASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRV 229
             LAS+S D T++IW        C   L+GH  ++ C  +  +     L SGS D T+R 
Sbjct: 249 PRLASASKDGTIKIWDTTRR--VCLITLSGHTSSVSCIKWGGQG---VLYSGSHDKTIRA 303

Query: 230 W 230
           W
Sbjct: 304 W 304

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 74/161 (45%), Gaps = 17/161 (10%)

Query: 72  DLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSR 131
           +L+   S D T+ +W               + +  + GH+  V  +++S DG  + + S 
Sbjct: 372 ELMVTASDDFTMYLWNPLK---------STKPITRMTGHQKLVNHVAFSPDGRHIVSASF 422

Query: 132 DKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDW 191
           D S+ +W     G + + IS  + H   V  V W +   LL S S D T+++W       
Sbjct: 423 DNSIKLWN----GRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTK-- 476

Query: 192 ECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKY 232
           + A  L GH+  ++  D+S   D  R+CSG  D  VR+W +
Sbjct: 477 KLAVDLPGHKDEVYTVDWS--VDGKRVCSGGKDKMVRLWTH 515

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 69/161 (42%), Gaps = 17/161 (10%)

Query: 24  VRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHSDLLAAGSFDSTI 83
           V  L+ T S D     + L N  ++   +   T H+K V  VA+ P    + + SFD++I
Sbjct: 370 VEELMVTASDDF---TMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRHIVSASFDNSI 426

Query: 84  SIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEA 143
            +W   D           + ++   GH   V  ++WS D  LL +CS+D ++ +W+    
Sbjct: 427 KLWNGRD----------GKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTK 476

Query: 144 GEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIW 184
               +    L  H  +V  V W      + S   D  VR+W
Sbjct: 477 KLAVD----LPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 54.7 bits (130), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 62/262 (23%), Positives = 116/262 (44%), Gaps = 43/262 (16%)

Query: 25  RGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHSDL-----LAAGSF 79
           +G+L +GS D+ I+   +  G +  +++L    H        W  H  L     L  G+F
Sbjct: 289 QGVLYSGSHDKTIRAWDMNLGGK-CINILKSHAH--------WVNHLSLSTDYALRIGAF 339

Query: 80  DSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWE 139
           D T    ++     EE  K  ++    I     EV+         L+ T S D ++++W 
Sbjct: 340 DHT----SEKPSTPEEAQKRALKNYEKIAKRNGEVEE--------LMVTASDDFTMYLWN 387

Query: 140 TDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTG 199
             ++ +    I+ +  H + V HV +      + S+S+D+++++W   D  +   +   G
Sbjct: 388 PLKSTKP---ITRMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWNGRDGKF--ISTFRG 442

Query: 200 HEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYG 259
           H  +++   +S   D   L S S D+T++VW        D +       LP  H+ ++Y 
Sbjct: 443 HVASVYQVAWS--SDCRLLVSCSKDTTLKVW--------DVKTKKLAVDLP-GHKDEVYT 491

Query: 260 VAWSPSG-RIASVGADGVLAVY 280
           V WS  G R+ S G D ++ ++
Sbjct: 492 VDWSVDGKRVCSGGKDKMVRLW 513

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 39/80 (48%), Gaps = 10/80 (12%)

Query: 194 AAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAH 253
           ++ + GH  TI CS F+      R+ +G+ D+T R+W        D       STL   H
Sbjct: 136 SSAIAGHGSTILCSAFAPHTSS-RMITGAGDNTARIW--------DCNTQTPMSTL-KGH 185

Query: 254 RSQIYGVAWSPSGRIASVGA 273
            + +  V+WSP G + + G+
Sbjct: 186 FNWVLCVSWSPDGELIATGS 205

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 53/120 (44%), Gaps = 15/120 (12%)

Query: 166 HTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDS 225
           HT   ++  +  D+T RIW    +     + L GH   + C  +S + + I   +GS D+
Sbjct: 154 HTSSRMITGAG-DNTARIWDC--NTQTPMSTLKGHFNWVLCVSWSPDGELI--ATGSMDN 208

Query: 226 TVRVW-----KYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVY 280
           T+R+W     + +GD      +W+   +        I+ V      R+AS   DG + ++
Sbjct: 209 TIRLWEGNKGQPVGDALRGHGKWITSLSW-----EPIHLVKPGQKPRLASASKDGTIKIW 263

>YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and
           component of the SCF-Cdc4p complex
           (Skp1p-Cdc53p-Cdc34p-Cdc4p) which targets Sic1p, Far1p,
           Cdc6p, Ctf13p and Gcn4p for ubiquitin-dependent
           degradation, has WD (WD-40) repeats [2340 bp, 779 aa]
          Length = 779

 Score = 63.9 bits (154), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 66/264 (25%), Positives = 118/264 (44%), Gaps = 45/264 (17%)

Query: 30  TGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQS 89
           TG+ D+ I+V    N K     +L  + H   V ++ +  H  +L +GS D T+ +W   
Sbjct: 397 TGADDKMIRVYDSINKKF----LLQLSGHDGGVWALKY-AHGGILVSGSTDRTVRVW--- 448

Query: 90  DLDLEEGAKLEMELLAIIEGHENEVK--GISWSQDGCLLATCSRDKSVWIWE------TD 141
             D+++G         + +GH + V+   I   ++   + T SRD ++ +W+        
Sbjct: 449 --DIKKGCCTH-----VFKGHNSTVRCLDIVEYKNIKYIVTGSRDNTLHVWKLPKESSVP 501

Query: 142 EAGEEYE-------------CISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYD 188
           + GEE++              + VL+ H   V+ V  H   N++ S SYD+T+ +W    
Sbjct: 502 DHGEEHDYPLVFHTPEENPYFVGVLRGHMASVRTVSGHG--NIVVSGSYDNTLIVWDV-- 557

Query: 189 DDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCEST 248
              +C  +L+GH   I+ + +  E    R  S S D+T+R+W       + +  +   S 
Sbjct: 558 AQMKCLYILSGHTDRIYSTIYDHERK--RCISASMDTTIRIWDLENIWNNGECSYATNSA 615

Query: 249 LPNAHRSQIYGVAWSPSGRIASVG 272
            P A   +I G  ++  G  A VG
Sbjct: 616 SPCA---KILGAMYTLQGHTALVG 636

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 57/256 (22%), Positives = 106/256 (41%), Gaps = 50/256 (19%)

Query: 9   LKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWR 68
           L  H+  VW++ +    G+L +GSTDR ++V  +K G      V     H   VR +   
Sbjct: 418 LSGHDGGVWALKYAH-GGILVSGSTDRTVRVWDIKKGC--CTHVFKG--HNSTVRCLDIV 472

Query: 69  PHSDL--LAAGSFDSTISIW------TQSDLDLEEGAKLEME-------LLAIIEGHENE 113
            + ++  +  GS D+T+ +W      +  D   E    L           + ++ GH   
Sbjct: 473 EYKNIKYIVTGSRDNTLHVWKLPKESSVPDHGEEHDYPLVFHTPEENPYFVGVLRGHMAS 532

Query: 114 VKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLA 173
           V+ +S    G ++ + S D ++ +W+      + +C+ +L  H+  +   ++  +     
Sbjct: 533 VRTVS--GHGNIVVSGSYDNTLIVWDV----AQMKCLYILSGHTDRIYSTIYDHERKRCI 586

Query: 174 SSSYDDTVRIWKDYDDDWE-------------CAAV------LTGHEGTIWCSDFSKEED 214
           S+S D T+RIW D ++ W              CA +      L GH   +     S +  
Sbjct: 587 SASMDTTIRIW-DLENIWNNGECSYATNSASPCAKILGAMYTLQGHTALVGLLRLSDK-- 643

Query: 215 PIRLCSGSDDSTVRVW 230
              L S + D ++R W
Sbjct: 644 --FLVSAAADGSIRGW 657

>CAGL0J10340g complement(1008637..1009653) highly similar to
           sp|P53011 Saccharomyces cerevisiae YGL100w SEH1 nuclear
           pore protein, start by similarity
          Length = 338

 Score = 62.8 bits (151), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 57/246 (23%), Positives = 113/246 (45%), Gaps = 32/246 (13%)

Query: 109 GHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTK 168
           GHE+ V  +++   G  +ATCS D+ + +++ D+    +E     + H   +  + W + 
Sbjct: 7   GHEDIVHDVAYDFYGRTMATCSSDQHIKVFKLDKDATRWEVNDSWRAHDSSIVSLDWASP 66

Query: 169 H--NLLASSSYDDTVRIWKDYDDDWECAA-------VLTGHEGTIWCSDFSKEEDPIRLC 219
               ++AS+SYD T++IW++  +  EC+         L   +G+++C  F+     +R+ 
Sbjct: 67  EYGRIIASASYDKTIKIWEEDPNQEECSGRRWTRLCTLNDSKGSLYCVKFAPSHLGLRIA 126

Query: 220 SGSDDSTVRVWKYIGDDEDDQQEWVCES---TLPNAHRSQI---YGVAW-----SPSGRI 268
           S  +D  +R++  +  D  + + W   +    LP A  + +   +G++W     SP  +I
Sbjct: 127 SIGNDGIMRMYDAL--DPSNLRSWTMTAEVKVLPVAPANNLQSAFGLSWCFTRFSPE-KI 183

Query: 269 ASVGADGVLAVYKEKQNDSEVSEWEISATYKAAHTVYEINTVKWVNIDGK--EMLITAGD 326
           A    D   A   ++  D    +    A     HT   I ++ W  + G+   ++ T   
Sbjct: 184 AVCALDQ--AYIYQRGKDGHFYQ----AGKLPGHTSL-IRSISWAPLIGRPYHLIATGCK 236

Query: 327 DGRVNL 332
           DGRV +
Sbjct: 237 DGRVRI 242

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 84/188 (44%), Gaps = 34/188 (18%)

Query: 1   MPLQLAKSLKLHNDKVWSID-FEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHK 59
           +P+  A +L+      W    F P +  +A  + D+A    + K+G       L    H 
Sbjct: 157 LPVAPANNLQSAFGLSWCFTRFSPEK--IAVCALDQAYIYQRGKDGHFYQAGKLPG--HT 212

Query: 60  KAVRSVAWRP----HSDLLAAGSFDSTISIWT---------------QSDLDLE-EGAK- 98
             +RS++W P       L+A G  D  + I+                  D ++E +G K 
Sbjct: 213 SLIRSISWAPLIGRPYHLIATGCKDGRVRIFRVNDSPSKSNTPNLSDSDDYNMEDQGIKQ 272

Query: 99  ------LEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISV 152
                 LE+ELL+  + H+ EV  +SW+  G +L++   D  V +W++  +  EY+C+S+
Sbjct: 273 RQNNTDLEVELLSEHDDHKGEVWSVSWNLTGTILSSTGEDGKVRLWKSTYS-NEYKCMSI 331

Query: 153 LQEHSQDV 160
           +    QD+
Sbjct: 332 ITS-KQDI 338

 Score = 30.4 bits (67), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 47/88 (53%), Gaps = 7/88 (7%)

Query: 12 HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDT--VHKKAVRSVAWRP 69
          H D V  + ++     +AT S+D+ IKV +L   K+     ++D+   H  ++ S+ W  
Sbjct: 8  HEDIVHDVAYDFYGRTMATCSSDQHIKVFKLD--KDATRWEVNDSWRAHDSSIVSLDWAS 65

Query: 70 --HSDLLAAGSFDSTISIWTQSDLDLEE 95
            +  ++A+ S+D TI IW + D + EE
Sbjct: 66 PEYGRIIASASYDKTIKIW-EEDPNQEE 92

>AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)
           [1542 bp, 513 aa]
          Length = 513

 Score = 62.8 bits (151), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 72/158 (45%), Gaps = 17/158 (10%)

Query: 27  LLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHSDLLAAGSFDSTISIW 86
           L+ TGS D  + +     G + +L +   T H+K V  VA+ P    + + SFD++I +W
Sbjct: 371 LMVTGSDDFTMYLWNPLKGSKPILRM---TGHQKLVNHVAFSPDGRYIVSASFDNSIKLW 427

Query: 87  TQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEE 146
              D           + +A   GH   V  ++WS D  LL +CS+D ++ +W+     + 
Sbjct: 428 DGRD----------GKFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDV----KT 473

Query: 147 YECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIW 184
            +    L  H+ +V  V W      + S   D  VR+W
Sbjct: 474 RKLTVDLPGHNDEVYTVDWSVDGKRVCSGGKDKMVRLW 511

 Score = 62.8 bits (151), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 78/161 (48%), Gaps = 17/161 (10%)

Query: 72  DLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSR 131
           +L+  GS D T+ +W     +  +G+K  + +     GH+  V  +++S DG  + + S 
Sbjct: 370 ELMVTGSDDFTMYLW-----NPLKGSKPILRM----TGHQKLVNHVAFSPDGRYIVSASF 420

Query: 132 DKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDW 191
           D S+ +W+    G + + I+  + H   V  V W +   LL S S D T+++W       
Sbjct: 421 DNSIKLWD----GRDGKFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTR-- 474

Query: 192 ECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKY 232
           +    L GH   ++  D+S   D  R+CSG  D  VR+W +
Sbjct: 475 KLTVDLPGHNDEVYTVDWS--VDGKRVCSGGKDKMVRLWTH 513

 Score = 61.6 bits (148), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 84/181 (46%), Gaps = 26/181 (14%)

Query: 58  HKKAVRSVAWRPH-SDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKG 116
           H   +   A+ PH S  +  G+ D+T  IW   D D +         L  ++GH N V  
Sbjct: 140 HGATILCSAFAPHTSSRMVTGAGDNTARIW---DCDTQTP-------LCTLKGHSNWVLC 189

Query: 117 ISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNL----- 171
           ++WS DG ++AT S D ++ +W++ E G+       L+ H++ +  + W   H +     
Sbjct: 190 VAWSADGEVIATGSMDATIRLWDS-EKGQSLG--DALRGHTKWITSLSWEPIHLVKPGEK 246

Query: 172 --LASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRV 229
             LAS+S D T++IW        C   L+GH  ++ C  +        L S S D TVR 
Sbjct: 247 PRLASASKDGTIKIWDTTRR--VCIYTLSGHTSSVSCIKWGGRN---VLYSASHDRTVRC 301

Query: 230 W 230
           W
Sbjct: 302 W 302

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 63/262 (24%), Positives = 108/262 (41%), Gaps = 43/262 (16%)

Query: 25  RGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHSDL-----LAAGSF 79
           R +L + S DR ++   +  G +  +++L    H        W  H  L     L  G F
Sbjct: 287 RNVLYSASHDRTVRCWDMAAGGK-CINILKSHAH--------WVNHLSLSTDYALRMGPF 337

Query: 80  DSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWE 139
           D T      S  D +  A    E +A   G   E           L+ T S D ++++W 
Sbjct: 338 DHT-GTKPASPEDAQARALRNYEKVAKKNGTMEE-----------LMVTGSDDFTMYLWN 385

Query: 140 TDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTG 199
             +  +    I  +  H + V HV +      + S+S+D+++++W   D  +   A   G
Sbjct: 386 PLKGSKP---ILRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKF--IATFRG 440

Query: 200 HEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYG 259
           H  +++   +S   D   L S S D+T++VW        D +       LP  H  ++Y 
Sbjct: 441 HVASVYQVAWS--SDCRLLVSCSKDTTLKVW--------DVKTRKLTVDLP-GHNDEVYT 489

Query: 260 VAWSPSG-RIASVGADGVLAVY 280
           V WS  G R+ S G D ++ ++
Sbjct: 490 VDWSVDGKRVCSGGKDKMVRLW 511

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 41/80 (51%), Gaps = 10/80 (12%)

Query: 194 AAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAH 253
           ++ + GH  TI CS F+      R+ +G+ D+T R+W      + D Q  +C  TL   H
Sbjct: 134 SSAIAGHGATILCSAFAPHTSS-RMVTGAGDNTARIW------DCDTQTPLC--TL-KGH 183

Query: 254 RSQIYGVAWSPSGRIASVGA 273
            + +  VAWS  G + + G+
Sbjct: 184 SNWVLCVAWSADGEVIATGS 203

>CAGL0E00561g 49750..52260 some similarities with sp|P16649
           Saccharomyces cerevisiae YCR084c TUP1, hypothetical
           start
          Length = 836

 Score = 62.8 bits (151), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 64/239 (26%), Positives = 97/239 (40%), Gaps = 25/239 (10%)

Query: 9   LKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWR 68
           LK H   ++S+D+ P    L +GS DR +++  LK G+  L   ++D      V +VA  
Sbjct: 593 LKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCTLTLSIED-----GVTTVAVS 647

Query: 69  P-HSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLA 127
           P     +AAGS D  + +W      L E    E EL     GH++ V  + +++DG  + 
Sbjct: 648 PGDGKFIAAGSLDRAVRVWDSDTGFLVERLDSENELGT---GHKDSVYSVVFTRDGNGVV 704

Query: 128 TCSRDKSVWIW--------ETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDD 179
           + S D+SV +W          D       C      H   V  V        + S S D 
Sbjct: 705 SGSLDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDR 764

Query: 180 TVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIR-----LCSGSDDSTVRVWKYI 233
            V  W     +     +L GH  ++  S       P+        +GS D   R+WKYI
Sbjct: 765 GVLFWDKVSGNPLL--MLQGHRNSV-ISVAVNHGHPLGPNYHIFATGSGDCKARIWKYI 820

 Score = 57.0 bits (136), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 63/231 (27%), Positives = 106/231 (45%), Gaps = 35/231 (15%)

Query: 16  VWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHSDLLA 75
           + S+ F P    LATG+ D+ I++  ++  K  ++ VL    H++ + S+ + P  D L 
Sbjct: 558 IRSVCFSPDGKFLATGAEDKLIRIWDIEQKK--IVMVLKG--HEQDIYSLDYFPSGDKLV 613

Query: 76  AGSFDSTISIWTQSDLDLEEGA-KLEMELLAIIEGHENEVKGISWSQ-DGCLLATCSRDK 133
           +GS D T+ IW     DL+ G   L + +       E+ V  ++ S  DG  +A  S D+
Sbjct: 614 SGSGDRTVRIW-----DLKTGQCTLTLSI-------EDGVTTVAVSPGDGKFIAAGSLDR 661

Query: 134 SVWIWETDEAGEEYECISVLQE----HSQDVKHVVWHTKHNLLASSSYDDTVRIWK---- 185
           +V +W++D  G   E +    E    H   V  VV+    N + S S D +V++W     
Sbjct: 662 AVRVWDSD-TGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNV 720

Query: 186 DYDD------DWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
           ++++         C    TGH+  +     +  ED   + SGS D  V  W
Sbjct: 721 NHNNADGKPTSGTCEVTYTGHKDFVLS--VATTEDDEYILSGSKDRGVLFW 769

 Score = 54.3 bits (129), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 71/156 (45%), Gaps = 16/156 (10%)

Query: 114 VKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLA 173
           ++ + +S DG  LAT + DK + IW+     E+ + + VL+ H QD+  + +    + L 
Sbjct: 558 IRSVCFSPDGKFLATGAEDKLIRIWDI----EQKKIVMVLKGHEQDIYSLDYFPSGDKLV 613

Query: 174 SSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYI 233
           S S D TVRIW       +C   L+  +G    +      D   + +GS D  VRVW   
Sbjct: 614 SGSGDRTVRIWD--LKTGQCTLTLSIEDGVTTVA--VSPGDGKFIAAGSLDRAVRVW--- 666

Query: 234 GDDEDDQ---QEWVCESTLPNAHRSQIYGVAWSPSG 266
             D D     +    E+ L   H+  +Y V ++  G
Sbjct: 667 --DSDTGFLVERLDSENELGTGHKDSVYSVVFTRDG 700

>Scas_592.4*
          Length = 318

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/210 (25%), Positives = 90/210 (42%), Gaps = 25/210 (11%)

Query: 70  HSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATC 129
             +LL +GS D T+  W  +  D + G  +        +GH + V+  + +QDG    + 
Sbjct: 29  QPNLLLSGSRDKTLISWKLTGDDQKFGVPVRS-----FKGHSHIVQDCTLTQDGAYALSA 83

Query: 130 SRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDD 189
           S DK++ +W+    GE Y+       H  DV  V    K +++ S S D T+++W     
Sbjct: 84  SWDKTLRLWDV-ATGETYQ---RFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKG- 138

Query: 190 DWECAAVLTGHE---GTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCE 246
             +C A L GH      +  +   + +D + + S  +D  V+ W           ++  E
Sbjct: 139 --QCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNL--------NQFQIE 188

Query: 247 STLPNAHRSQIYGVAWSPSGR-IASVGADG 275
           +     H   +  V  SP G  IAS G DG
Sbjct: 189 ADFV-GHNGNVNAVTASPDGTLIASAGKDG 217

 Score = 35.8 bits (81), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 57/139 (41%), Gaps = 16/139 (11%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHS 71
           H   V S+  +    ++ +GS D+ IKV  +K   + L  +L        VR      + 
Sbjct: 106 HKSDVMSVAIDRKASMIISGSRDKTIKVWTIKG--QCLATLLGHNDWVSQVRIAPTDQND 163

Query: 72  D---LLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLAT 128
           D   +++AG+ D  +  W  +   +E          A   GH   V  ++ S DG L+A+
Sbjct: 164 DAVTVISAGN-DKMVKAWNLNQFQIE----------ADFVGHNGNVNAVTASPDGTLIAS 212

Query: 129 CSRDKSVWIWETDEAGEEY 147
             +D  + +W   E    Y
Sbjct: 213 AGKDGEIMLWNLAEKKAMY 231

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 39/80 (48%), Gaps = 11/80 (13%)

Query: 14  DKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVL-------DDTVHKKAVRSVA 66
           D+V+S+ F P R  LA  +T   IK+  L    ++L+D L       + +    AV S+A
Sbjct: 237 DEVFSLAFSPNRYWLA-AATASGIKIFCLD--PQSLIDDLRPEFAGYNKSAEPHAV-SLA 292

Query: 67  WRPHSDLLAAGSFDSTISIW 86
           W      L AG  DS I +W
Sbjct: 293 WSADGQTLFAGYTDSVIRVW 312

 Score = 29.6 bits (65), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 3/44 (6%)

Query: 195 AVLTGHEGTIWCSDFSKEE-DPIRLCSGSDDSTVRVWKYIGDDE 237
             L GH G  W +  +     P  L SGS D T+  WK  GDD+
Sbjct: 11  GTLEGHNG--WVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQ 52

>KLLA0F06754g complement(650475..651509) similar to sp|P53011
           Saccharomyces cerevisiae YGL100w SEH1 nuclear pore
           protein, start by similarity
          Length = 344

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/248 (21%), Positives = 105/248 (42%), Gaps = 30/248 (12%)

Query: 106 IIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVW 165
            + GH + V  IS+   G  +ATCS D+ + +++ D+   E+E     + H   +  + W
Sbjct: 4   FLTGHSDLVHDISYDFYGRRVATCSSDQHIKVFKLDKETNEWELSESWKAHDSSIVSLDW 63

Query: 166 HTKH--NLLASSSYDDTVRIWKDYDD-------DWECAAVLTGHEGTIWCSDFSKEEDPI 216
                  ++AS SYD T+++W++  D        W+    L    G ++   F+     +
Sbjct: 64  AAPEFGRIIASVSYDKTIKLWEEDPDALELSGKRWQKLCTLNDATGPLFSVKFAPSHLGL 123

Query: 217 RLCSGSDDSTVRVWKYIGDDEDDQQEWVCES------TLPNAHRSQIYGVAWSPSG---- 266
           RL +  +D  +R++  +  +  D + W   S      T P +H    + ++W PS     
Sbjct: 124 RLAALGNDGKLRLYDAL--ESSDLRSWTLTSEITVLNTPPASHLQSDFCLSWCPSRFSTE 181

Query: 267 RIASVGADGVLAVYKEKQNDSEVSEWEISATYKAAHTVYEINTVKWVNIDGK--EMLITA 324
           R+     D      + KQ         + A +   HT   I ++ W    G+  +++ T 
Sbjct: 182 RLVISAMDQATIYQRNKQGK------LVPAGHLKGHTGL-IRSIAWAPSVGRWYQLIATG 234

Query: 325 GDDGRVNL 332
             DG++ +
Sbjct: 235 CKDGKLRI 242

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 72/156 (46%), Gaps = 20/156 (12%)

Query: 3   LQLAKSLKLHNDKVWSIDFEPVRG----LLATGSTDRAIKVLQLKNGKENLLDVLDDTVH 58
           L  A  LK H   + SI + P  G    L+ATG  D  +++ ++   + N  +++++   
Sbjct: 202 LVPAGHLKGHTGLIRSIAWAPSVGRWYQLIATGCKDGKLRIFKVTESRNNGTNIINEEND 261

Query: 59  KKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGIS 118
             A       P    + + + D+  S+           A L +EL++    H+ EV  +S
Sbjct: 262 NNANIERDGPP----IDSSAIDADGSV-----------ANLHVELISEHSDHQGEVWSVS 306

Query: 119 WSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQ 154
           W+  G +L++   D  + +W+   +  E+ C+SV+Q
Sbjct: 307 WNLTGTILSSTGDDGKIRLWKASYS-NEFRCMSVVQ 341

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 71/177 (40%), Gaps = 26/177 (14%)

Query: 28  LATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPH----SDLLAAGSFDSTI 83
           L   + D+A    + K GK  L+       H   +RS+AW P       L+A G  D  +
Sbjct: 183 LVISAMDQATIYQRNKQGK--LVPAGHLKGHTGLIRSIAWAPSVGRWYQLIATGCKDGKL 240

Query: 84  SIW--TQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETD 141
            I+  T+S  +       E +  A IE     +   +   DG +                
Sbjct: 241 RIFKVTESRNNGTNIINEENDNNANIERDGPPIDSSAIDADGSV---------------- 284

Query: 142 EAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWK-DYDDDWECAAVL 197
            A    E IS   +H  +V  V W+    +L+S+  D  +R+WK  Y +++ C +V+
Sbjct: 285 -ANLHVELISEHSDHQGEVWSVSWNLTGTILSSTGDDGKIRLWKASYSNEFRCMSVV 340

>AGR180W [4491] [Homologous to ScYLR222C - SH]
           complement(1090647..1093067) [2421 bp, 806 aa]
          Length = 806

 Score = 62.4 bits (150), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 85/185 (45%), Gaps = 21/185 (11%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGI 117
           H+K + +++  P+  + A  S+D T  IW     +++ G     E+ A +  H+  + G+
Sbjct: 487 HEKDINAISMSPNDSIFATASYDKTCKIW-----NVDTG-----EVEATLANHKRGLWGV 536

Query: 118 SWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSY 177
           ++ +   LLATCS D+S+ +W      E +  +  L+ H+  V+ V +   +  L S+  
Sbjct: 537 AFCEYDWLLATCSGDRSINLWSL----ESFTVLKTLEGHTNAVQRVSFINGNKQLVSTGA 592

Query: 178 DDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDE 237
           D  V+IW       EC   L  H   IW    +   D   + +   D   + W+   D+ 
Sbjct: 593 DGLVKIWD--CSTGECVRTLDAHNNRIWA--LAVANDGQLIITADADGVFQFWE---DNS 645

Query: 238 DDQQE 242
           +++ E
Sbjct: 646 EEEHE 650

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 116/282 (41%), Gaps = 43/282 (15%)

Query: 69  PHSDLLAAGSFDSTISIW-TQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLA 127
           P  + LA  +   T+ I  T    + +E  ++E E+    EGH + +  +  + DG  LA
Sbjct: 342 PSLNRLALATNSPTLRIIPTPQASEDKEVMEIETEMY---EGHTDLLNSLDATSDGLWLA 398

Query: 128 TCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHN-----LLASSSYDDTVR 182
           T S+D SV +W  +EA   +E  +    H+  V  +      N      L ++S D T++
Sbjct: 399 TASKDHSVILWRYNEASSSFEPFTKFLGHAGPVTAIALPNVMNRNWPEFLLTASNDLTIK 458

Query: 183 IWKDYDDDWECAAVLT-----------GHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWK 231
            WK  + +   A  L             HE  I     S   D I   + S D T ++W 
Sbjct: 459 RWKVPNPNDRKAIELPHIVKASEYTRRAHEKDINAISMSP-NDSI-FATASYDKTCKIWN 516

Query: 232 YIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYKEKQNDSEVSE 291
                  D  E   E+TL N H+  ++GVA+           D +LA       D  ++ 
Sbjct: 517 V------DTGE--VEATLAN-HKRGLWGVAFCE--------YDWLLATCS---GDRSINL 556

Query: 292 WEISATYKAAHTVYEINTVKWVN-IDGKEMLITAGDDGRVNL 332
           W + +           N V+ V+ I+G + L++ G DG V +
Sbjct: 557 WSLESFTVLKTLEGHTNAVQRVSFINGNKQLVSTGADGLVKI 598

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 66/145 (45%), Gaps = 15/145 (10%)

Query: 4   QLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVR 63
           ++  +L  H   +W + F     LLAT S DR+I +  L++    +L  L+   H  AV+
Sbjct: 521 EVEATLANHKRGLWGVAFCEYDWLLATCSGDRSINLWSLESF--TVLKTLEG--HTNAVQ 576

Query: 64  SVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDG 123
            V++   +  L +   D  + IW     D   G     E +  ++ H N +  ++ + DG
Sbjct: 577 RVSFINGNKQLVSTGADGLVKIW-----DCSTG-----ECVRTLDAHNNRIWALAVANDG 626

Query: 124 CLLATCSRDKSVWIWETDEAGEEYE 148
            L+ T   D     WE D + EE+E
Sbjct: 627 QLIITADADGVFQFWE-DNSEEEHE 650

>Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement
          Length = 749

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/212 (28%), Positives = 92/212 (43%), Gaps = 23/212 (10%)

Query: 73  LLAAGSFDSTISIW----TQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLAT 128
           L AAG  DS I +W    T  D  L    + ++    +I GH   V   S+S D   L +
Sbjct: 435 LAAAGFQDSYIKLWSLDGTPLDSKLPSKQREKINNTTLI-GHSGTVYSTSFSPDNKYLLS 493

Query: 129 CSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYD 188
            S DK+V +W  D     Y  +   + H+  V  V +    +  A++S+D T R+W    
Sbjct: 494 ASEDKTVRLWSMD----TYSSLVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWS--C 547

Query: 189 DDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCEST 248
           D      +  GH   + C  F    +   + +GS D T R+W  IG   D  + ++    
Sbjct: 548 DHIYPLRIFAGHLNDVDCVSF--HPNGTYVFTGSTDKTCRMWD-IGTG-DSVRLFL---- 599

Query: 249 LPNAHRSQIYGVAWSPSGRIASVGA-DGVLAV 279
               H + +   A SP GR  S G+ DG++ V
Sbjct: 600 ---GHTAPVISTAVSPDGRWLSTGSEDGIINV 628

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 97/232 (41%), Gaps = 27/232 (11%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGI 117
           H   V S ++ P +  L + S D T+ +W+                L   +GH + V  +
Sbjct: 475 HSGTVYSTSFSPDNKYLLSASEDKTVRLWSMD----------TYSSLVSYKGHNHPVWDV 524

Query: 118 SWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSY 177
           S+S  G   AT S D++  +W  D        + +   H  DV  V +H     + + S 
Sbjct: 525 SFSPLGHYFATASHDQTARLWSCDHI----YPLRIFAGHLNDVDCVSFHPNGTYVFTGST 580

Query: 178 DDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDE 237
           D T R+W     D     +  GH   +  +  S   D   L +GS+D  + VW  IG  +
Sbjct: 581 DKTCRMWDIGTGD--SVRLFLGHTAPVISTAVS--PDGRWLSTGSEDGIINVWD-IGTGK 635

Query: 238 DDQQEWVCESTLPNAHRSQIYGVAWSPSGRI-ASVGADGVLAVYKEKQNDSE 288
             +Q       +    ++ +Y +++S  G +  S GAD  + V+  K++ +E
Sbjct: 636 RLKQ-------MRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDLKRSTAE 680

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 78/178 (43%), Gaps = 19/178 (10%)

Query: 8   SLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAW 67
           S K HN  VW + F P+    AT S D+  ++       +++  +     H   V  V++
Sbjct: 513 SYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSC----DHIYPLRIFAGHLNDVDCVSF 568

Query: 68  RPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLA 127
            P+   +  GS D T  +W     D+  G  + + L     GH   V   + S DG  L+
Sbjct: 569 HPNGTYVFTGSTDKTCRMW-----DIGTGDSVRLFL-----GHTAPVISTAVSPDGRWLS 618

Query: 128 TCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKH-NLLASSSYDDTVRIW 184
           T S D  + +W+        + +  ++ H ++  + + ++K   +L S   D +VR+W
Sbjct: 619 TGSEDGIINVWDIGTG----KRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVW 672

>YNL006W (LST8) [4579] chr14 (620066..620977) Protein required for
           transport of permeases from the Golgi to the plasma
           membrane [912 bp, 303 aa]
          Length = 303

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 93/225 (41%), Gaps = 19/225 (8%)

Query: 8   SLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAW 67
           S + H   V S+ F+     + T S D  IKV  +++       +  +  H   V  V  
Sbjct: 70  SFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPS-----IPRNYKHNAPVNEVVI 124

Query: 68  RPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLA 127
            P+   L +   D  I IW     DL E          +    +  ++ +S + DG +LA
Sbjct: 125 HPNQGELISCDRDGNIRIW-----DLGENQCTHQ----LTPEDDTSLQSLSMASDGSMLA 175

Query: 128 TCSRDKSVWIWETDEA--GEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWK 185
             +   + ++WE          + ++  + HS  +  ++  +    LA+ S D T R+W 
Sbjct: 176 AANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWS 235

Query: 186 DYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
             DDD++    L GH+  +W   FS   D   L + S D  VR+W
Sbjct: 236 -IDDDFKLETTLDGHQRWVWDCAFSA--DSAYLVTASSDHYVRLW 277

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 52/128 (40%), Gaps = 8/128 (6%)

Query: 104 LAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHV 163
           +A  EGH   V  +S+ QD   + T S D ++ +W+          I    +H+  V  V
Sbjct: 68  VASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPS-----IPRNYKHNAPVNEV 122

Query: 164 VWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSD 223
           V H     L S   D  +RIW   ++  +C   LT  + T   S  S   D   L + + 
Sbjct: 123 VIHPNQGELISCDRDGNIRIWDLGEN--QCTHQLTPEDDTSLQS-LSMASDGSMLAAANT 179

Query: 224 DSTVRVWK 231
                VW+
Sbjct: 180 KGNCYVWE 187

 Score = 28.9 bits (63), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 52/125 (41%), Gaps = 13/125 (10%)

Query: 27  LLATGSTDRAIKVLQLKNGKE--NLLDVLDDTVHKKAVRSVAWRPHSDLLAAGSFDSTIS 84
           +LA  +T     V ++ N  +  +L  V     H   +  +        LA  S D T  
Sbjct: 173 MLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTAR 232

Query: 85  IWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWE--TDE 142
           +W+     +++  KLE  L    +GH+  V   ++S D   L T S D  V +W+  T E
Sbjct: 233 VWS-----IDDDFKLETTL----DGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRE 283

Query: 143 AGEEY 147
              +Y
Sbjct: 284 IVRQY 288

>Scas_702.16
          Length = 816

 Score = 61.6 bits (148), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 91/195 (46%), Gaps = 32/195 (16%)

Query: 16  VWSIDFEPVRGLLATGSTD------------RAIKVLQLKN----GKENLLDVLDDTVHK 59
           ++++D  P    +ATG  D            + +K+L LK+     KE    +   + H 
Sbjct: 20  IYTVDVSPDGKRVATGGLDGKIRIWSVDSIKQIVKILSLKDEVPIDKELKKPLASMSRHT 79

Query: 60  KAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEE------GAKLEMELLAI---IEGH 110
            +V  + + P+   LA+GS D  + IWT   LD E       G + E E  A+   +  H
Sbjct: 80  GSVTCLKFSPNGKYLASGSDDRILLIWT---LDEERPIQPIFGGESEKERWAVRKRLVAH 136

Query: 111 ENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHN 170
           +N+++ I W+ D  LL +   D++V IW     G  +E +     H   VK V++   + 
Sbjct: 137 DNDIQDICWAPDSSLLVSVGLDRAVIIWN----GITFEKLKRFDVHQSHVKGVIFDPANK 192

Query: 171 LLASSSYDDTVRIWK 185
             A++S D T++I++
Sbjct: 193 YFATASDDRTMKIFR 207

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 62/150 (41%), Gaps = 22/150 (14%)

Query: 8   SLKLHNDKVWSIDFEPVRGLLATGSTDRAI--------KVLQLKNGKENLLD---VLDDT 56
           S+  H   V  + F P    LA+GS DR +        + +Q   G E+  +   V    
Sbjct: 74  SMSRHTGSVTCLKFSPNGKYLASGSDDRILLIWTLDEERPIQPIFGGESEKERWAVRKRL 133

Query: 57  V-HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVK 115
           V H   ++ + W P S LL +   D  + IW            +  E L   + H++ VK
Sbjct: 134 VAHDNDIQDICWAPDSSLLVSVGLDRAVIIWNG----------ITFEKLKRFDVHQSHVK 183

Query: 116 GISWSQDGCLLATCSRDKSVWIWETDEAGE 145
           G+ +       AT S D+++ I+   + G+
Sbjct: 184 GVIFDPANKYFATASDDRTMKIFRYHKIGD 213

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 69/181 (38%), Gaps = 40/181 (22%)

Query: 108 EGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHT 167
           E    E+  +  S DG  +AT   D  + IW  D   +  + +S+               
Sbjct: 14  ESRSYEIYTVDVSPDGKRVATGGLDGKIRIWSVDSIKQIVKILSL--------------- 58

Query: 168 KHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTV 227
                      D V I K+     +  A ++ H G++ C  FS       L SGSDD  +
Sbjct: 59  ----------KDEVPIDKELK---KPLASMSRHTGSVTCLKFSPNGK--YLASGSDDRIL 103

Query: 228 RVW--------KYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSP-SGRIASVGADGVLA 278
            +W        + I   E +++ W     L  AH + I  + W+P S  + SVG D  + 
Sbjct: 104 LIWTLDEERPIQPIFGGESEKERWAVRKRL-VAHDNDIQDICWAPDSSLLVSVGLDRAVI 162

Query: 279 V 279
           +
Sbjct: 163 I 163

 Score = 34.7 bits (78), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 42/203 (20%), Positives = 78/203 (38%), Gaps = 31/203 (15%)

Query: 7   KSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQ---LKNGKENLLDVLDDTVHKKAV- 62
           K   +H   V  + F+P     AT S DR +K+ +   + +    +  V+ +      + 
Sbjct: 173 KRFDVHQSHVKGVIFDPANKYFATASDDRTMKIFRYHKIGDASFTIEHVVTEPFKGSPLT 232

Query: 63  ---RSVAWRPHSDLLAA----------------GSFDSTISIWTQSDLDLEEGAKLEMEL 103
              R ++W P    +AA                G++DS IS+         E  +    L
Sbjct: 233 TYFRRLSWSPDGQHIAAPNATNGPVSSVAIINRGTWDSNISLIGHD--APTEVVRFNPRL 290

Query: 104 LAIIEGH-ENEVKGISWSQDGC--LLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDV 160
             + +G    + K  S   D    ++AT  +DK+V +W T  A   +    +  +   D+
Sbjct: 291 FEVNDGMTPAKRKQDSGPNDSMESIIATAGQDKTVVVWSTTRARPIFIAFDIANKSITDM 350

Query: 161 KHVVWHTKHNLLASSSYDDTVRI 183
           +   W     +L  +S D ++ I
Sbjct: 351 Q---WTPDGTMLFLTSLDSSITI 370

>ACR199C [1246] [Homologous to ScYLR208W (SEC13) - SH]
           (698881..699768) [888 bp, 295 aa]
          Length = 295

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 84/194 (43%), Gaps = 25/194 (12%)

Query: 103 LLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKH 162
           ++ I   H   +        G  LATCS DK++ I+E D  G+ ++ +  L  H   V  
Sbjct: 1   MVTITNAHTELIHDAVLDYYGKRLATCSSDKTIQIFEVD--GDSHKLVDSLHGHEGPVWQ 58

Query: 163 VVW-HTKHN-LLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEE-DPIRLC 219
           V W H K   +LAS SYD  V IWK+ +  W   A    H  ++    ++  E  P+ LC
Sbjct: 59  VDWAHPKFGVILASCSYDGKVLIWKEENGRWSQIAAYEVHSASVNSVKWAPHEYGPLLLC 118

Query: 220 SGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSG------------R 267
           S SD     V        + ++       + +AH   +    W+P+             R
Sbjct: 119 SSSDGKFSVV--------EFKENGTTSPIIIDAHAIGVNAACWAPATIEDDGQQSQHLRR 170

Query: 268 IASVGADGVLAVYK 281
           IA+ GAD ++ ++K
Sbjct: 171 IATGGADNLVKIWK 184

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 64/249 (25%), Positives = 99/249 (39%), Gaps = 33/249 (13%)

Query: 4   QLAKSLKLHNDKVWSIDF-EPVRG-LLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKA 61
           +L  SL  H   VW +D+  P  G +LA+ S D  + + + +NG+ + +   +  VH  +
Sbjct: 44  KLVDSLHGHEGPVWQVDWAHPKFGVILASCSYDGKVLIWKEENGRWSQIAAYE--VHSAS 101

Query: 62  VRSVAWRPH--SDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISW 119
           V SV W PH    LL   S D   S+     ++ +E          II+ H   V    W
Sbjct: 102 VNSVKWAPHEYGPLLLCSSSDGKFSV-----VEFKENGTTSP---IIIDAHAIGVNAACW 153

Query: 120 -----------SQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHT- 167
                      SQ    +AT   D  V IW+ +     Y     L  H+  V+ V W   
Sbjct: 154 APATIEDDGQQSQHLRRIATGGADNLVKIWKYNPEANTYLLEDTLAAHADWVRDVAWSPS 213

Query: 168 --KHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEG---TIWCSDFSKEEDPIRLCSGS 222
                 LA+ S D T  IW   ++       L   +     +W + +S   + + L  G 
Sbjct: 214 VLPRAYLATVSQDRTCIIWTQENNQGPWTKTLLKEDKFPDVLWRASWSLSGNILALSGG- 272

Query: 223 DDSTVRVWK 231
            D+ V +WK
Sbjct: 273 -DNKVTLWK 280

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 63/266 (23%), Positives = 103/266 (38%), Gaps = 60/266 (22%)

Query: 28  LATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAW--RPHSDLLAAGSFDSTISI 85
           LAT S+D+ I++ ++      L+D L    H+  V  V W       +LA+ S+D  + I
Sbjct: 24  LATCSSDKTIQIFEVDGDSHKLVDSLHG--HEGPVWQVDWAHPKFGVILASCSYDGKVLI 81

Query: 86  WTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWS--QDGCLLATCSRDKSVWIWETDEA 143
           W       EE  +     +A  E H   V  + W+  + G LL   S D    + E  E 
Sbjct: 82  WK------EENGRWSQ--IAAYEVHSASVNSVKWAPHEYGPLLLCSSSDGKFSVVEFKEN 133

Query: 144 GEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGT 203
           G     I  +  H+  V    W       A ++ +D                        
Sbjct: 134 GTTSPII--IDAHAIGVNAACW-------APATIED------------------------ 160

Query: 204 IWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWS 263
               D  + +   R+ +G  D+ V++WKY      +   ++ E TL  AH   +  VAWS
Sbjct: 161 ----DGQQSQHLRRIATGGADNLVKIWKY----NPEANTYLLEDTLA-AHADWVRDVAWS 211

Query: 264 PS----GRIASVGADGVLAVYKEKQN 285
           PS      +A+V  D    ++ ++ N
Sbjct: 212 PSVLPRAYLATVSQDRTCIIWTQENN 237

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 85/206 (41%), Gaps = 26/206 (12%)

Query: 8   SLKLHNDKVWSIDFEP--VRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSV 65
           + ++H+  V S+ + P     LL   S+D    V++ K        ++D   H   V + 
Sbjct: 94  AYEVHSASVNSVKWAPHEYGPLLLCSSSDGKFSVVEFKENGTTSPIIID--AHAIGVNAA 151

Query: 66  AWRP-----------HSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEV 114
            W P           H   +A G  D+ + IW     + E    L  + LA    H + V
Sbjct: 152 CWAPATIEDDGQQSQHLRRIATGGADNLVKIW---KYNPEANTYLLEDTLA---AHADWV 205

Query: 115 KGISWSQD---GCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVK-HVVWHTKHN 170
           + ++WS        LAT S+D++  IW  +     +    + ++   DV     W    N
Sbjct: 206 RDVAWSPSVLPRAYLATVSQDRTCIIWTQENNQGPWTKTLLKEDKFPDVLWRASWSLSGN 265

Query: 171 LLASSSYDDTVRIWK-DYDDDWECAA 195
           +LA S  D+ V +WK + +  WE AA
Sbjct: 266 ILALSGGDNKVTLWKENLEGKWESAA 291

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 63/141 (44%), Gaps = 10/141 (7%)

Query: 150 ISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDF 209
           +++   H++ +   V       LA+ S D T++I++   D  +    L GHEG +W  D+
Sbjct: 2   VTITNAHTELIHDAVLDYYGKRLATCSSDKTIQIFEVDGDSHKLVDSLHGHEGPVWQVDW 61

Query: 210 SKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSP---SG 266
           +  +  + L S S D  V +WK      ++   W  +      H + +  V W+P     
Sbjct: 62  AHPKFGVILASCSYDGKVLIWK------EENGRW-SQIAAYEVHSASVNSVKWAPHEYGP 114

Query: 267 RIASVGADGVLAVYKEKQNDS 287
            +    +DG  +V + K+N +
Sbjct: 115 LLLCSSSDGKFSVVEFKENGT 135

 Score = 31.6 bits (70), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 26/120 (21%), Positives = 58/120 (48%), Gaps = 19/120 (15%)

Query: 217 RLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGR---IASVGA 273
           RL + S D T+++++  GD        + +S   + H   ++ V W+       +AS   
Sbjct: 23  RLATCSSDKTIQIFEVDGDSHK-----LVDSL--HGHEGPVWQVDWAHPKFGVILASCSY 75

Query: 274 DGVLAVYKEKQND-SEVSEWEISATYKAAHTVYEINTVKWVNIDGKEMLITAGDDGRVNL 332
           DG + ++KE+    S+++ +E+ +          +N+VKW   +   +L+ +  DG+ ++
Sbjct: 76  DGKVLIWKEENGRWSQIAAYEVHSA--------SVNSVKWAPHEYGPLLLCSSSDGKFSV 127

>KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces
           cerevisiae YLR129w DIP2 DOM34P-interacting protein,
           start by similarity
          Length = 936

 Score = 61.6 bits (148), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 64/254 (25%), Positives = 101/254 (39%), Gaps = 46/254 (18%)

Query: 5   LAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIK------------------VLQLKNGK 46
           L  + + H   +WS+D       L TGS D++ K                  + QLK   
Sbjct: 456 LLSTTEAHTAAIWSLDLTSNGKRLVTGSADKSCKFWDFEVVEQLVPGTKDKYIPQLKLVH 515

Query: 47  ENLLDVLDDTVHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAI 106
           +  L++ DD      + +V        LA    D+T+ ++    L      K  + L   
Sbjct: 516 DTTLELTDD------ILAVKISSEDRYLAVSLLDNTVKVFFFDSL------KFYLSLY-- 561

Query: 107 IEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWH 166
             GH+  V  I +S D  +L T S DK++ IW  D      +C   +  H   +  V + 
Sbjct: 562 --GHKLPVLSIDFSVDSKMLITSSADKNIKIWGVDFG----DCHKSIFAHQDSIMSVRFE 615

Query: 167 TKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDST 226
              +   S   D  V+ W    D ++C   L GH+  +WC   S   D   + S S D +
Sbjct: 616 ADTHNFFSCGKDGAVKRWD--GDKFDCIQKLNGHQSEVWCIAVS--PDGRTVVSTSHDHS 671

Query: 227 VRVWKYIGDDEDDQ 240
           +RVW+    + DDQ
Sbjct: 672 IRVWQ----ETDDQ 681

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 56/218 (25%), Positives = 92/218 (42%), Gaps = 37/218 (16%)

Query: 26  GLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRP----------HSDLLA 75
           G L TG    A++ +Q+   K N ++VL D +   AV +   +P           ++LL 
Sbjct: 34  GKLITG----ALENIQIWTLKTNEVEVLTDGLPIGAVETNISKPSVVTAMCFHKETELLC 89

Query: 76  AGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSV 135
            G  D  I +W     DL     L   +L    GH++ V  +    +G  L + S+D  +
Sbjct: 90  VGYEDGVIKVW-----DL-----LSKSVLMQFNGHKSGVTVLRLDSEGTRLVSGSKDSDL 139

Query: 136 WIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNL--LASSSYDDTVRIWKDYDDDWEC 193
            IW  D  GE    +  L+ H +D    +W   HN+  L S + D  +++W D     +C
Sbjct: 140 IIW--DLVGE--VGLMKLRSH-KDAITGIW-IDHNMDWLISVAKDGLIKVW-DLKAGGQC 192

Query: 194 AAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWK 231
                 H G  W     +E     + + S DS  ++W+
Sbjct: 193 VETHMAHTGQCWSMAIDEE----VIITTSMDSQAKIWE 226

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 58/132 (43%), Gaps = 16/132 (12%)

Query: 153 LQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWK-DYDDDWECAAVLTGHEGTIWCSDFSK 211
           L  H   V  + +     +L +SS D  ++IW  D+ D   C   +  H+ +I    F  
Sbjct: 560 LYGHKLPVLSIDFSVDSKMLITSSADKNIKIWGVDFGD---CHKSIFAHQDSIMSVRF-- 614

Query: 212 EEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGR-IAS 270
           E D     S   D  V+ W        D  ++ C   L N H+S+++ +A SP GR + S
Sbjct: 615 EADTHNFFSCGKDGAVKRW--------DGDKFDCIQKL-NGHQSEVWCIAVSPDGRTVVS 665

Query: 271 VGADGVLAVYKE 282
              D  + V++E
Sbjct: 666 TSHDHSIRVWQE 677

 Score = 36.6 bits (83), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 62/143 (43%), Gaps = 19/143 (13%)

Query: 3   LQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKV--LQLKNGKENLLDVLDDTVHKK 60
           L+   SL  H   V SIDF     +L T S D+ IK+  +   +  +++        H+ 
Sbjct: 554 LKFYLSLYGHKLPVLSIDFSVDSKMLITSSADKNIKIWGVDFGDCHKSIF------AHQD 607

Query: 61  AVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWS 120
           ++ SV +   +    +   D  +  W     D           +  + GH++EV  I+ S
Sbjct: 608 SIMSVRFEADTHNFFSCGKDGAVKRWDGDKFD----------CIQKLNGHQSEVWCIAVS 657

Query: 121 QDGCLLATCSRDKSVWIW-ETDE 142
            DG  + + S D S+ +W ETD+
Sbjct: 658 PDGRTVVSTSHDHSIRVWQETDD 680

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 52/133 (39%), Gaps = 25/133 (18%)

Query: 107 IEGHENEVKGISWSQDGCLLATCSRDK-SVWIWETDEAGEEYECISVL--QEHSQDVKHV 163
           ++GH  +++ +  S DG LL+T S  +  VW   T +    + C   L  Q     +  V
Sbjct: 379 LQGHRTDIRSMDISDDGKLLSTASNGELKVWNLTTKKCIRTFSCGYALCSQMLPGGLLVV 438

Query: 164 VWHTKHNL----LASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLC 219
           V   +  L    LASS+   T                   H   IW  D +   +  RL 
Sbjct: 439 VGTRQGELQLFDLASSTLLSTTE----------------AHTAAIWSLDLT--SNGKRLV 480

Query: 220 SGSDDSTVRVWKY 232
           +GS D + + W +
Sbjct: 481 TGSADKSCKFWDF 493

>Scas_721.115*
          Length = 318

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 54/210 (25%), Positives = 90/210 (42%), Gaps = 25/210 (11%)

Query: 70  HSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATC 129
             +LL +GS D T+  W  +  D + G  +        +GH + V+  + +QDG    + 
Sbjct: 29  QPNLLLSGSRDKTLISWKLTGDDQKFGVPVRS-----FKGHSHIVQDCTLTQDGAYALSA 83

Query: 130 SRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDD 189
           S DK++ +W+    GE Y+       H  DV  V    K +++ S S D T+++W     
Sbjct: 84  SWDKTLRLWDV-ATGETYQR---FVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKG- 138

Query: 190 DWECAAVLTGHE---GTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCE 246
             +C A L GH      +  +   + +D + + S  +D  V+ W           ++  E
Sbjct: 139 --QCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNL--------NQFQIE 188

Query: 247 STLPNAHRSQIYGVAWSPSGR-IASVGADG 275
           +     H   +  V  SP G  IAS G DG
Sbjct: 189 ADFV-GHNGNVNTVTASPDGTLIASAGKDG 217

 Score = 35.8 bits (81), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 30/136 (22%), Positives = 52/136 (38%), Gaps = 10/136 (7%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHS 71
           H   V S+  +    ++ +GS D+ IKV  +K      L   +D V +  +        S
Sbjct: 106 HKSDVMSVAIDRKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDS 165

Query: 72  DLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSR 131
             + +   D  +  W  +   +E          A   GH   V  ++ S DG L+A+  +
Sbjct: 166 VTVISAGNDKMVKAWNLNQFQIE----------ADFVGHNGNVNTVTASPDGTLIASAGK 215

Query: 132 DKSVWIWETDEAGEEY 147
           D  + +W   E    Y
Sbjct: 216 DGEIMLWNLAEKKAMY 231

 Score = 29.6 bits (65), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 3/44 (6%)

Query: 195 AVLTGHEGTIWCSDFSKEE-DPIRLCSGSDDSTVRVWKYIGDDE 237
             L GH G  W +  +     P  L SGS D T+  WK  GDD+
Sbjct: 11  GTLEGHNG--WVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQ 52

 Score = 28.9 bits (63), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 11/80 (13%)

Query: 14  DKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVL-------DDTVHKKAVRSVA 66
           D+V+++ F P R  LA  +T   IK+  L    ++L+D L       + +    AV S+A
Sbjct: 237 DEVFALAFSPNRYWLA-AATASGIKIFCLD--PQSLVDDLRPEFAGYNKSAEPHAV-SLA 292

Query: 67  WRPHSDLLAAGSFDSTISIW 86
           W      L AG  DS I +W
Sbjct: 293 WSADGQTLFAGYTDSVIRVW 312

>YBR198C (TAF5) [381] chr2 complement(616084..618480) Component of
           the TAF(II) complex (TBP-associated protein complex) and
           SAGA complex (Spt-Ada-Gcn5-acetyltransferase), required
           for activated transcription by RNA polymerase II, member
           of WD (WD-40) repeat family [2397 bp, 798 aa]
          Length = 798

 Score = 61.2 bits (147), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 93/224 (41%), Gaps = 21/224 (9%)

Query: 7   KSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVA 66
           K+L  H+  V+S  F P    L +GS D+ +++  +    +    ++    H   V  V+
Sbjct: 519 KTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSM----DTHTALVSYKGHNHPVWDVS 574

Query: 67  WRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLL 126
           + P     A  S D T  +W+             +  L I  GH N+V  +S+  +GC +
Sbjct: 575 FSPLGHYFATASHDQTARLWSCD----------HIYPLRIFAGHLNDVDCVSFHPNGCYV 624

Query: 127 ATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKD 186
            T S DK+  +W+        + + +   H+  V  +        L++ S D  + +W D
Sbjct: 625 FTGSSDKTCRMWDVSTG----DSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVW-D 679

Query: 187 YDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
                    +    +  I+   +SKE +   L SG  D TVRVW
Sbjct: 680 IGTGKRLKQMRGHGKNAIYSLSYSKEGN--VLISGGADHTVRVW 721

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 56/215 (26%), Positives = 85/215 (39%), Gaps = 25/215 (11%)

Query: 73  LLAAGSFDSTISIWTQSDLDLEEGA-------KLEMELLAIIEGHENEVKGISWSQDGCL 125
           + AAG  DS I IW+     L           K E      + GH   V   S+S D   
Sbjct: 480 IAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHSGTVYSTSFSPDNKY 539

Query: 126 LATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWK 185
           L + S DK+V +W  D     +  +   + H+  V  V +    +  A++S+D T R+W 
Sbjct: 540 LLSGSEDKTVRLWSMD----THTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWS 595

Query: 186 DYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVC 245
              D      +  GH   + C  F    +   + +GS D T R+W     D         
Sbjct: 596 --CDHIYPLRIFAGHLNDVDCVSF--HPNGCYVFTGSSDKTCRMWDVSTGD--------- 642

Query: 246 ESTLPNAHRSQIYGVAWSPSGRIASVGA-DGVLAV 279
              L   H + +  +A  P GR  S G+ DG++ V
Sbjct: 643 SVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINV 677

>Kwal_47.17465
          Length = 800

 Score = 60.8 bits (146), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 69/134 (51%), Gaps = 11/134 (8%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEE---GAKLEME---LLAIIEGHE 111
           H  +V  V + P  + LA+GS D  + IW + D D ++   GA+ + E   +   +  H+
Sbjct: 21  HTGSVTVVRFSPDGNFLASGSDDRILLIW-EKDEDQKQPIFGAENDKEHWNVRRRLVAHD 79

Query: 112 NEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNL 171
           N+++ I W+ D  +L T   D+SV +W     G  +E I     H   VK V++   +  
Sbjct: 80  NDIQDICWAPDSSILVTVGLDRSVIVWN----GSTFEKIKRFDVHQSLVKGVIFDPANKY 135

Query: 172 LASSSYDDTVRIWK 185
            A++S D TVRI++
Sbjct: 136 FATASDDRTVRIFR 149

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 77/186 (41%), Gaps = 22/186 (11%)

Query: 104 LAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDE-----------AGEEYECISV 152
           LA +  H   V  + +S DG  LA+ S D+ + IWE DE             E +     
Sbjct: 15  LASMSRHTGSVTVVRFSPDGNFLASGSDDRILLIWEKDEDQKQPIFGAENDKEHWNVRRR 74

Query: 153 LQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKE 212
           L  H  D++ + W    ++L +   D +V +W      +E       H+  +    F   
Sbjct: 75  LVAHDNDIQDICWAPDSSILVTVGLDRSVIVWN--GSTFEKIKRFDVHQSLVKGVIF--- 129

Query: 213 EDPIR--LCSGSDDSTVRVWKY--IGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGR- 267
            DP      + SDD TVR+++Y   GD     +  V E    +   +    ++WSP G+ 
Sbjct: 130 -DPANKYFATASDDRTVRIFRYHKAGDMSFSIEHVVSEPFKGSPITTYFRRLSWSPDGQH 188

Query: 268 IASVGA 273
           IA+  A
Sbjct: 189 IAAPNA 194

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 62/151 (41%), Gaps = 25/151 (16%)

Query: 8   SLKLHNDKVWSIDFEPVRGLLATGSTDRAI-----------KVLQLKNGKE--NLLDVLD 54
           S+  H   V  + F P    LA+GS DR +            +   +N KE  N+   L 
Sbjct: 17  SMSRHTGSVTVVRFSPDGNFLASGSDDRILLIWEKDEDQKQPIFGAENDKEHWNVRRRL- 75

Query: 55  DTVHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEV 114
              H   ++ + W P S +L     D ++ +W  S            E +   + H++ V
Sbjct: 76  -VAHDNDIQDICWAPDSSILVTVGLDRSVIVWNGSTF----------EKIKRFDVHQSLV 124

Query: 115 KGISWSQDGCLLATCSRDKSVWIWETDEAGE 145
           KG+ +       AT S D++V I+   +AG+
Sbjct: 125 KGVIFDPANKYFATASDDRTVRIFRYHKAGD 155

 Score = 30.0 bits (66), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 41/234 (17%), Positives = 85/234 (36%), Gaps = 64/234 (27%)

Query: 7   KSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKE---NLLDVLDDTVHKKAV- 62
           K   +H   V  + F+P     AT S DR +++ +     +   ++  V+ +      + 
Sbjct: 115 KRFDVHQSLVKGVIFDPANKYFATASDDRTVRIFRYHKAGDMSFSIEHVVSEPFKGSPIT 174

Query: 63  ---RSVAWRPHSDLLAA----------------GSFDSTISIWTQSDLDLEEGAKLEMEL 103
              R ++W P    +AA                GS+D+++++         E  +    L
Sbjct: 175 TYFRRLSWSPDGQHIAAPNATNGPVSSVSIIARGSWDTSVTLIGHDSP--TEVVRFNPRL 232

Query: 104 LAIIEGHENEVK--------------GISWSQDGC----------------------LLA 127
             ++E    + K              G+  SQD                        ++A
Sbjct: 233 FQVLEKKTEKNKPEVESPLVSPETQNGVKDSQDEAGQRKDGQEEQEQEESVEEKVDSVIA 292

Query: 128 TCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTV 181
           T  +DK++ +W T +A   +    +    S+ +  +VW+   +LL  +S D ++
Sbjct: 293 TAGQDKTLVVWSTGKARPIFVAYDIA---SKSITDMVWNPNGDLLFLTSLDGSI 343

 Score = 28.9 bits (63), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 3/77 (3%)

Query: 24  VRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHSDLLAAGSFDSTI 83
           V  ++AT   D+ + V     GK   + V  D +  K++  + W P+ DLL   S D +I
Sbjct: 287 VDSVIATAGQDKTLVVWS--TGKARPIFVAYD-IASKSITDMVWNPNGDLLFLTSLDGSI 343

Query: 84  SIWTQSDLDLEEGAKLE 100
             +   + +L E   LE
Sbjct: 344 ITFHFGEKELGEAIPLE 360

>CAGL0I03454g 292823..293734 similar to sp|Q04491 Saccharomyces
           cerevisiae YLR208w SEC13 protein transport protein,
           start by similarity
          Length = 303

 Score = 59.7 bits (143), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 67/252 (26%), Positives = 101/252 (40%), Gaps = 41/252 (16%)

Query: 55  DTVHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEV 114
           +  H+  +   A   +   LA  S D T+ I+  +D++          LL  + GHE  V
Sbjct: 5   ENAHEGVIHHAALNYYGTRLATCSSDKTVKIFEINDVNNSS------SLLETLVGHEGPV 58

Query: 115 KGISWSQDGC-------LLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVW-- 165
               W  D C       LLATC  D  V IW+    G + + I     HS  V  V W  
Sbjct: 59  ----WYADWCHPSLGENLLATCGYDGKVLIWKESGHGGKMQIIGKHAVHSASVNCVKWAP 114

Query: 166 HTKHNLLASSSYDDTVRIWKDYDDDWECAAVL-----TGHEGTIWC-------SDFSKEE 213
           H    +L   S D  + + +  D       +L      G     W        SD   E 
Sbjct: 115 HEYGLILLCGSADGKISVVELKDGQIASTKILDNAHKFGVNSISWAPLMKTDSSDDGDET 174

Query: 214 DPIR-LCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVG 272
             ++   SG +D+ V++WK+    +DDQ+ +V   TL   H+  +  V WSP+  + S  
Sbjct: 175 TAVKQFISGGNDNLVKIWKF----DDDQETYVVADTLE-GHKDAVTAVDWSPTTLLQSY- 228

Query: 273 ADGVLAVYKEKQ 284
              V +V  +KQ
Sbjct: 229 ---VASVSNDKQ 237

 Score = 59.3 bits (142), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 64/214 (29%), Positives = 99/214 (46%), Gaps = 32/214 (14%)

Query: 3   LQLAKSLKLHNDKVWSIDFEPVR-GL-LATGSTDRAIKVLQLKNGKENLLDVLDDTVHKK 60
           +Q+     +H+  V  + + P   GL L  GS D  I V++LK+G+     +LD+  HK 
Sbjct: 94  MQIIGKHAVHSASVNCVKWAPHEYGLILLCGSADGKISVVELKDGQIASTKILDNA-HKF 152

Query: 61  AVRSVAWRP-----HSD---------LLAAGSFDSTISIWTQSDLDLEEGAKLEMELLA- 105
            V S++W P      SD            +G  D+ + IW   D         E  ++A 
Sbjct: 153 GVNSISWAPLMKTDSSDDGDETTAVKQFISGGNDNLVKIWKFDD-------DQETYVVAD 205

Query: 106 IIEGHENEVKGISWSQDGCL---LATCSRDKSVWIWETDEAGE--EYECISVLQ-EHSQD 159
            +EGH++ V  + WS    L   +A+ S DK   +W  D + +  +++ ISV + +  Q 
Sbjct: 206 TLEGHKDAVTAVDWSPTTLLQSYVASVSNDKQCLVWTQDHSSKKNDWKKISVNEGKFEQK 265

Query: 160 VKHVVWHTKHNLLASSSYDDTVRIWKDY-DDDWE 192
           +  V W    NLLA S  D  V IWK+  D  WE
Sbjct: 266 LGSVSWSLSGNLLAVSDDDKNVTIWKESGDGKWE 299

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 55/213 (25%), Positives = 88/213 (41%), Gaps = 17/213 (7%)

Query: 103 LLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKH 162
           ++ I   HE  +   + +  G  LATCS DK+V I+E ++       +  L  H   V +
Sbjct: 1   MVKIENAHEGVIHHAALNYYGTRLATCSSDKTVKIFEINDVNNSSSLLETLVGHEGPVWY 60

Query: 163 VVW---HTKHNLLASSSYDDTVRIWKD--YDDDWECAAVLTGHEGTIWCSDFSKEEDPIR 217
             W       NLLA+  YD  V IWK+  +    +       H  ++ C  ++  E  + 
Sbjct: 61  ADWCHPSLGENLLATCGYDGKVLIWKESGHGGKMQIIGKHAVHSASVNCVKWAPHEYGLI 120

Query: 218 LCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRI-ASVGADGV 276
           L  GS D  + V       E    +      L NAH+  +  ++W+P  +  +S   D  
Sbjct: 121 LLCGSADGKISV------VELKDGQIASTKILDNAHKFGVNSISWAPLMKTDSSDDGDET 174

Query: 277 LAV--YKEKQNDSEVSEWEI---SATYKAAHTV 304
            AV  +    ND+ V  W+      TY  A T+
Sbjct: 175 TAVKQFISGGNDNLVKIWKFDDDQETYVVADTL 207

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 72/283 (25%), Positives = 110/283 (38%), Gaps = 59/283 (20%)

Query: 5   LAKSLKLHNDKVWSIDF-EPVRG--LLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKA 61
           L ++L  H   VW  D+  P  G  LLAT   D  + + +       +  +    VH  +
Sbjct: 47  LLETLVGHEGPVWYADWCHPSLGENLLATCGYDGKVLIWKESGHGGKMQIIGKHAVHSAS 106

Query: 62  VRSVAWRPH--SDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISW 119
           V  V W PH    +L  GS D  IS+     ++L++G     ++L     H+  V  ISW
Sbjct: 107 VNCVKWAPHEYGLILLCGSADGKISV-----VELKDGQIASTKILD--NAHKFGVNSISW 159

Query: 120 SQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDD 179
           +                + +TD + +  E  +V Q                   S   D+
Sbjct: 160 AP---------------LMKTDSSDDGDETTAVKQ-----------------FISGGNDN 187

Query: 180 TVRIWKDYDDDWECAAV---LTGHEGTIWCSDFSKEEDPIRL-----CSGSDDSTVRVWK 231
            V+IWK +DDD E   V   L GH+  +   D+S    P  L      S S+D    VW 
Sbjct: 188 LVKIWK-FDDDQETYVVADTLEGHKDAVTAVDWS----PTTLLQSYVASVSNDKQCLVWT 242

Query: 232 YIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGAD 274
              D    + +W   S        ++  V+WS SG + +V  D
Sbjct: 243 Q--DHSSKKNDWKKISVNEGKFEQKLGSVSWSLSGNLLAVSDD 283

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 65/130 (50%), Gaps = 12/130 (9%)

Query: 28  LATGSTDRAIKVLQLKNGKENLLDVLDDTV--HKKAVRSVAWRPHSDL---LAAGSFDST 82
             +G  D  +K+ +  + +E    V+ DT+  HK AV +V W P + L   +A+ S D  
Sbjct: 180 FISGGNDNLVKIWKFDDDQETY--VVADTLEGHKDAVTAVDWSPTTLLQSYVASVSNDKQ 237

Query: 83  ISIWTQSDLDLEEGAKLEMELLAIIEG-HENEVKGISWSQDGCLLATCSRDKSVWIWETD 141
             +WTQ         K + + +++ EG  E ++  +SWS  G LLA    DK+V IW+  
Sbjct: 238 CLVWTQD----HSSKKNDWKKISVNEGKFEQKLGSVSWSLSGNLLAVSDDDKNVTIWKES 293

Query: 142 EAGEEYECIS 151
             G+  E ++
Sbjct: 294 GDGKWEEVVN 303

>Scas_720.83d
          Length = 915

 Score = 60.5 bits (145), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 68/169 (40%), Gaps = 48/169 (28%)

Query: 108 EGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHT 167
           +GH +    +++S DG  + T + D  + +W+         C++  QEH+  V  V +  
Sbjct: 340 QGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVVSGF----CLATFQEHTSSVTQVQFAK 395

Query: 168 KHNLLASSSYDDTVRIW-----KDYDD-------DWECAAV------------------- 196
           +  +L SSS D TVR W     +++          + C AV                   
Sbjct: 396 RGQVLFSSSLDGTVRAWDLIRYRNFRTFTAAERIQFNCLAVDPSGEVVCAGSLDNFDIHV 455

Query: 197 -----------LTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIG 234
                      L+GHEG + C  FS+E     L S S D TVRVW   G
Sbjct: 456 WSVQTGQLLDTLSGHEGPVSCLAFSQENSV--LASASWDKTVRVWSIFG 502

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 59/122 (48%), Gaps = 9/122 (7%)

Query: 117 ISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQE-----HSQDVKHVVWHTKHNL 171
           + +S DG L A  +  + + IW+T +A E+ +    ++      H QD+  + W      
Sbjct: 102 VKFSPDGKLFALAT-GRFLQIWKTPDATEDRQFAPFVRYRVHAGHFQDILSLTWSLDSRF 160

Query: 172 LASSSYDDTVRIWKDYDDDWECAAV-LTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
           + S+S D T RIW    ++ + A++   GH   +  + FS +++ I     S D  + VW
Sbjct: 161 IISTSKDLTARIWSIDSEEKDLASMTFAGHRDYVMGAFFSADQEKIYTV--SKDGALFVW 218

Query: 231 KY 232
           ++
Sbjct: 219 EF 220

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 47/89 (52%), Gaps = 11/89 (12%)

Query: 65  VAWRPHSDLLAAGSFDST-ISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDG 123
           +A  P  +++ AGS D+  I +W+     ++ G     +LL  + GHE  V  +++SQ+ 
Sbjct: 434 LAVDPSGEVVCAGSLDNFDIHVWS-----VQTG-----QLLDTLSGHEGPVSCLAFSQEN 483

Query: 124 CLLATCSRDKSVWIWETDEAGEEYECISV 152
            +LA+ S DK+V +W      ++ E   V
Sbjct: 484 SVLASASWDKTVRVWSIFGRSQQVEPFDV 512

 Score = 36.2 bits (82), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 37/176 (21%), Positives = 68/176 (38%), Gaps = 50/176 (28%)

Query: 52  VLDDTVHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHE 111
           +L    H  A  S+ + P    +   + D  I +W     D+  G       LA  + H 
Sbjct: 336 ILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVW-----DVVSGF-----CLATFQEHT 385

Query: 112 NEVKGISWSQDGCLLATCSRDKSVWIWE--------TDEAGE--EYECISV--------- 152
           + V  + +++ G +L + S D +V  W+        T  A E  ++ C++V         
Sbjct: 386 SSVTQVQFAKRGQVLFSSSLDGTVRAWDLIRYRNFRTFTAAERIQFNCLAVDPSGEVVCA 445

Query: 153 ---------------------LQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDY 187
                                L  H   V  + +  ++++LAS+S+D TVR+W  +
Sbjct: 446 GSLDNFDIHVWSVQTGQLLDTLSGHEGPVSCLAFSQENSVLASASWDKTVRVWSIF 501

 Score = 31.6 bits (70), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 68/178 (38%), Gaps = 16/178 (8%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTD-RAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPH 70
           H   + +ID      LL +   D RAI    L N K     VL     K+    V + P 
Sbjct: 54  HRKNIATIDLNKQGTLLISVDEDGRAI----LTNFKAK--TVLHHFNFKEKCYQVKFSPD 107

Query: 71  SDL--LAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLAT 128
             L  LA G F   + IW   D   E+          +  GH  ++  ++WS D   + +
Sbjct: 108 GKLFALATGRF---LQIWKTPDAT-EDRQFAPFVRYRVHAGHFQDILSLTWSLDSRFIIS 163

Query: 129 CSRDKSVWIWETDEAGEEYECISV-LQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWK 185
            S+D +  IW  D   EE +  S+    H   V    +      + + S D  + +W+
Sbjct: 164 TSKDLTARIWSID--SEEKDLASMTFAGHRDYVMGAFFSADQEKIYTVSKDGALFVWE 219

>Kwal_55.22067
          Length = 451

 Score = 60.1 bits (144), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 76/174 (43%), Gaps = 17/174 (9%)

Query: 57  VHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKG 116
            H  AV  + +    D L +G  D TI IW Q + ++ +          + E H   ++G
Sbjct: 123 AHDSAVAVMKYSHAGDWLISGDSDGTIKIW-QPNFNMVK---------VLDEAHTQCIRG 172

Query: 117 ISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSS 176
           IS+S       TCS D  + IW      +E    S L  H  DV+   WH    L+AS S
Sbjct: 173 ISFSGTDSKFVTCSDDNILKIWNFSNGQQE----STLSGHHWDVRSCDWHPTMGLIASGS 228

Query: 177 YDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
            D+ V++W       +C + + G + TI  + F   +  + L   S D + R++
Sbjct: 229 KDNLVKLWDPRAG--QCISTILGCKHTIISTKFQPTKGNM-LAVISKDKSCRIF 279

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 77/174 (44%), Gaps = 24/174 (13%)

Query: 114 VKGISWSQDG--CLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNL 171
           +  + W+ +G   ++AT S + S+W       G  +   S++Q H   V  + +    + 
Sbjct: 86  IPALEWTPEGRRLVVATYSGEFSLW------NGSTFNFESIMQAHDSAVAVMKYSHAGDW 139

Query: 172 LASSSYDDTVRIWKDYDDDWECAAVL-TGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
           L S   D T++IW+    ++    VL   H   I    FS  +     C  SDD+ +++W
Sbjct: 140 LISGDSDGTIKIWQ---PNFNMVKVLDEAHTQCIRGISFSGTDSKFVTC--SDDNILKIW 194

Query: 231 KYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPS-GRIASVGADGVLAVYKEK 283
            +     + QQ    ESTL + H   +    W P+ G IAS   D ++ ++  +
Sbjct: 195 NF----SNGQQ----ESTL-SGHHWDVRSCDWHPTMGLIASGSKDNLVKLWDPR 239

 Score = 36.6 bits (83), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 54/244 (22%), Positives = 104/244 (42%), Gaps = 34/244 (13%)

Query: 4   QLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGK--ENLLDVLDDTVHKKA 61
           Q   +L  H+  V S D+ P  GL+A+GS D  +K+   + G+    +L        K  
Sbjct: 200 QQESTLSGHHWDVRSCDWHPTMGLIASGSKDNLVKLWDPRAGQCISTILGC------KHT 253

Query: 62  VRSVAWRP-HSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWS 120
           + S  ++P   ++LA  S D +  I+     D+ +     M+ LA+    E++   ++W 
Sbjct: 254 IISTKFQPTKGNMLAVISKDKSCRIF-----DIRQ----NMKELAVYRD-ESDYMSLTWH 303

Query: 121 Q-DGCLLATCSRDKSVWIWETDEAGEEYE--CI-SVLQEHSQDVKHVVWHTKHNLLASSS 176
             +  +      D S+  ++  +  ++    C  ++   H + +  + ++   ++LAS+S
Sbjct: 304 PINESMFTVGCYDGSMKHFDLLQEPQDSSSGCFHNIPYAHDKCITSLAYNPVGHILASAS 363

Query: 177 YDDTVRIW---KDYDDDWECAAVLTGHEGTIWCSDFS--------KEEDPIRLCSGSDDS 225
            D T+R W   + YD +          +   W    +        K ED I L   S+DS
Sbjct: 364 KDRTIRFWTRARPYDPNSFDDPTYNNKKVNAWYFGINNNINAIRPKTEDGIALPPASNDS 423

Query: 226 TVRV 229
           T  +
Sbjct: 424 TASI 427

>Scas_629.12
          Length = 671

 Score = 60.5 bits (145), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 82/177 (46%), Gaps = 27/177 (15%)

Query: 62  VRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQ 121
           +RSV + P  + LA G+ D  I IW     D++E      +++ +++GHE +V  + +  
Sbjct: 390 IRSVCFSPDGEFLATGAEDKLIRIW-----DIQE-----RKIVMVLKGHEQDVYSLDYFP 439

Query: 122 DGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTV 181
           +G  L + S D++V IW+        +C   L          V       +A+ S D  V
Sbjct: 440 NGEKLVSGSGDRTVRIWDLRTG----QCSLTLSIEYGVTTVAVSPNDGKFIAAGSLDRAV 495

Query: 182 RIW--------KDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
           R+W        +  D + E     TGH  +++   F+++ +   + SGS D TV++W
Sbjct: 496 RVWDSTTGFLVERLDSENELG---TGHRDSVYSVVFTRDGN--EVVSGSLDKTVKLW 547

 Score = 60.1 bits (144), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 98/242 (40%), Gaps = 30/242 (12%)

Query: 9   LKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWR 68
           LK H   V+S+D+ P    L +GS DR +++  L+ G+ +L   ++       V +VA  
Sbjct: 425 LKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDLRTGQCSLTLSIE-----YGVTTVAVS 479

Query: 69  PH-SDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLA 127
           P+    +AAGS D  + +W  +   L E    E EL     GH + V  + +++DG  + 
Sbjct: 480 PNDGKFIAAGSLDRAVRVWDSTTGFLVERLDSENELGT---GHRDSVYSVVFTRDGNEVV 536

Query: 128 TCSRDKSVWIWETDEAGEEYE-----------CISVLQEHSQDVKHVVWHTKHNLLASSS 176
           + S DK+V +W    +G               C      H   V  V        + S S
Sbjct: 537 SGSLDKTVKLWNMRHSGNSNNESNDKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSGS 596

Query: 177 YDDTVRIWKDYDDDWECAAVLTGHEGTIWC------SDFSKEEDPIRLCSGSDDSTVRVW 230
            D  +  W    +      +L GH  ++        S    + +     +GS D   R+W
Sbjct: 597 KDRGILFWD--KESGNPLLMLQGHRNSVISVAVANGSALGPKYN--VFATGSGDCKARIW 652

Query: 231 KY 232
           KY
Sbjct: 653 KY 654

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 71/157 (45%), Gaps = 18/157 (11%)

Query: 114 VKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLA 173
           ++ + +S DG  LAT + DK + IW+     +E + + VL+ H QDV  + +      L 
Sbjct: 390 IRSVCFSPDGEFLATGAEDKLIRIWDI----QERKIVMVLKGHEQDVYSLDYFPNGEKLV 445

Query: 174 SSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW--- 230
           S S D TVRIW       +C+  L+   G    +      D   + +GS D  VRVW   
Sbjct: 446 SGSGDRTVRIWDLR--TGQCSLTLSIEYGVTTVA--VSPNDGKFIAAGSLDRAVRVWDST 501

Query: 231 -KYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSG 266
             ++ +  D + E      L   HR  +Y V ++  G
Sbjct: 502 TGFLVERLDSENE------LGTGHRDSVYSVVFTRDG 532

>YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential
           protein required for cell separation, has eight WD
           (WD-40) repeats, component of U3 snoRNP (also called
           small subunit processome), which is required for 18S
           rRNA biogenesis [2772 bp, 923 aa]
          Length = 923

 Score = 60.5 bits (145), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 62/265 (23%), Positives = 102/265 (38%), Gaps = 67/265 (25%)

Query: 15  KVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHSDLL 74
           KV  + F P   LLA G T    ++  L +    L+  L  ++ +  V +V+     + L
Sbjct: 262 KVKCVTFHPATRLLAVGFTSGEFRLYDLPDF--TLIQQL--SMGQNPVNTVSVNQTGEWL 317

Query: 75  AAGSF---DSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSR 131
           A GS       +  W      L++            +GH +    +++S DG  + T S 
Sbjct: 318 AFGSSKLGQLLVYEWQSESYILKQ------------QGHFDSTNSLAYSPDGSRVVTASE 365

Query: 132 DKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIW-----KD 186
           D  + +W+         C++  +EH+  V  V +  +  ++ SSS D TVR W     ++
Sbjct: 366 DGKIKVWDITSGF----CLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRN 421

Query: 187 YDD-------DWECAAV------------------------------LTGHEGTIWCSDF 209
           +          + C AV                              L+GHEG + C  F
Sbjct: 422 FRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPVSCLSF 481

Query: 210 SKEEDPIRLCSGSDDSTVRVWKYIG 234
           S+E     L S S D T+R+W   G
Sbjct: 482 SQENSV--LASASWDKTIRIWSIFG 504

 Score = 44.7 bits (104), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 36/181 (19%), Positives = 80/181 (44%), Gaps = 27/181 (14%)

Query: 116 GISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQE-----HSQDVKHVVWHTKHN 170
            + +S DG L A  S  + + IW+T +  ++ +    ++      H QD+  + W     
Sbjct: 101 AVKFSPDGRLFALAS-GRFLQIWKTPDVNKDRQFAPFVRHRVHAGHFQDITSLTWSQDSR 159

Query: 171 LLASSSYDDTVRIWK-DYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRV 229
            + ++S D + +IW  D ++    A    GH   +  + FS +++  ++ + S D  V V
Sbjct: 160 FILTTSKDLSAKIWSVDSEEKNLAATTFNGHRDYVMGAFFSHDQE--KIYTVSKDGAVFV 217

Query: 230 WKYI---------------GDDEDDQQEW---VCESTLPNAHRSQIYGVAWSPSGRIASV 271
           W++                  +E D  ++   + +     A+++++  V + P+ R+ +V
Sbjct: 218 WEFTKRPSDDDDNESEDDDKQEEVDISKYSWRITKKHFFYANQAKVKCVTFHPATRLLAV 277

Query: 272 G 272
           G
Sbjct: 278 G 278

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 48/89 (53%), Gaps = 11/89 (12%)

Query: 65  VAWRPHSDLLAAGSFDST-ISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDG 123
           +A  P  +++ AGS D+  I +W+     ++ G     +LL  + GHE  V  +S+SQ+ 
Sbjct: 436 LAVDPSGEVVCAGSLDNFDIHVWS-----VQTG-----QLLDALSGHEGPVSCLSFSQEN 485

Query: 124 CLLATCSRDKSVWIWETDEAGEEYECISV 152
            +LA+ S DK++ IW      ++ E I V
Sbjct: 486 SVLASASWDKTIRIWSIFGRSQQVEPIEV 514

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 81/185 (43%), Gaps = 17/185 (9%)

Query: 11  LHNDKVWSIDFEPVRGLLATGSTDRAIKVLQL-KNGKENLLD-----VLDDTVHKKAVRS 64
           L N+K ++ ++E  + + A     +   ++ + ++G+  L++     VL     K+   +
Sbjct: 42  LINNKSFTFEYEHRKNIAAIDLNKQGTLLISIDEDGRAILVNFKARNVLHHFNFKEKCSA 101

Query: 65  VAWRPHSDL--LAAGSFDSTISIWTQSDL--DLEEGAKLEMELLAIIEGHENEVKGISWS 120
           V + P   L  LA+G F   + IW   D+  D +    +   + A   GH  ++  ++WS
Sbjct: 102 VKFSPDGRLFALASGRF---LQIWKTPDVNKDRQFAPFVRHRVHA---GHFQDITSLTWS 155

Query: 121 QDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDT 180
           QD   + T S+D S  IW  D + E+    +    H   V    +      + + S D  
Sbjct: 156 QDSRFILTTSKDLSAKIWSVD-SEEKNLAATTFNGHRDYVMGAFFSHDQEKIYTVSKDGA 214

Query: 181 VRIWK 185
           V +W+
Sbjct: 215 VFVWE 219

>YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associated
           splicing factor, member of WD (WD-40) repeat family
           [1398 bp, 465 aa]
          Length = 465

 Score = 59.7 bits (143), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 56/228 (24%), Positives = 95/228 (41%), Gaps = 17/228 (7%)

Query: 5   LAKSLKLHNDKVWSIDFEP-VRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTV-HKKAV 62
           L + L  H  K+ +ID+ P     + + + D  IK  Q  N +E  L +L D V H++ +
Sbjct: 210 LTQKLDSHVGKIGAIDWHPDSNNQMISCAEDGLIKNFQYSN-EEGGLRLLGDLVGHERRI 268

Query: 63  RSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQD 122
             V + P    + + S D T  +W          A    ELL + EGH+  V  +S+  D
Sbjct: 269 SDVKYHPSGKFIGSASHDMTWRLWD---------ASTHQELL-LQEGHDKGVFSLSFQCD 318

Query: 123 GCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVR 182
           G L+ +   D    +W+     +    +  L  HS+ +  V W      +A+   D  + 
Sbjct: 319 GSLVCSGGMDSLSMLWDIRSGSK----VMTLAGHSKPIYTVAWSPNGYQVATGGGDGIIN 374

Query: 183 IWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
           +W     D      +  H   +    FSKE+   +L S   D+ + V+
Sbjct: 375 VWDIRKRDEGQLNQILAHRNIVTQVRFSKEDGGKKLVSCGYDNLINVY 422

 Score = 57.0 bits (136), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 57/230 (24%), Positives = 105/230 (45%), Gaps = 26/230 (11%)

Query: 107 IEGHENEVKGISWSQD-GCLLATCSRDKSV--WIWETDEAGEEYECISVLQEHSQDVKHV 163
           ++ H  ++  I W  D    + +C+ D  +  + +  +E G     +  L  H + +  V
Sbjct: 214 LDSHVGKIGAIDWHPDSNNQMISCAEDGLIKNFQYSNEEGG--LRLLGDLVGHERRISDV 271

Query: 164 VWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSD 223
            +H     + S+S+D T R+W D     E   +  GH+  ++   F  + D   +CSG  
Sbjct: 272 KYHPSGKFIGSASHDMTWRLW-DASTHQELL-LQEGHDKGVFSLSF--QCDGSLVCSGGM 327

Query: 224 DSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSG-RIASVGADGVLAVYKE 282
           DS   +W        D +      TL   H   IY VAWSP+G ++A+ G DG++ V+  
Sbjct: 328 DSLSMLW--------DIRSGSKVMTLA-GHSKPIYTVAWSPNGYQVATGGGDGIINVWDI 378

Query: 283 KQNDSEVSEWEISATYKAAHTVYEINTVKWVNIDGKEMLITAGDDGRVNL 332
           ++ D    E +++      + V +   V++   DG + L++ G D  +N+
Sbjct: 379 RKRD----EGQLNQILAHRNIVTQ---VRFSKEDGGKKLVSCGYDNLINV 421

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 78/175 (44%), Gaps = 18/175 (10%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHS 71
           H+  V+S+ F+    L+ +G  D    +  +++G +    V+    H K + +VAW P+ 
Sbjct: 306 HDKGVFSLSFQCDGSLVCSGGMDSLSMLWDIRSGSK----VMTLAGHSKPIYTVAWSPNG 361

Query: 72  DLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQD--GCLLATC 129
             +A G  D  I++W     D  EG       L  I  H N V  + +S++  G  L +C
Sbjct: 362 YQVATGGGDGIINVWDIRKRD--EGQ------LNQILAHRNIVTQVRFSKEDGGKKLVSC 413

Query: 130 SRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIW 184
             D  + ++ +D     +  +  L  H+  +  +      + L S  +D ++++W
Sbjct: 414 GYDNLINVYSSD----TWLKMGSLAGHTDKIISLDISNNSHFLVSGGWDRSIKLW 464

>Scas_652.16
          Length = 345

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 81/172 (47%), Gaps = 17/172 (9%)

Query: 109 GHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTK 168
           GHE+ +  + +   G  +ATCS D+ + +++ D+   E+E     + H   +  V W + 
Sbjct: 10  GHEDLIHDVVYDFYGRHVATCSSDQHIKVFKLDKETSEWELSDSWKAHDSSIVSVDWASP 69

Query: 169 H--NLLASSSYDDTVRIWKDYDDD-------WECAAVLTGHEGTIWCSDFSKEEDPIRLC 219
               ++ S+SYD TV++W++  D        W     L   +G+++   F+     ++L 
Sbjct: 70  EYGRIIVSASYDKTVKLWEEDPDQPEGSGRRWTKLCTLNDSKGSLYTVKFAPPHLGLKLA 129

Query: 220 SGSDDSTVRVWKYIGDDEDDQQEWVCESTL------PNAHRSQIYGVAWSPS 265
              +D+T+R+++ +  +  D + W   S +      P  H    + +AW PS
Sbjct: 130 CIGNDATLRIYEAL--EPSDLRSWTLTSEVKVLPVPPANHLQSDFCIAWCPS 179

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 77/170 (45%), Gaps = 38/170 (22%)

Query: 21  FEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPH----SDLLAA 76
           F P +  L   + D+A    + K+GK  ++  L+   HK  +R ++W P       L+A 
Sbjct: 181 FSPEK--LVVSTLDQASIYQRGKDGKLYIVAKLNG--HKGLIRDISWAPSIGRWYHLIAT 236

Query: 77  GSFDSTISIWT-------------------QSDLDLEE----------GAKLEMELLAII 107
           G  D  + I+                      D+D+E+          G+ + +ELL+  
Sbjct: 237 GCKDGKLRIFRLVEKLSDNSSKDAINDSYDDEDVDMEDIAENKEKSLLGSSVSVELLSEH 296

Query: 108 EGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHS 157
           + H  E+  +SW+  G +L++   D  V +W++  +  E++C+SV+  +S
Sbjct: 297 DDHNAEIWSVSWNLTGTILSSAGDDGKVRLWKSTYSN-EFKCMSVITSNS 345

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 44/83 (53%), Gaps = 6/83 (7%)

Query: 251 NAHRSQIYGVAWSPSGR-IASVGADGVLAVYKEKQNDSEVSEWEISATYKAAHTVYEINT 309
           + H   I+ V +   GR +A+  +D  + V+K    D E SEWE+S ++KA  +   I +
Sbjct: 9   SGHEDLIHDVVYDFYGRHVATCSSDQHIKVFKL---DKETSEWELSDSWKAHDS--SIVS 63

Query: 310 VKWVNIDGKEMLITAGDDGRVNL 332
           V W + +   ++++A  D  V L
Sbjct: 64  VDWASPEYGRIIVSASYDKTVKL 86

>Kwal_23.5769
          Length = 627

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 74/158 (46%), Gaps = 23/158 (14%)

Query: 73  LLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRD 132
           LL  GS+DST++IW     DL  G     +L+  + GH + VK I +  DG  L T S D
Sbjct: 329 LLFTGSYDSTVAIW-----DLATG-----KLVRRLTGHRDGVKAIYF--DGQKLITGSLD 376

Query: 133 KSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWE 192
           + + +W          C++    HS  V  V  + K  ++ S S D TV++W  + +   
Sbjct: 377 RMIRVWNYVTGA----CVAAYPGHSDSVLSVDSYKK--IIVSGSADKTVKVW--HVESRT 428

Query: 193 CAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
           C   L GH  T W              SGSDD+T+R+W
Sbjct: 429 C-YTLRGH--TEWVGTVKLHPKSFTCFSGSDDTTIRMW 463

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 62/266 (23%), Positives = 97/266 (36%), Gaps = 68/266 (25%)

Query: 4   QLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVR 63
           +L + L  H D V +I F+  +  L TGS DR I+V     G      V     H  +V 
Sbjct: 348 KLVRRLTGHRDGVKAIYFDGQK--LITGSLDRMIRVWNYVTGA----CVAAYPGHSDSVL 401

Query: 64  SVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDG 123
           SV    +  ++ +GS D T+ +W            +E      + GH   V  +      
Sbjct: 402 SVD--SYKKIIVSGSADKTVKVW-----------HVESRTCYTLRGHTEWVGTVKLHPKS 448

Query: 124 CLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHT---KHNL--------- 171
               + S D ++ +W+         C+ V + H   V+ V+  T     NL         
Sbjct: 449 FTCFSGSDDTTIRMWDI----RSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPP 504

Query: 172 ---------------------------LASSSYDDTVRIWKDYDDDWECAAVLTGHEGTI 204
                                      L S S D+T+++W+      +C     GH   I
Sbjct: 505 RNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTG--KCVRTHFGHVEGI 562

Query: 205 WCSDFSKEEDPIRLCSGSDDSTVRVW 230
           W  D +   D  R+ SG+ D TV+VW
Sbjct: 563 W--DIA--ADNFRIVSGAHDKTVKVW 584

 Score = 34.3 bits (77), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 31/65 (47%), Gaps = 6/65 (9%)

Query: 169 HNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVR 228
           + LL + SYD TV IW       +    LTGH   +    F    D  +L +GS D  +R
Sbjct: 327 YRLLFTGSYDSTVAIWDLATG--KLVRRLTGHRDGVKAIYF----DGQKLITGSLDRMIR 380

Query: 229 VWKYI 233
           VW Y+
Sbjct: 381 VWNYV 385

>AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH]
           complement(1061522..1063999) [2478 bp, 825 aa]
          Length = 825

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 67/133 (50%), Gaps = 9/133 (6%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMEL-----LAIIEGHEN 112
           H  +V ++ + P +  LA+GS D  + IW + +  ++    +E +L        +  H+N
Sbjct: 76  HTGSVTALKFSPDNKYLASGSDDKILLIWEKEEGAVQPLFDMENDLEHWNVRRRLVAHDN 135

Query: 113 EVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLL 172
           +++ I W+ D  +L T   D+S+ +W     G  +E I     H   VK VV+   +   
Sbjct: 136 DIQDICWAPDSSILVTVGLDRSIIVWN----GSTFEKIKRFDVHQSHVKGVVFDPANKYF 191

Query: 173 ASSSYDDTVRIWK 185
           A++S D TV++++
Sbjct: 192 ATASDDRTVKVFR 204

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 63/150 (42%), Gaps = 24/150 (16%)

Query: 4   QLAKSL---KLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGK-ENLLDVLDD---- 55
           QL K L     H   V ++ F P    LA+GS D+ + + + + G  + L D+ +D    
Sbjct: 65  QLRKPLANMSRHTGSVTALKFSPDNKYLASGSDDKILLIWEKEEGAVQPLFDMENDLEHW 124

Query: 56  ------TVHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEG 109
                   H   ++ + W P S +L     D +I +W  S            E +   + 
Sbjct: 125 NVRRRLVAHDNDIQDICWAPDSSILVTVGLDRSIIVWNGSTF----------EKIKRFDV 174

Query: 110 HENEVKGISWSQDGCLLATCSRDKSVWIWE 139
           H++ VKG+ +       AT S D++V ++ 
Sbjct: 175 HQSHVKGVVFDPANKYFATASDDRTVKVFR 204

 Score = 33.9 bits (76), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 44/93 (47%), Gaps = 11/93 (11%)

Query: 195 AVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW-------KYIGDDEDDQQEWVCES 247
           A ++ H G++    FS +     L SGSDD  + +W       + + D E+D + W    
Sbjct: 71  ANMSRHTGSVTALKFSPDNK--YLASGSDDKILLIWEKEEGAVQPLFDMENDLEHWNVRR 128

Query: 248 TLPNAHRSQIYGVAWSP-SGRIASVGADGVLAV 279
            L  AH + I  + W+P S  + +VG D  + V
Sbjct: 129 RL-VAHDNDIQDICWAPDSSILVTVGLDRSIIV 160

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 43/215 (20%), Positives = 74/215 (34%), Gaps = 43/215 (20%)

Query: 7   KSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKE-------NLLDVLDDTVHK 59
           K   +H   V  + F+P     AT S DR +KV +   G +        + +    +   
Sbjct: 170 KRFDVHQSHVKGVVFDPANKYFATASDDRTVKVFRYHKGTDLSFTIEHIITEPFQGSPLT 229

Query: 60  KAVRSVAWRPHSDLLAAGSFD----STISIWTQSDLDLE----------EGAKLEMELLA 105
              R ++W P    +A  +      ST++I ++ + D            E A     L  
Sbjct: 230 TYFRRLSWSPDGQHIAVPNATNGPVSTVAIISRGNWDTSVSLVGHDQPTEVACFNPRLFE 289

Query: 106 IIEGHEN--EVKGISWSQDGC-----------------LLATCSRDKSVWIWETDEAGEE 146
             + HE   EV G S                       ++AT  +DK++ +W T  A   
Sbjct: 290 HNDNHERGEEVDGASKDNSAASESSGKRRLKDDDRVDSVIATAGQDKTLAVWSTSRARPI 349

Query: 147 YECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTV 181
           +    +    S+ V  + W      L  +S D  +
Sbjct: 350 FVAYDLT---SKSVTDIAWTCDGTALFLTSLDGRI 381

>Kwal_27.11585
          Length = 823

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 92/222 (41%), Gaps = 25/222 (11%)

Query: 27  LLATGSTDRAIKVLQLKNGKENLLDVLDDTV-------HKKAVRSVAWRPHSDLLAAGSF 79
            + T S D  IK   +     N +D+ +  V       H+K + +++  P+  + A  S+
Sbjct: 465 FIITASNDLTIKKWSVPKPTSNDVDMHNIKVSDYTRRAHEKDINALSISPNDSVFATASY 524

Query: 80  DSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWE 139
           D T  IW     +++ G     EL   +  H+  +  +++ Q   LLATCS DK++ +W 
Sbjct: 525 DKTCKIW-----NVDSG-----ELEGTLANHKRGLWDVTFCQYDKLLATCSGDKTIKVWS 574

Query: 140 TDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTG 199
                E    +  L+ H+  V+   +  ++  + S+  D  +++W       EC   L  
Sbjct: 575 L----ESMSVVKTLEGHTNAVQRCSFINRNKQIVSTGADGLIKVWD--LSTGECIRTLDA 628

Query: 200 HEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQ 241
           H   IW    S   D     +   D   + WK   ++E  + 
Sbjct: 629 HSNRIWA--LSVLSDGKEFVTADADGVFQFWKDCSEEEQKEN 668

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 55/101 (54%), Gaps = 8/101 (7%)

Query: 89  SDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYE 148
           S +D++    LE+EL    EGH + +  +  S++G  LATCS+D +V +W+ +   E+++
Sbjct: 381 SKVDIQNCLPLEVELY---EGHTDLLNSLDSSENGEWLATCSKDHTVILWKLNADSEKFK 437

Query: 149 CISVLQEHSQDV-----KHVVWHTKHNLLASSSYDDTVRIW 184
             +    H+  V      +V+ +T    + ++S D T++ W
Sbjct: 438 PYARFTGHAGPVTAVGLPNVMRNTWPEFIITASNDLTIKKW 478

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 41/187 (21%), Positives = 80/187 (42%), Gaps = 19/187 (10%)

Query: 4   QLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVR 63
           +L  +L  H   +W + F     LLAT S D+ IKV  L++   +++  L+   H  AV+
Sbjct: 537 ELEGTLANHKRGLWDVTFCQYDKLLATCSGDKTIKVWSLES--MSVVKTLEG--HTNAVQ 592

Query: 64  SVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDG 123
             ++   +  + +   D  I +W     DL  G     E +  ++ H N +  +S   DG
Sbjct: 593 RCSFINRNKQIVSTGADGLIKVW-----DLSTG-----ECIRTLDAHSNRIWALSVLSDG 642

Query: 124 CLLATCSRDKSVWIWE---TDEAGEEYECISVLQEHSQDVKHVVWHT--KHNLLASSSYD 178
               T   D     W+    +E  E  E   ++ E  Q +++ +      +  L + + +
Sbjct: 643 KEFVTADADGVFQFWKDCSEEEQKENLENQKLMVEQEQSLQNYMAQGDWTNAFLLAMTLN 702

Query: 179 DTVRIWK 185
             +R+++
Sbjct: 703 HPMRLYR 709

>AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH]
           (409496..411169) [1674 bp, 557 aa]
          Length = 557

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 84/182 (46%), Gaps = 21/182 (11%)

Query: 108 EGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHT 167
           E H +EV GI + QDG  LA+   D +V IW+T     + E + V + H+  VK + WH 
Sbjct: 344 EKHTSEVCGIKFRQDGLQLASGGNDNTVMIWDT----RQDEPLWVKRNHNAAVKAITWHP 399

Query: 168 K-HNLLAS--SSYDDTVRIWKDYDDDWECAAVLTGHEGTI--WCSDF--SKEEDPIRLCS 220
              NLLA+   S D  +  W +        ++ TG + +   W   +  S     I    
Sbjct: 400 DVVNLLATGGGSLDRHIHFW-NTTTGARIGSINTGSQVSSLHWGQSYEDSHMNREIVATG 458

Query: 221 GSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSG-RIASVGADGVLAV 279
           GS D+++ ++ Y      D +  V E T   AH S+I     SP G  IA+VG D  L  
Sbjct: 459 GSPDNSISIYNY------DSKVKVAEIT--QAHESRIVSSQLSPDGTTIATVGGDENLKF 510

Query: 280 YK 281
           Y+
Sbjct: 511 YR 512

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 81/204 (39%), Gaps = 31/204 (15%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIW-TQSDLDLEEGAKLEMELLAIIEGHENEVKG 116
           H   V  + +R     LA+G  D+T+ IW T+ D           E L +   H   VK 
Sbjct: 346 HTSEVCGIKFRQDGLQLASGGNDNTVMIWDTRQD-----------EPLWVKRNHNAAVKA 394

Query: 117 ISWSQDGC-LLAT--CSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVW-------H 166
           I+W  D   LLAT   S D+ +  W T         I  +   SQ V  + W       H
Sbjct: 395 ITWHPDVVNLLATGGGSLDRHIHFWNTTTGAR----IGSINTGSQ-VSSLHWGQSYEDSH 449

Query: 167 TKHNLLAS-SSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDS 225
               ++A+  S D+++ I+ +YD   + A +   HE  I  S  S +   I    G  D 
Sbjct: 450 MNREIVATGGSPDNSISIY-NYDSKVKVAEITQAHESRIVSSQLSPDGTTIATVGG--DE 506

Query: 226 TVRVWKYIGDDEDDQQEWVCESTL 249
            ++ ++         ++   ES L
Sbjct: 507 NLKFYRVFDAKRKKSRDHEAESFL 530

>CAGL0E02805g complement(265137..267659) similar to sp|P32479
           Saccharomyces cerevisiae YBL008w HIR1 histone
           transcription regulator, start by similarity
          Length = 840

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 86/187 (45%), Gaps = 20/187 (10%)

Query: 15  KVWSIDFEPVRGLLATGSTDRAIKV-----LQLKNGKENLLD------VLDDTVHKKAVR 63
           +++++D  P    +ATG  D  I++     L      E+ +D      +   + H  +V 
Sbjct: 19  EIYTVDVSPDGKRVATGGLDGKIRIWSVDALVSAAAGESGVDRDTHRPLASMSRHTGSVT 78

Query: 64  SVAWRPHSDLLAAGSFDSTISIWTQSDLDL-----EEGAKLEMELLAIIEGHENEVKGIS 118
            V + P  + LA+GS D  + IW   + +       EG K    +   +  H+N+++ I 
Sbjct: 79  CVKFSPDGNYLASGSDDRILLIWAMDEENHGGSFGSEGEKEHWTVRKRLVAHDNDIQDIC 138

Query: 119 WSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYD 178
           W+ D  +L T   D+SV +W     G  +E +     H   VK V++   +   A++S D
Sbjct: 139 WAPDSSILVTVGLDRSVIVWN----GLNFERLKRFDVHQSLVKGVIFDPANKYFATASDD 194

Query: 179 DTVRIWK 185
            T+R+++
Sbjct: 195 RTMRVFR 201

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 60/149 (40%), Gaps = 21/149 (14%)

Query: 8   SLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQL----------KNGKENLLDVLDDTV 57
           S+  H   V  + F P    LA+GS DR + +  +            G++    V    V
Sbjct: 69  SMSRHTGSVTCVKFSPDGNYLASGSDDRILLIWAMDEENHGGSFGSEGEKEHWTVRKRLV 128

Query: 58  -HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKG 116
            H   ++ + W P S +L     D ++ +W            L  E L   + H++ VKG
Sbjct: 129 AHDNDIQDICWAPDSSILVTVGLDRSVIVWNG----------LNFERLKRFDVHQSLVKG 178

Query: 117 ISWSQDGCLLATCSRDKSVWIWETDEAGE 145
           + +       AT S D+++ ++   + GE
Sbjct: 179 VIFDPANKYFATASDDRTMRVFRYHKTGE 207

 Score = 36.6 bits (83), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 58/256 (22%), Positives = 100/256 (39%), Gaps = 49/256 (19%)

Query: 108 EGHENEVKGISWSQDGCLLATCSRDKSVWIWETD-----EAGEE------YECISVLQEH 156
           E  + E+  +  S DG  +AT   D  + IW  D      AGE       +  ++ +  H
Sbjct: 14  ESRDYEIYTVDVSPDGKRVATGGLDGKIRIWSVDALVSAAAGESGVDRDTHRPLASMSRH 73

Query: 157 SQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDD-------------WECAAVLTGHEGT 203
           +  V  V +    N LAS S D  + IW   +++             W     L  H+  
Sbjct: 74  TGSVTCVKFSPDGNYLASGSDDRILLIWAMDEENHGGSFGSEGEKEHWTVRKRLVAHDND 133

Query: 204 I----WCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYG 259
           I    W  D S     I +  G D S + VW   G + +  + +       + H+S + G
Sbjct: 134 IQDICWAPDSS-----ILVTVGLDRSVI-VWN--GLNFERLKRF-------DVHQSLVKG 178

Query: 260 VAWSPSGR-IASVGADGVLAVYKEKQNDSEVS---EWEISATYKAAHTVYEINTVKWVNI 315
           V + P+ +  A+   D  + V++  +   EVS   E  I   + A+        + W + 
Sbjct: 179 VIFDPANKYFATASDDRTMRVFRYHKT-GEVSFTIEQVIVEPFIASPLTTYFRRLSW-SP 236

Query: 316 DGKEMLITAGDDGRVN 331
           DG+ + +    +G V+
Sbjct: 237 DGQHIAVPNATNGPVS 252

 Score = 32.3 bits (72), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 43/206 (20%), Positives = 80/206 (38%), Gaps = 37/206 (17%)

Query: 7   KSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQL-KNG------KENLLDVLDDTVHK 59
           K   +H   V  + F+P     AT S DR ++V +  K G      ++ +++    +   
Sbjct: 167 KRFDVHQSLVKGVIFDPANKYFATASDDRTMRVFRYHKTGEVSFTIEQVIVEPFIASPLT 226

Query: 60  KAVRSVAWRPHSDLLAA----------------GSFDSTISIWTQSDLDLEEGAKLEMEL 103
              R ++W P    +A                 G++DS+IS+         E A+    L
Sbjct: 227 TYFRRLSWSPDGQHIAVPNATNGPVSSVAIINRGTWDSSISLIGHD--APTEVARFNPRL 284

Query: 104 L-AIIEGHENEVKGISWSQDG-------CLLATCSRDKSVWIWETDEAGEEYECISVLQE 155
             + +E      K    S+D         ++AT  +DKS+ +W T      +    + Q+
Sbjct: 285 FKSDVEKKAKNAKD-ELSKDTKNNKKLESIIATAGQDKSLALWITSRPRPIFVAYDIAQK 343

Query: 156 HSQDVKHVVWHTKHNLLASSSYDDTV 181
              D   + W+   N+L  +S D ++
Sbjct: 344 SITD---MAWNPNGNILFVTSLDSSI 366

>AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH]
           complement(850726..850730,850789..852685) [1902 bp, 633
           aa]
          Length = 633

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 71/293 (24%), Positives = 127/293 (43%), Gaps = 44/293 (15%)

Query: 9   LKLHNDKVWSIDFEPV-RGLLATGSTDRAIKV-----------LQLKNGK-ENLLDVLDD 55
            + H  +V   DF+P    +L +GS D  I V            Q ++G  E++  V   
Sbjct: 77  FRGHTAQVLDTDFDPFDERMLVSGSDDGRIGVWEIPATYSFHNAQDEDGNVEHVAPVKFL 136

Query: 56  TVHKKAVRSVAWRPHSD-LLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEV 114
           T H++ V  V + P +  +LA+ S D T+ +W     ++E+G         I+  H + V
Sbjct: 137 TGHQRKVGHVLYHPTAQGVLASSSLDHTVRLW-----NVEQGTN------PIVLTHPDMV 185

Query: 115 KGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHS-QDVKHVVWHTKHNLLA 173
             +S+S  G  LAT  RDK + +W+  +     E +S    HS    + VVW    + LA
Sbjct: 186 TSMSFSYGGTYLATVCRDKMLRVWDIRKG----EVVSEGMGHSGPKNQRVVWLGNSDRLA 241

Query: 174 SSSY----DDTVRIWKDYD-DDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVR 228
           ++ +    D  + +W  ++ +  +        + +     F  + + I   +G  D  +R
Sbjct: 242 TTGFSKLSDRQIAVWDAFNLEKGQLGGFYNVDQSSGILMPFYDDSNKILYVAGKGDGNIR 301

Query: 229 VWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYK 281
            +++  D+  +  E+  +ST P        G A +P  R  +V  + VL  YK
Sbjct: 302 YYEFQDDELYELSEF--QSTEPQ------RGFAVAPK-RSVNVKENEVLRAYK 345

>Kwal_27.10385
          Length = 536

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 84/177 (47%), Gaps = 23/177 (12%)

Query: 28  LATGSTDRAIKV--LQLKNGKENLLDVLDD----TVHKKAVRSVAWRPHSDLLAAGSFDS 81
           L T   D  I+V  L  +   EN +D +D     T H++AV  + +   +D+LA    D 
Sbjct: 34  LVTAGGDNKIRVWQLNFEEQNENKVDTIDFLSSLTQHEQAVNVIRFNSRNDVLATAGDDG 93

Query: 82  TISIWTQSD-------LDLEEGAKLE------MELLAIIEGHENEVKGISWSQDGCLLAT 128
            + +W ++D       +D EE A+ +        L +      +E+  ++WS D   + T
Sbjct: 94  QLLLWKRNDSISKEFGVDEEEFAEFKESWYVWKRLRSSSTAGSSEIYDLAWSPDDNYIVT 153

Query: 129 CSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWK 185
            S D S+ I+E +E      C++   +H+  V+ VVW  ++  + S S D +V +++
Sbjct: 154 GSMDNSLRIFEVEEG----TCVANAADHNHYVQGVVWDPQNEFIFSQSADRSVHVYR 206

 Score = 33.5 bits (75), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 39/78 (50%), Gaps = 10/78 (12%)

Query: 65  VAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGC 124
           +AW P  + +  GS D+++ I+     ++EEG       +A    H + V+G+ W     
Sbjct: 142 LAWSPDDNYIVTGSMDNSLRIF-----EVEEGT-----CVANAADHNHYVQGVVWDPQNE 191

Query: 125 LLATCSRDKSVWIWETDE 142
            + + S D+SV ++  ++
Sbjct: 192 FIFSQSADRSVHVYRIEK 209

 Score = 32.7 bits (73), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 41/188 (21%), Positives = 80/188 (42%), Gaps = 35/188 (18%)

Query: 126 LATCSRDKSVWIWETD--EAGEE----YECISVLQEHSQDVKHVVWHTKHNLLASSSYDD 179
           L T   D  + +W+ +  E  E      + +S L +H Q V  + +++++++LA++  D 
Sbjct: 34  LVTAGGDNKIRVWQLNFEEQNENKVDTIDFLSSLTQHEQAVNVIRFNSRNDVLATAGDDG 93

Query: 180 TVRIWKDYD--------DDWECAAVL-----------TGHEGTIWCSDFSKEEDPIRLCS 220
            + +WK  D        D+ E A              +   G+    D +   D   + +
Sbjct: 94  QLLLWKRNDSISKEFGVDEEEFAEFKESWYVWKRLRSSSTAGSSEIYDLAWSPDDNYIVT 153

Query: 221 GSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGR-IASVGADGVLAV 279
           GS D+++R+++         +E  C +   + H   + GV W P    I S  AD  + V
Sbjct: 154 GSMDNSLRIFEV--------EEGTCVANAAD-HNHYVQGVVWDPQNEFIFSQSADRSVHV 204

Query: 280 YKEKQNDS 287
           Y+ ++  S
Sbjct: 205 YRIEKTPS 212

>YCR084C (TUP1) [608] chr3 complement(260307..262448) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by regulated,
           sequence-specific DNA-binding proteins, exists in a
           complex with Ssn6p that is converted to a
           transcriptional activator in a Hog1p-dependent manner
           [2142 bp, 713 aa]
          Length = 713

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 98/239 (41%), Gaps = 27/239 (11%)

Query: 9   LKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWR 68
           L+ H   ++S+D+ P    L +GS DR +++  L+ G+ +L   ++D      V +VA  
Sbjct: 481 LQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIED-----GVTTVAVS 535

Query: 69  P-HSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLA 127
           P     +AAGS D  + +W      L E    E E      GH++ V  + +++DG  + 
Sbjct: 536 PGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGT---GHKDSVYSVVFTRDGQSVV 592

Query: 128 TCSRDKSVWIWETDEAGEEYE--------CISVLQEHSQDVKHVVWHTKHNLLASSSYDD 179
           + S D+SV +W    A  + +        C      H   V  V        + S S D 
Sbjct: 593 SGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDR 652

Query: 180 TVRIWKDYDDDWECAAVLTGHEGTIWC------SDFSKEEDPIRLCSGSDDSTVRVWKY 232
            V  W     +     +L GH  ++        S    E +     +GS D   R+WKY
Sbjct: 653 GVLFWDKKSGN--PLLMLQGHRNSVISVAVANGSPLGPEYN--VFATGSGDCKARIWKY 707

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 71/278 (25%), Positives = 118/278 (42%), Gaps = 45/278 (16%)

Query: 16  VWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHSDLLA 75
           + S+ F P    LATG+ DR I++  ++N K  ++ +L    H++ + S+ + P  D L 
Sbjct: 446 IRSVCFSPDGKFLATGAEDRLIRIWDIENRK--IVMILQG--HEQDIYSLDYFPSGDKLV 501

Query: 76  AGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQ-DGCLLATCSRDKS 134
           +GS D T+ IW     DL  G        ++    E+ V  ++ S  DG  +A  S D++
Sbjct: 502 SGSGDRTVRIW-----DLRTGQ------CSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRA 550

Query: 135 VWIWETDEAGEEYECISVLQE----HSQDVKHVVWHTKHNLLASSSYDDTVRIWK----- 185
           V +W++ E G   E +    E    H   V  VV+      + S S D +V++W      
Sbjct: 551 VRVWDS-ETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNAN 609

Query: 186 -----DYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQ 240
                   +   C     GH+  +     ++ ++ I   SGS D  V  W    D +   
Sbjct: 610 NKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYI--LSGSKDRGVLFW----DKKSGN 663

Query: 241 QEWVCESTLPNAHRSQIYGVA---WSPSGRIASVGADG 275
              + +      HR+ +  VA    SP G   +V A G
Sbjct: 664 PLLMLQ-----GHRNSVISVAVANGSPLGPEYNVFATG 696

>YGL100W (SEH1) [1883] chr7 (313235..314284) Protein found in
           complex with nuclear pore proteins, member of WD (WD-40)
           repeat family [1050 bp, 349 aa]
          Length = 349

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 50/243 (20%), Positives = 109/243 (44%), Gaps = 26/243 (10%)

Query: 109 GHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTK 168
           GH++ V  + +   G  +ATCS D+ + +++ D+    +E     + H   +  + W + 
Sbjct: 7   GHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWASP 66

Query: 169 H--NLLASSSYDDTVRIWKDYDDDWECAA-------VLTGHEGTIWCSDFSKEEDPIRLC 219
               ++AS+SYD TV++W++  D  EC+         L   +G+++   F+     ++L 
Sbjct: 67  EYGRIIASASYDKTVKLWEEDPDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAHLGLKLA 126

Query: 220 SGSDDSTVRVWKYIGDDEDDQQEWVCESTL------PNAHRSQIYGVAWSPSGRIASVGA 273
              +D  +R++  +  +  D + W   S +      P  H    + ++W PS       A
Sbjct: 127 CLGNDGILRLYDAL--EPSDLRSWTLTSEMKVLSIPPANHLQSDFCLSWCPSRFSPEKLA 184

Query: 274 DGVL--AVYKEKQNDSEVSEWEISATYKAAHTVYEINTVKWVNIDGK--EMLITAGDDGR 329
              L  A+  ++  D ++    ++A      ++  I ++ W    G+  +++ T   DGR
Sbjct: 185 VSALEQAIIYQRGKDGKL---HVAAKLPGHKSL--IRSISWAPSIGRWYQLIATGCKDGR 239

Query: 330 VNL 332
           + +
Sbjct: 240 IRI 242

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 77/173 (44%), Gaps = 45/173 (26%)

Query: 21  FEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPH----SDLLAA 76
           F P +  LA  + ++AI   + K+GK ++   L    HK  +RS++W P       L+A 
Sbjct: 178 FSPEK--LAVSALEQAIIYQRGKDGKLHVAAKLPG--HKSLIRSISWAPSIGRWYQLIAT 233

Query: 77  GSFDSTISIWT--------------------------------QSDLDLEEGAKLE---- 100
           G  D  I I+                                 +SD + EE A+L+    
Sbjct: 234 GCKDGRIRIFKITEKLSPLASEESLTNSNMFDNSADVDMDAQGRSDSNTEEKAELQSNLQ 293

Query: 101 MELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVL 153
           +ELL+  + H  EV  +SW+  G +L++   D  V +W+   +  E++C+SV+
Sbjct: 294 VELLSEHDDHNGEVWSVSWNLTGTILSSAGDDGKVRLWKATYSN-EFKCMSVI 345

 Score = 32.3 bits (72), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 52/242 (21%), Positives = 99/242 (40%), Gaps = 27/242 (11%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDT--VHKKAVRSVAWRP 69
           H+D V  + ++     +AT S+D+ IKV +L     N    L D+   H  ++ ++ W  
Sbjct: 8   HDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNW--ELSDSWRAHDSSIVAIDWAS 65

Query: 70  --HSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQD--GCL 125
             +  ++A+ S+D T+ +W + D D EE +      L  +   +  +  + ++    G  
Sbjct: 66  PEYGRIIASASYDKTVKLW-EEDPDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAHLGLK 124

Query: 126 LATCSRDKSVWIWETDEAGE--------EYECISVLQ-EHSQDVKHVVW---HTKHNLLA 173
           LA    D  + +++  E  +        E + +S+    H Q    + W         LA
Sbjct: 125 LACLGNDGILRLYDALEPSDLRSWTLTSEMKVLSIPPANHLQSDFCLSWCPSRFSPEKLA 184

Query: 174 SSSYDDTVRIWKDYDDDWECAAVLTGHEGTI----WCSDFSKEEDPIRLCSGSDDSTVRV 229
            S+ +  +   +  D     AA L GH+  I    W     +    I   +G  D  +R+
Sbjct: 185 VSALEQAIIYQRGKDGKLHVAAKLPGHKSLIRSISWAPSIGRWYQLI--ATGCKDGRIRI 242

Query: 230 WK 231
           +K
Sbjct: 243 FK 244

>CAGL0L02629g complement(307323..309710) similar to sp|P07834
           Saccharomyces cerevisiae YFL009w CDC4 cell division
           control, hypothetical start
          Length = 795

 Score = 58.5 bits (140), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 51/222 (22%), Positives = 99/222 (44%), Gaps = 32/222 (14%)

Query: 9   LKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWR 68
           L  H+  VW++ +    G+L +GSTDR++++  +  GK     V     H   VR +   
Sbjct: 405 LSGHDGGVWALKYAG-NGILVSGSTDRSVRIWNIHLGK--CTHVFKG--HTSTVRCLDIV 459

Query: 69  PHSDL--LAAGSFDSTISIWT---QSDLDLEEG---------------AKLEMELLAIIE 108
            H  +  +  GS D+T+ IW     SD +++EG                +     + ++ 
Sbjct: 460 EHEGVKYIVTGSRDNTLHIWKLPQMSDSNIDEGMPNVYSNNGPLFFHSPEENPYFVGVLR 519

Query: 109 GHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTK 168
           GH   V+ +S    G ++ + S D ++ +W+      + +C+ +L  H+  +   ++  K
Sbjct: 520 GHIASVRTVSG--HGRIVISGSYDNNLIVWDI----IQMKCLYILMGHTDRIYSTIYDYK 573

Query: 169 HNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFS 210
            N   S+S D T++IW D  + W     +     T+ C+  +
Sbjct: 574 RNRCISASMDSTIKIW-DLQNIWNNGECVNVTNATVPCTKIT 614

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 37/71 (52%), Gaps = 5/71 (7%)

Query: 164 VWHTKH---NLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCS 220
           VW  K+    +L S S D +VRIW  +    +C  V  GH  T+ C D  + E    + +
Sbjct: 412 VWALKYAGNGILVSGSTDRSVRIWNIHLG--KCTHVFKGHTSTVRCLDIVEHEGVKYIVT 469

Query: 221 GSDDSTVRVWK 231
           GS D+T+ +WK
Sbjct: 470 GSRDNTLHIWK 480

>ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH]
           (538948..540657) [1710 bp, 569 aa]
          Length = 569

 Score = 57.8 bits (138), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 50/158 (31%), Positives = 74/158 (46%), Gaps = 23/158 (14%)

Query: 73  LLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRD 132
           LL  GS+DST++IW     DL  G     +L+  + GH + VK + +  D   L T S D
Sbjct: 271 LLLTGSYDSTVAIW-----DLATG-----KLIRRLSGHTDGVKALRF--DDQKLITGSLD 318

Query: 133 KSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWE 192
           K++ +W          C+S  + H   V  V   +   L+ S S D TV++W  + +   
Sbjct: 319 KTIRVWNYVTGA----CVSTYRGHQDSVLSV--DSFRKLIVSGSADKTVKVW--HVESRT 370

Query: 193 CAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
           C   L GH G + C     +       SGSDD T+R+W
Sbjct: 371 CYT-LRGHTGWVNCVKLHPKS--FTCFSGSDDMTIRMW 405

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 82/198 (41%), Gaps = 27/198 (13%)

Query: 7   KSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVA 66
           +  K H D V S+       LL TGS D  + +  L  GK  L+  L    H   V+  A
Sbjct: 253 QEFKGHMDGVLSLQL--TNKLLLTGSYDSTVAIWDLATGK--LIRRLSG--HTDGVK--A 304

Query: 67  WRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLL 126
            R     L  GS D TI +W     +   GA      ++   GH++ V  +   +   L+
Sbjct: 305 LRFDDQKLITGSLDKTIRVW-----NYVTGA-----CVSTYRGHQDSVLSVDSFRK--LI 352

Query: 127 ATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKD 186
            + S DK+V +W      E   C + L+ H+  V  V  H K     S S D T+R+W  
Sbjct: 353 VSGSADKTVKVWHV----ESRTCYT-LRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDI 407

Query: 187 YDDDWECAAVLTGHEGTI 204
             +   C  V  GH G +
Sbjct: 408 RTN--TCVRVFHGHVGQV 423

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 91/242 (37%), Gaps = 40/242 (16%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHS 71
           H D V S+D    R L+ +GS D+ +KV  +++     L       H   V  V   P S
Sbjct: 338 HQDSVLSVD--SFRKLIVSGSADKTVKVWHVESRTCYTL-----RGHTGWVNCVKLHPKS 390

Query: 72  DLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSR 131
               +GS D TI +W     D+          + +  GH  +V+ +     G  L    +
Sbjct: 391 FTCFSGSDDMTIRMW-----DIRTNT-----CVRVFHGHVGQVQKVIPLTLGSDLIEDPK 440

Query: 132 DKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDW 191
           D  V    T  A +           + +  H + +  H  L S S D+T+++W       
Sbjct: 441 DAVVPPDATAPAHDP-------SVQAANFDHSLPYPTH--LLSCSLDNTIKLWNVKTG-- 489

Query: 192 ECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPN 251
            C     GH   +W  D +   D  R+ SGS D + +VW        D Q   C  T   
Sbjct: 490 ACIRTQFGHVEGVW--DIA--ADNFRIVSGSHDRSCKVW--------DLQTGKCMHTFVG 537

Query: 252 AH 253
            H
Sbjct: 538 IH 539

 Score = 33.5 bits (75), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 32/65 (49%), Gaps = 6/65 (9%)

Query: 169 HNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVR 228
           + LL + SYD TV IW       +    L+GH   +    F    D  +L +GS D T+R
Sbjct: 269 NKLLLTGSYDSTVAIWDLATG--KLIRRLSGHTDGVKALRF----DDQKLITGSLDKTIR 322

Query: 229 VWKYI 233
           VW Y+
Sbjct: 323 VWNYV 327

>KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces
           cerevisiae YBL008w HIR1 histone transcription regulator,
           start by similarity
          Length = 861

 Score = 58.2 bits (139), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 87/195 (44%), Gaps = 33/195 (16%)

Query: 15  KVWSIDFEPVRGLLATGSTDRAIKV------LQLKNG------KENLLDVLDD-TVHKKA 61
           +V++ D  P    LATG  D  I++      L+  +       K+ L+  L   + H  +
Sbjct: 19  EVYTCDVSPDSQRLATGGLDGKIRIWSIPDILKFASNPNASTDKDILMKPLSTMSRHAGS 78

Query: 62  VRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEM-----------ELLAIIEGH 110
           V +V + P    LA+GS D  + IW     +LE G    M            +   +  H
Sbjct: 79  VTTVKFSPDGKYLASGSDDRILLIW-----ELEGGTTQPMFGAESTDIEHWNVRRRLVAH 133

Query: 111 ENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHN 170
           +N+++ I W+ D  ++ +   D+++ IW     G  +E +     H   VK VV+   + 
Sbjct: 134 DNDIQDICWAPDSSIMVSVGLDRAIIIWN----GSTFEKVKRFDVHQSHVKGVVFDPANK 189

Query: 171 LLASSSYDDTVRIWK 185
             A++S D T+++++
Sbjct: 190 YFATASDDRTIKMFR 204

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 62/150 (41%), Gaps = 22/150 (14%)

Query: 8   SLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDT----------- 56
           ++  H   V ++ F P    LA+GS DR + + +L+ G    +   + T           
Sbjct: 71  TMSRHAGSVTTVKFSPDGKYLASGSDDRILLIWELEGGTTQPMFGAESTDIEHWNVRRRL 130

Query: 57  -VHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVK 115
             H   ++ + W P S ++ +   D  I IW  S            E +   + H++ VK
Sbjct: 131 VAHDNDIQDICWAPDSSIMVSVGLDRAIIIWNGSTF----------EKVKRFDVHQSHVK 180

Query: 116 GISWSQDGCLLATCSRDKSVWIWETDEAGE 145
           G+ +       AT S D+++ ++   + GE
Sbjct: 181 GVVFDPANKYFATASDDRTIKMFRYHKTGE 210

 Score = 36.2 bits (82), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 53/132 (40%), Gaps = 27/132 (20%)

Query: 172 LASSSYDDTVRIWK---------------DYDDDWECAAVLTGHEGTIWCSDFSKEEDPI 216
           LA+   D  +RIW                D D   +  + ++ H G++    FS   D  
Sbjct: 32  LATGGLDGKIRIWSIPDILKFASNPNASTDKDILMKPLSTMSRHAGSVTTVKFS--PDGK 89

Query: 217 RLCSGSDDSTVRVWK--------YIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSP-SGR 267
            L SGSDD  + +W+          G +  D + W     L  AH + I  + W+P S  
Sbjct: 90  YLASGSDDRILLIWELEGGTTQPMFGAESTDIEHWNVRRRL-VAHDNDIQDICWAPDSSI 148

Query: 268 IASVGADGVLAV 279
           + SVG D  + +
Sbjct: 149 MVSVGLDRAIII 160

>Scas_704.40
          Length = 608

 Score = 57.8 bits (138), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 52/158 (32%), Positives = 75/158 (47%), Gaps = 23/158 (14%)

Query: 73  LLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRD 132
           LL  GS+DST++IW   DL          +L+  + GH + VK + +  D   L T S D
Sbjct: 265 LLFTGSYDSTVAIW---DL-------CSNKLIRRLSGHTDGVKTLYF--DEAKLVTGSLD 312

Query: 133 KSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWE 192
           K++ +W         ECIS  + H+  V  V    K  ++ S S D TV+IW  + +   
Sbjct: 313 KTIRVWNYKTG----ECISTYRGHTDSVMSVDAFKK--IIVSGSADKTVKIW--HVESRT 364

Query: 193 CAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
           C   L GH  T W +            SGSDD+T+R+W
Sbjct: 365 CYT-LRGH--TEWVNCVKLHPKSFTCFSGSDDTTIRMW 399

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 95/225 (42%), Gaps = 30/225 (13%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHS 71
           H D V S+D    + ++ +GS D+ +K+  +++     L       H + V  V   P S
Sbjct: 332 HTDSVMSVD--AFKKIIVSGSADKTVKIWHVESRTCYTL-----RGHTEWVNCVKLHPKS 384

Query: 72  DLLAAGSFDSTISIW---TQSDLDLEEGAKLEME---LLAIIEGHENEVKGISWSQDGCL 125
               +GS D+TI +W   T S L +  G   +++    L II+     V  IS S +G  
Sbjct: 385 FTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEG-- 442

Query: 126 LATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWK 185
                 D+         A       +   E +Q +   + +  H  L S S D+T+++W 
Sbjct: 443 -----DDEPASTTTPTAAIAAEAATN--DEENQTLDKSIPYPTH--LLSCSLDNTIKLWD 493

Query: 186 DYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
                 +C     GH   +W  D +   D  R+ SGS D ++++W
Sbjct: 494 V--QTGQCIRTQFGHVEGVW--DIA--ADNFRIISGSHDGSIKIW 532

 Score = 33.9 bits (76), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 32/64 (50%), Gaps = 6/64 (9%)

Query: 169 HNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVR 228
           + LL + SYD TV IW    +  +    L+GH   +    F    D  +L +GS D T+R
Sbjct: 263 YRLLFTGSYDSTVAIWDLCSN--KLIRRLSGHTDGVKTLYF----DEAKLVTGSLDKTIR 316

Query: 229 VWKY 232
           VW Y
Sbjct: 317 VWNY 320

>CAGL0J08778g 866175..867071 highly similar to sp|Q04491
           Saccharomyces cerevisiae YLR208w SEC13, start by
           similarity
          Length = 298

 Score = 57.0 bits (136), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 79/176 (44%), Gaps = 26/176 (14%)

Query: 123 GCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVW-HTKH-NLLASSSYDDT 180
           G  LATCS DK++ I+E +  GE ++ +  L  H   V  V W H K   +LAS SYD  
Sbjct: 21  GKKLATCSSDKTIKIFEVE--GESHKLVDTLVGHEGPVWRVDWAHPKFGTILASCSYDGK 78

Query: 181 VRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQ 240
           V IWK+ +D W   AV   H  ++    ++  E    L + S D  V V ++       +
Sbjct: 79  VIIWKEENDRWSQIAVHAVHTASVNSVQWAPHEYGALLLAASSDGKVSVVEF-------K 131

Query: 241 QEWVCESTLPNAHRSQIYGVAWSPSG---------------RIASVGADGVLAVYK 281
           +       + +AH   +   +W+P+                R  + GAD ++ +++
Sbjct: 132 ENGTATPLIFDAHAIGVNAASWAPATVEGGNNPGEAPKEVRRFVTGGADNLVKIWR 187

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 71/299 (23%), Positives = 116/299 (38%), Gaps = 44/299 (14%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAW--RP 69
           HND +     +     LAT S+D+ IK+ +++     L+D L    H+  V  V W    
Sbjct: 8   HNDLIHDAVLDYYGKKLATCSSDKTIKIFEVEGESHKLVDTL--VGHEGPVWRVDWAHPK 65

Query: 70  HSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWS--QDGCLLA 127
              +LA+ S+D  + IW + +    +        +A+   H   V  + W+  + G LL 
Sbjct: 66  FGTILASCSYDGKVIIWKEENDRWSQ--------IAVHAVHTASVNSVQWAPHEYGALLL 117

Query: 128 TCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKH--------------NLLA 173
             S D  V + E  E G     I     H+  V    W                      
Sbjct: 118 AASSDGKVSVVEFKENGTATPLI--FDAHAIGVNAASWAPATVEGGNNPGEAPKEVRRFV 175

Query: 174 SSSYDDTVRIWKDYDDDWECAAV---LTGHEGTIWCSDFSKEEDPI---RLCSGSDDSTV 227
           +   D+ V+IW+ Y+ + +   V   L GH  + W  D +     +    + S S D T 
Sbjct: 176 TGGADNLVKIWR-YNPETQSYLVEDTLEGH--SDWVRDVAWSPSVLLRSYIASVSQDRTC 232

Query: 228 RVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASV-GADGVLAVYKEKQN 285
            +W      ED+   WV     P      ++  +WS SG I ++ G D  + ++KE  N
Sbjct: 233 NIWT----QEDNTGPWVKTQLTPEEFPDVLWRASWSLSGNILAISGGDNKVTLWKENLN 287

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 59/119 (49%), Gaps = 10/119 (8%)

Query: 172 LASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWK 231
           LA+ S D T++I++   +  +    L GHEG +W  D++  +    L S S D  V +WK
Sbjct: 24  LATCSSDKTIKIFEVEGESHKLVDTLVGHEGPVWRVDWAHPKFGTILASCSYDGKVIIWK 83

Query: 232 YIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSP---SGRIASVGADGVLAVYKEKQNDS 287
               +E+D+   +    +   H + +  V W+P      + +  +DG ++V + K+N +
Sbjct: 84  ----EENDRWSQIAVHAV---HTASVNSVQWAPHEYGALLLAASSDGKVSVVEFKENGT 135

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 57/119 (47%), Gaps = 17/119 (14%)

Query: 217 RLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPS--GRI-ASVGA 273
           +L + S D T+++++  G+        V        H   ++ V W+    G I AS   
Sbjct: 23  KLATCSSDKTIKIFEVEGESHKLVDTLV-------GHEGPVWRVDWAHPKFGTILASCSY 75

Query: 274 DGVLAVYKEKQNDSEVSEWEISATYKAAHTVYEINTVKWVNIDGKEMLITAGDDGRVNL 332
           DG + ++KE +ND     W   A + A HT   +N+V+W   +   +L+ A  DG+V++
Sbjct: 76  DGKVIIWKE-END----RWSQIAVH-AVHTA-SVNSVQWAPHEYGALLLAASSDGKVSV 127

>Kwal_56.24596
          Length = 294

 Score = 57.0 bits (136), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 77/172 (44%), Gaps = 22/172 (12%)

Query: 123 GCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVW-HTKHN-LLASSSYDDT 180
           G  LATCS DK++ I+E +  GE ++ +  L  H   V  V W H K   +LAS SYD  
Sbjct: 21  GKRLATCSSDKTIKIFEVE--GETHKLVETLHGHEGPVWQVDWAHPKFGVILASCSYDGK 78

Query: 181 VRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQ 240
           V IWK+ +  W   AV   H  ++    ++  E    L + S D  V V ++       +
Sbjct: 79  VLIWKEENGRWTQIAVHAVHSASVNSVQWAPHEYGPLLLAASSDGKVSVVEF-------K 131

Query: 241 QEWVCESTLPNAHRSQIYGVAWSPSG-----------RIASVGADGVLAVYK 281
           +       L +AH   +   +W+ +            R  + GAD ++ V+K
Sbjct: 132 ENGTTSPILVDAHSIGVNTASWASAALQGGAVSQQMRRFVTGGADNLVKVWK 183

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 64/248 (25%), Positives = 104/248 (41%), Gaps = 32/248 (12%)

Query: 4   QLAKSLKLHNDKVWSIDF-EPVRG-LLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKA 61
           +L ++L  H   VW +D+  P  G +LA+ S D  + + + +NG+   + V    VH  +
Sbjct: 44  KLVETLHGHEGPVWQVDWAHPKFGVILASCSYDGKVLIWKEENGRWTQIAV--HAVHSAS 101

Query: 62  VRSVAWRPH--SDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISW 119
           V SV W PH    LL A S D  +S+     ++ +E       L   ++ H   V   SW
Sbjct: 102 VNSVQWAPHEYGPLLLAASSDGKVSV-----VEFKENGTTSPIL---VDAHSIGVNTASW 153

Query: 120 S----QDGCL------LATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTK- 168
           +    Q G +        T   D  V +W+ +     Y     L+ H+  V+ V W    
Sbjct: 154 ASAALQGGAVSQQMRRFVTGGADNLVKVWKFNPDANTYLLEDTLEGHTDWVRDVAWSPSV 213

Query: 169 --HNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEG---TIWCSDFSKEEDPIRLCSGSD 223
              + LAS S D T  IW   ++       L   +     +W + +S   + + L  G  
Sbjct: 214 LLRSYLASVSQDRTCIIWTQENNQGPWKKTLLKEDKFSDVLWRASWSLSGNILALSGG-- 271

Query: 224 DSTVRVWK 231
           D+ V +WK
Sbjct: 272 DNKVTLWK 279

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 67/275 (24%), Positives = 112/275 (40%), Gaps = 38/275 (13%)

Query: 28  LATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAW--RPHSDLLAAGSFDSTISI 85
           LAT S+D+ IK+ +++     L++ L    H+  V  V W       +LA+ S+D  + I
Sbjct: 24  LATCSSDKTIKIFEVEGETHKLVETLHG--HEGPVWQVDWAHPKFGVILASCSYDGKVLI 81

Query: 86  WTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWS--QDGCLLATCSRDKSVWIWETDEA 143
           W +     E G   ++ + A+   H   V  + W+  + G LL   S D  V + E  E 
Sbjct: 82  WKE-----ENGRWTQIAVHAV---HSASVNSVQWAPHEYGPLLLAASSDGKVSVVEFKEN 133

Query: 144 GEEYECISVLQEHSQDVKHVVWHT----------KHNLLASSSYDDTVRIWKDYDD--DW 191
           G     +  +  HS  V    W +          +     +   D+ V++WK   D   +
Sbjct: 134 GTTSPIL--VDAHSIGVNTASWASAALQGGAVSQQMRRFVTGGADNLVKVWKFNPDANTY 191

Query: 192 ECAAVLTGHEGTIWCSDFSKEEDPI---RLCSGSDDSTVRVWKYIGDDEDDQQEWVCEST 248
                L GH  T W  D +     +    L S S D T  +W      E++Q  W     
Sbjct: 192 LLEDTLEGH--TDWVRDVAWSPSVLLRSYLASVSQDRTCIIWT----QENNQGPWKKTLL 245

Query: 249 LPNAHRSQIYGVAWSPSGRIASV-GADGVLAVYKE 282
             +     ++  +WS SG I ++ G D  + ++KE
Sbjct: 246 KEDKFSDVLWRASWSLSGNILALSGGDNKVTLWKE 280

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 76/168 (45%), Gaps = 17/168 (10%)

Query: 150 ISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDF 209
           +++   H++ +   V       LA+ S D T++I++   +  +    L GHEG +W  D+
Sbjct: 2   VTITNAHTELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLVETLHGHEGPVWQVDW 61

Query: 210 SKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSP---SG 266
           +  +  + L S S D  V +WK      ++   W  +  +   H + +  V W+P     
Sbjct: 62  AHPKFGVILASCSYDGKVLIWK------EENGRW-TQIAVHAVHSASVNSVQWAPHEYGP 114

Query: 267 RIASVGADGVLAVYKEKQNDSEVSEWEISATYKAAHTVYEINTVKWVN 314
            + +  +DG ++V + K+N +       S     AH++  +NT  W +
Sbjct: 115 LLLAASSDGKVSVVEFKENGT------TSPILVDAHSI-GVNTASWAS 155

 Score = 36.2 bits (82), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 52/123 (42%), Gaps = 12/123 (9%)

Query: 28  LATGSTDRAIKVLQLKNGKENLLDVLDDTV--HKKAVRSVAWRPHSDL---LAAGSFDST 82
             TG  D  +KV +        L  L+DT+  H   VR VAW P   L   LA+ S D T
Sbjct: 170 FVTGGADNLVKVWKFNPDANTYL--LEDTLEGHTDWVRDVAWSPSVLLRSYLASVSQDRT 227

Query: 83  ISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDE 142
             IWTQ +        L  E     +   + +   SWS  G +LA    D  V +W+ + 
Sbjct: 228 CIIWTQENNQGPWKKTLLKE-----DKFSDVLWRASWSLSGNILALSGGDNKVTLWKENL 282

Query: 143 AGE 145
            G+
Sbjct: 283 EGK 285

 Score = 32.0 bits (71), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 57/121 (47%), Gaps = 21/121 (17%)

Query: 217 RLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGR---IASVGA 273
           RL + S D T+++++  G+        + E+   + H   ++ V W+       +AS   
Sbjct: 23  RLATCSSDKTIKIFEVEGETHK-----LVETL--HGHEGPVWQVDWAHPKFGVILASCSY 75

Query: 274 DGVLAVYKEKQNDSEVSEWEISATYKAAHTVYE--INTVKWVNIDGKEMLITAGDDGRVN 331
           DG + ++KE     E   W    T  A H V+   +N+V+W   +   +L+ A  DG+V+
Sbjct: 76  DGKVLIWKE-----ENGRW----TQIAVHAVHSASVNSVQWAPHEYGPLLLAASSDGKVS 126

Query: 332 L 332
           +
Sbjct: 127 V 127

>YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 snoRNP
           (renamed small subunit processome - SSU processome),
           which is required for 18S rRNA biogenesis [2832 bp, 943
           aa]
          Length = 943

 Score = 57.8 bits (138), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 94/232 (40%), Gaps = 30/232 (12%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLK-------NGKENLLDVLD---DTVHKKA 61
           H+  +WS+D       L TGS D+ +K    K         K   L VL    DT  +  
Sbjct: 472 HDAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVENSLVPGTKNKFLPVLKLHHDTTLELT 531

Query: 62  --VRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISW 119
             +  V   P    LA    D+T+ ++    LD        M+    + GH+  V  I  
Sbjct: 532 DDILCVRVSPDDRYLAISLLDNTVKVFF---LD-------SMKFYLSLYGHKLPVLSIDI 581

Query: 120 SQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDD 179
           S D  ++ T S DK++ IW  D      +C   L  H   + +V +  + +   S S D 
Sbjct: 582 SFDSKMIITSSADKNIKIWGLDFG----DCHKSLFAHQDSIMNVKFLPQSHNFFSCSKDA 637

Query: 180 TVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWK 231
            V+ W    + +EC   L  H+  +W    +   D   + S S D ++R+W+
Sbjct: 638 VVKYWD--GEKFECIQKLYAHQSEVWA--LAVATDGGFVVSSSHDHSIRIWE 685

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 52/188 (27%), Positives = 80/188 (42%), Gaps = 25/188 (13%)

Query: 9   LKLHNDK-------VWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKA 61
           LKLH+D        +  +   P    LA    D  +KV  L + K      L    HK  
Sbjct: 520 LKLHHDTTLELTDDILCVRVSPDDRYLAISLLDNTVKVFFLDSMKF----YLSLYGHKLP 575

Query: 62  VRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQ 121
           V S+     S ++   S D  I IW    LD  +  K    L A    H++ +  + +  
Sbjct: 576 VLSIDISFDSKMIITSSADKNIKIW---GLDFGDCHK---SLFA----HQDSIMNVKFLP 625

Query: 122 DGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTV 181
                 +CS+D  V  W+    GE++ECI  L  H  +V  +   T    + SSS+D ++
Sbjct: 626 QSHNFFSCSKDAVVKYWD----GEKFECIQKLYAHQSEVWALAVATDGGFVVSSSHDHSI 681

Query: 182 RIWKDYDD 189
           RIW++ +D
Sbjct: 682 RIWEETED 689

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 64/142 (45%), Gaps = 18/142 (12%)

Query: 3   LQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKV--LQLKNGKENLLDVLDDTVHKK 60
           ++   SL  H   V SID      ++ T S D+ IK+  L   +  ++L        H+ 
Sbjct: 563 MKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLF------AHQD 616

Query: 61  AVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWS 120
           ++ +V + P S    + S D+ +  W        +G K E   +  +  H++EV  ++ +
Sbjct: 617 SIMNVKFLPQSHNFFSCSKDAVVKYW--------DGEKFEC--IQKLYAHQSEVWALAVA 666

Query: 121 QDGCLLATCSRDKSVWIWETDE 142
            DG  + + S D S+ IWE  E
Sbjct: 667 TDGGFVVSSSHDHSIRIWEETE 688

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 46/159 (28%), Positives = 72/159 (45%), Gaps = 21/159 (13%)

Query: 27  LLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHSDLLAAGSFDSTISIW 86
           LLA G  D  IKV  L + K  LL+      HK A+  + +      L +GS DS I +W
Sbjct: 93  LLAVGYADGVIKVWDLMS-KTVLLNF---NGHKAAITLLQFDGTGTRLISGSKDSNIIVW 148

Query: 87  TQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEE 146
              DL  E G       L  +  H++ + G  W Q    L + S+D  + +W+     + 
Sbjct: 149 ---DLVGEVG-------LYKLRSHKDSITGF-WCQGEDWLISTSKDGMIKLWDL----KT 193

Query: 147 YECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWK 185
           ++CI     H+ +   +    K +LL ++  D  V+IWK
Sbjct: 194 HQCIETHIAHTGECWGLA--VKDDLLITTGTDSQVKIWK 230

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 74/170 (43%), Gaps = 23/170 (13%)

Query: 71  SDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCS 130
           +DLLA G  D  I +W   DL       +   +L    GH+  +  + +   G  L + S
Sbjct: 91  TDLLAVGYADGVIKVW---DL-------MSKTVLLNFNGHKAAITLLQFDGTGTRLISGS 140

Query: 131 RDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDD 190
           +D ++ +W  D  GE    +  L+ H   +    W    + L S+S D  +++W      
Sbjct: 141 KDSNIIVW--DLVGE--VGLYKLRSHKDSITG-FWCQGEDWLISTSKDGMIKLWD--LKT 193

Query: 191 WECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQ 240
            +C      H G  W       +D + + +G+ DS V++WK   D E+D+
Sbjct: 194 HQCIETHIAHTGECWGLAV---KDDLLITTGT-DSQVKIWKL--DIENDK 237

 Score = 37.0 bits (84), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 79/189 (41%), Gaps = 27/189 (14%)

Query: 103 LLAIIE-GHENEVKGISWSQDGCLLATCSRDKSVWIWETD-----EAGEEYECISVLQEH 156
           LL  IE  H+  +  +  + DG  L T S DK+V  W+         G + + + VL+ H
Sbjct: 464 LLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVENSLVPGTKNKFLPVLKLH 523

Query: 157 -------SQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDF 209
                  + D+  V        LA S  D+TV+++  + D  +    L GH+  +   D 
Sbjct: 524 HDTTLELTDDILCVRVSPDDRYLAISLLDNTVKVF--FLDSMKFYLSLYGHKLPVLSIDI 581

Query: 210 SKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSP-SGRI 268
           S   D   + + S D  +++W   G D  D     C  +L  AH+  I  V + P S   
Sbjct: 582 S--FDSKMIITSSADKNIKIW---GLDFGD-----CHKSL-FAHQDSIMNVKFLPQSHNF 630

Query: 269 ASVGADGVL 277
            S   D V+
Sbjct: 631 FSCSKDAVV 639

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 32/73 (43%), Gaps = 10/73 (13%)

Query: 166 HTKHNLLASSSYDDTVRIWKDYDDDWECAAVL---TGHEGTIWCSDFSKEEDPIRLCSGS 222
           H   +LLA    D  +++W     D     VL    GH+  I    F  +    RL SGS
Sbjct: 88  HKDTDLLAVGYADGVIKVW-----DLMSKTVLLNFNGHKAAITLLQF--DGTGTRLISGS 140

Query: 223 DDSTVRVWKYIGD 235
            DS + VW  +G+
Sbjct: 141 KDSNIIVWDLVGE 153

>Scas_695.15
          Length = 327

 Score = 57.0 bits (136), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 89/223 (39%), Gaps = 19/223 (8%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHS 71
           H   V S+ F+     + T S D  IKV  +++       V  +  H   V  V   P+ 
Sbjct: 94  HKGNVTSVSFQQDNKWMVTSSEDGTIKVWDVRSPS-----VPRNYKHNAPVNEVVIHPNQ 148

Query: 72  DLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSR 131
             L +   D TI IW     DL E    +     I +     ++ +S + DG +L   + 
Sbjct: 149 GELISCDRDGTIKIW-----DLGEN---QCTHQLIPDDDNTSLQSLSVASDGSMLVAANN 200

Query: 132 DKSVWIWETDEA--GEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWK--DY 187
               ++WE          + I+    H   +  VV  +    +A+ S D T +IW   + 
Sbjct: 201 KGDCYVWEMPNHTDASNLKPINKFSAHKDYITRVVLSSDVKHMATCSADRTAKIWSVGET 260

Query: 188 DDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
           +DD+     L GH+  +W   FS   D   L + S D  VR+W
Sbjct: 261 EDDFNLETTLDGHQRWVWDCAFS--ADSAYLVTASSDHYVRLW 301

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 5/81 (6%)

Query: 104 LAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHV 163
           +A  EGH+  V  +S+ QD   + T S D ++ +W+          +    +H+  V  V
Sbjct: 88  VATFEGHKGNVTSVSFQQDNKWMVTSSEDGTIKVWDVRSPS-----VPRNYKHNAPVNEV 142

Query: 164 VWHTKHNLLASSSYDDTVRIW 184
           V H     L S   D T++IW
Sbjct: 143 VIHPNQGELISCDRDGTIKIW 163

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 43/106 (40%), Gaps = 16/106 (15%)

Query: 48  NLLDVLDDTVHKKAVRSVAWRPHSDLLAAGSFDSTISIW----TQSDLDLEEGAKLEMEL 103
           NL  +   + HK  +  V        +A  S D T  IW    T+ D +LE         
Sbjct: 217 NLKPINKFSAHKDYITRVVLSSDVKHMATCSADRTAKIWSVGETEDDFNLE--------- 267

Query: 104 LAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWE--TDEAGEEY 147
              ++GH+  V   ++S D   L T S D  V +W+  T E   +Y
Sbjct: 268 -TTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQY 312

>Scas_721.32
          Length = 822

 Score = 57.4 bits (137), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 63/251 (25%), Positives = 101/251 (40%), Gaps = 30/251 (11%)

Query: 40  LQLKNGKENLLDVLDDTVHKK--AVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEE-- 95
           ++L N +  L  V   T H     + S+ +   S L+AAG  DS I +W+     L++  
Sbjct: 466 IKLDNLQAALPSVCMYTFHNTNGGMTSLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQ 525

Query: 96  --------GAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEY 147
                      +       + GH   V   S+S D   L + S DK+V +W TD     Y
Sbjct: 526 EKSADSINTGDMNDNTSTTLIGHSGAVYSTSFSPDNRYLLSGSEDKTVRLWSTD----TY 581

Query: 148 ECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCS 207
             +   + H+  V  V +    +  A++S+D T R+W    D      +  GH   + C 
Sbjct: 582 TSLVSYKGHNHPVWDVQFSPLGHYFATASHDQTARLWS--CDHIYPLRIFAGHLSDVDCV 639

Query: 208 DFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGR 267
            F    +   + +GS D T R+W     D            L   H + +   A SP GR
Sbjct: 640 SF--HPNGCYVFTGSSDKTCRMWDISTGD---------SVRLFLGHTAPVLCTAVSPDGR 688

Query: 268 -IASVGADGVL 277
            +A+   DG++
Sbjct: 689 WLATGSEDGII 699

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 80/178 (44%), Gaps = 19/178 (10%)

Query: 8   SLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAW 67
           S K HN  VW + F P+    AT S D+  ++       +++  +     H   V  V++
Sbjct: 586 SYKGHNHPVWDVQFSPLGHYFATASHDQTARLWSC----DHIYPLRIFAGHLSDVDCVSF 641

Query: 68  RPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLA 127
            P+   +  GS D T  +W     D+  G  + + L     GH   V   + S DG  LA
Sbjct: 642 HPNGCYVFTGSSDKTCRMW-----DISTGDSVRLFL-----GHTAPVLCTAVSPDGRWLA 691

Query: 128 TCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKH-NLLASSSYDDTVRIW 184
           T S D  + +W+   A    + + V++ H ++  H + + K  N+L S   D +VR+W
Sbjct: 692 TGSEDGIINLWDIGTA----KRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVW 745

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 54/223 (24%), Positives = 89/223 (39%), Gaps = 29/223 (13%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHS 71
           H+  V+S  F P    L +GS D+ +++       +    ++    H   V  V + P  
Sbjct: 548 HSGAVYSTSFSPDNRYLLSGSEDKTVRLWS----TDTYTSLVSYKGHNHPVWDVQFSPLG 603

Query: 72  DLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSR 131
              A  S D T  +W+             +  L I  GH ++V  +S+  +GC + T S 
Sbjct: 604 HYFATASHDQTARLWSCD----------HIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSS 653

Query: 132 DKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDW 191
           DK+  +W+        + + +   H+  V           LA+ S D  + +W     D 
Sbjct: 654 DKTCRMWDISTG----DSVRLFLGHTAPVLCTAVSPDGRWLATGSEDGIINLW-----DI 704

Query: 192 ECA---AVLTGH-EGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
             A    V+ GH +  I    + KE +   L SG  D +VRVW
Sbjct: 705 GTAKRLKVMRGHGKNAIHSLSYCKEGN--VLVSGGADHSVRVW 745

>Kwal_23.5035
          Length = 744

 Score = 57.4 bits (137), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 47/207 (22%), Positives = 92/207 (44%), Gaps = 25/207 (12%)

Query: 4   QLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVR 63
           +    L  H+  VW++ +    G+L +GSTDR+++V  +K+GK     V     H   VR
Sbjct: 401 KFITQLSGHDGGVWALKYGH-DGILVSGSTDRSVRVWNIKSGK--CTHVFKG--HTSTVR 455

Query: 64  SVAWRPHS--DLLAAGSFDSTISIWTQSDLDLEEGAKLEME----------LLAIIEGHE 111
            +    H+    +  GS D T+ +W   + + E+      E           + ++ GH 
Sbjct: 456 CLDIVEHNGKKFIVTGSRDHTLHVWKLPNCNAEDYNPEVCEVFNTTDANPYFVGVLRGHM 515

Query: 112 NEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNL 171
             V+ +S    G ++ + S D ++ +W+      + +C+ VL  H+  +   ++  + N 
Sbjct: 516 AAVRTVSG--HGNIVVSGSYDFNLMVWDI----AQMKCLYVLTGHTDRIYSTIYDYQRNR 569

Query: 172 LASSSYDDTVRIW--KDYDDDWECAAV 196
             S+  D TV++W   D   +  C  +
Sbjct: 570 CISAGMDSTVKVWDLADVSKNGPCTTI 596

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 72/182 (39%), Gaps = 19/182 (10%)

Query: 107 IEGHENEVKGISWSQDGCL------LATCSRDKSVWIWETDEAGEEYECISVLQEHSQDV 160
            + H   ++G +     CL      + T + DK + ++  D   E++  I+ L  H   V
Sbjct: 358 FKPHRTTLRGHTMKIVTCLQFEDDYVITGADDKMIRVY--DAKTEKF--ITQLSGHDGGV 413

Query: 161 KHVVWHTKHN---LLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIR 217
               W  K+    +L S S D +VR+W       +C  V  GH  T+ C D  +      
Sbjct: 414 ----WALKYGHDGILVSGSTDRSVRVWNI--KSGKCTHVFKGHTSTVRCLDIVEHNGKKF 467

Query: 218 LCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVL 277
           + +GS D T+ VWK    + +D    VCE            GV       + +V   G +
Sbjct: 468 IVTGSRDHTLHVWKLPNCNAEDYNPEVCEVFNTTDANPYFVGVLRGHMAAVRTVSGHGNI 527

Query: 278 AV 279
            V
Sbjct: 528 VV 529

>AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH]
           complement(442821..445589) [2769 bp, 922 aa]
          Length = 922

 Score = 57.4 bits (137), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 82/216 (37%), Gaps = 58/216 (26%)

Query: 108 EGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHT 167
           +GH + +  +++S DG  + T + D  + IW+         C++  +EH+  V  V +  
Sbjct: 353 QGHFDALNALAYSPDGARIVTAAEDGKIKIWDIVSGF----CLATFEEHTSSVTSVQFAK 408

Query: 168 KHNLLASSSYDDTVRIW-----------------------KDYDDDWECAA--------- 195
              ++ SSS D TV+ W                        D   +  CA          
Sbjct: 409 NGQIMFSSSLDGTVKAWDLMRFRNFRTFTATERIQFSCLAADPTGEVVCAGSLDNYDIQV 468

Query: 196 ----------VLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVC 245
                      L+GHEG + C  FS+E     L S S D T+RVW   G  +  +     
Sbjct: 469 WSVQTGQLLDTLSGHEGPVSCLSFSRENSI--LASASWDKTIRVWSIFGRSQQVE----- 521

Query: 246 ESTLPNAHRSQIYGVAWSPSGRIASVGA-DGVLAVY 280
               P    S +  ++  P G+  +V   +G L+ +
Sbjct: 522 ----PIEAYSDVLDISMRPDGKQVAVSTLNGQLSFF 553

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 66/143 (46%), Gaps = 20/143 (13%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIK---VLQLKNGKENLLDVLDDTVHKKAVRSVAWR 68
           H   V S+ F     ++ + S D  +K   +++ +N +            +     +A  
Sbjct: 397 HTSSVTSVQFAKNGQIMFSSSLDGTVKAWDLMRFRNFRTF------TATERIQFSCLAAD 450

Query: 69  PHSDLLAAGSFDST-ISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLA 127
           P  +++ AGS D+  I +W+     ++ G     +LL  + GHE  V  +S+S++  +LA
Sbjct: 451 PTGEVVCAGSLDNYDIQVWS-----VQTG-----QLLDTLSGHEGPVSCLSFSRENSILA 500

Query: 128 TCSRDKSVWIWETDEAGEEYECI 150
           + S DK++ +W      ++ E I
Sbjct: 501 SASWDKTIRVWSIFGRSQQVEPI 523

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 57/129 (44%), Gaps = 11/129 (8%)

Query: 111 ENEVKGISWSQDGCLLA-TCSRDKSVWIWETDEAGEEYECISVLQE-----HSQDVKHVV 164
           +++V  + +S DG L A  C R   + IW T     E +    ++      H  D+  + 
Sbjct: 112 KDKVNDVKFSTDGKLFALACGR--FLQIWRTPGVSAERQFAPFVRYRVHAGHFADITSLT 169

Query: 165 WHTKHNLLASSSYDDTVRIWKDYDDDWECAAV-LTGHEGTIWCSDFSKEEDPIRLCSGSD 223
           W      + S++ D T RI+    ++ + A++   GH   +  + FS +++ I     S 
Sbjct: 170 WSRDSRFIISTAKDMTARIYSVNAEEKDLASMTFAGHRDYVMGAFFSADQEKIYTV--SK 227

Query: 224 DSTVRVWKY 232
           D  +  W+Y
Sbjct: 228 DGALFQWEY 236

>Kwal_14.1611
          Length = 334

 Score = 56.6 bits (135), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 55/248 (22%), Positives = 103/248 (41%), Gaps = 30/248 (12%)

Query: 106 IIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVW 165
            I GHE+ V  IS+   G  +ATCS D+ + ++       E++     + H   V  + W
Sbjct: 4   FITGHEDLVHDISYDFYGRHVATCSSDQHIKVFRLVRETNEWQLSDSWKAHDSSVVGLDW 63

Query: 166 HTKH--NLLASSSYDDTVRIWKDYDDDWECAA-------VLTGHEGTIWCSDFSKEEDPI 216
            +     ++AS SYD  V +W++  D  EC+         L    G ++   F+     +
Sbjct: 64  ASPEYGRIIASVSYDKQVNLWEEEPDAAECSGRRWTKLCTLNDATGPLFSVKFAPGHLGL 123

Query: 217 RLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTL------PNAHRSQIYGVAWSPSG---- 266
           +L +  +D  +R+++ +  +  D + W   S +      P +H    + + W PS     
Sbjct: 124 KLGAIGNDGILRIYEAM--EPSDLRSWTLTSEVKVLPSPPASHLQSDFCLTWCPSRFSPE 181

Query: 267 RIASVGADGVLAVYKEKQNDSEVSEWEISATYKAAHTVYEINTVKWVNIDGK--EMLITA 324
           ++     D  L   K+K         ++    K       I +V W    G+  +++ TA
Sbjct: 182 KLIVCALDQALIYQKDKAG-------KLYVAAKLEGHAGLIRSVSWAPSVGRWYQLIATA 234

Query: 325 GDDGRVNL 332
             DG+V +
Sbjct: 235 CKDGKVRI 242

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 70/162 (43%), Gaps = 29/162 (17%)

Query: 21  FEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPH----SDLLAA 76
           F P +  L   + D+A+   + K GK  +   L+   H   +RSV+W P       L+A 
Sbjct: 178 FSPEK--LIVCALDQALIYQKDKAGKLYVAAKLEG--HAGLIRSVSWAPSVGRWYQLIAT 233

Query: 77  GSFDSTISIW-----TQSDLDLEE---------------GAKLEMELLAIIEGHENEVKG 116
              D  + I+      Q D D                   + L++EL++  + H  EV  
Sbjct: 234 ACKDGKVRIFKLMETAQDDQDAMSVDQVEEESENGSESIPSSLKVELVSESDDHRGEVWS 293

Query: 117 ISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQ 158
           +SW+  G +L++   D  V +W+   +  E++C+SV+    +
Sbjct: 294 VSWNLTGTILSSAGDDGKVRLWKASYS-SEFKCMSVISAQQK 334

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 29/133 (21%), Positives = 58/133 (43%), Gaps = 31/133 (23%)

Query: 100 EMELLAIIEGHENEVKGISWSQDGC----LLATCSRDKSVWIWETDEAGEE--------- 146
           ++ + A +EGH   ++ +SW+        L+AT  +D  V I++  E  ++         
Sbjct: 201 KLYVAAKLEGHAGLIRSVSWAPSVGRWYQLIATACKDGKVRIFKLMETAQDDQDAMSVDQ 260

Query: 147 -----------------YECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWK-DYD 188
                             E +S   +H  +V  V W+    +L+S+  D  VR+WK  Y 
Sbjct: 261 VEEESENGSESIPSSLKVELVSESDDHRGEVWSVSWNLTGTILSSAGDDGKVRLWKASYS 320

Query: 189 DDWECAAVLTGHE 201
            +++C +V++  +
Sbjct: 321 SEFKCMSVISAQQ 333

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 67/313 (21%), Positives = 121/313 (38%), Gaps = 47/313 (15%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDD-TVHKKAVRSVAWRP- 69
           H D V  I ++     +AT S+D+ IKV +L   + N   + D    H  +V  + W   
Sbjct: 8   HEDLVHDISYDFYGRHVATCSSDQHIKVFRLVR-ETNEWQLSDSWKAHDSSVVGLDWASP 66

Query: 70  -HSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQD--GCLL 126
            +  ++A+ S+D  +++W + + D  E +      L  +      +  + ++    G  L
Sbjct: 67  EYGRIIASVSYDKQVNLW-EEEPDAAECSGRRWTKLCTLNDATGPLFSVKFAPGHLGLKL 125

Query: 127 ATCSRDKSVWIWETDEAGE--------EYECI-SVLQEHSQDVKHVVW---HTKHNLLAS 174
                D  + I+E  E  +        E + + S    H Q    + W         L  
Sbjct: 126 GAIGNDGILRIYEAMEPSDLRSWTLTSEVKVLPSPPASHLQSDFCLTWCPSRFSPEKLIV 185

Query: 175 SSYDDTVRIWKDYDDDWECAAVLTGHEGTI----WCSDFSKEEDPIRLCSGSDDSTVRVW 230
            + D  +   KD       AA L GH G I    W     +    I   +   D  VR++
Sbjct: 186 CALDQALIYQKDKAGKLYVAAKLEGHAGLIRSVSWAPSVGRWYQLI--ATACKDGKVRIF 243

Query: 231 KYIGDDEDDQQEWVCEST----------LPNA-----------HRSQIYGVAWSPSGRI- 268
           K +   +DDQ     +            +P++           HR +++ V+W+ +G I 
Sbjct: 244 KLMETAQDDQDAMSVDQVEEESENGSESIPSSLKVELVSESDDHRGEVWSVSWNLTGTIL 303

Query: 269 ASVGADGVLAVYK 281
           +S G DG + ++K
Sbjct: 304 SSAGDDGKVRLWK 316

>KLLA0D04840g 413362..414273 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8 required for
           transport of permeases from the golgi to the plasma
           membrane, start by similarity
          Length = 303

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 92/225 (40%), Gaps = 19/225 (8%)

Query: 8   SLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAW 67
           S + H   V SI F+     + + S D  IKV  +++       V  +  H   V  VA 
Sbjct: 70  SFEGHKGNVTSIAFQQENRWMVSSSEDGTIKVWDVRSPS-----VQRNYKHNAPVNEVAI 124

Query: 68  RPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLA 127
            P+   L +   D  I IW     DL E          +       ++ +S + DG +L 
Sbjct: 125 HPNQGELISCDQDGNIRIW-----DLGENQCTNQ----LTPEDNTPLQSLSVASDGSMLV 175

Query: 128 TCSRDKSVWIWETDEA--GEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWK 185
             +   + ++W+          E ++  + H++ +  V+       LA+ S D T R+W 
Sbjct: 176 AGNNKGNCYVWKMPHHTDASTLEPVTKFKSHTKYITRVLLSADVKHLATCSADHTARVW- 234

Query: 186 DYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
           + +D++E    L GH+  +W   FS   D   L +   D  VR+W
Sbjct: 235 NIEDNFELETTLDGHQRWVWDCAFSA--DSAYLVTACSDHYVRLW 277

 Score = 28.1 bits (61), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 35/92 (38%), Gaps = 11/92 (11%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGI 117
           H K +  V        LA  S D T  +W   D           EL   ++GH+  V   
Sbjct: 206 HTKYITRVLLSADVKHLATCSADHTARVWNIED---------NFELETTLDGHQRWVWDC 256

Query: 118 SWSQDGCLLATCSRDKSVWIWE--TDEAGEEY 147
           ++S D   L T   D  V +W+  T E   +Y
Sbjct: 257 AFSADSAYLVTACSDHYVRLWDLSTSEIVRQY 288

>KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1 40S
           small subunit ribosomal protein, start by similarity
          Length = 326

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 68/141 (48%), Gaps = 6/141 (4%)

Query: 97  AKLEMELLAIIEGHENEVKGISWSQ-DGCLLATCSRDKSVWIWETDEAGEEYEC-ISVLQ 154
           + + + L   +EGH   V  +S S     LL + SRDK++  W   E  +++   +   +
Sbjct: 4   SNIMLVLRGTLEGHNGWVTSLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYK 63

Query: 155 EHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEED 214
            HS  V+ VV     N   S+S+D T+R+W     + E  A   GH G +     + + +
Sbjct: 64  GHSHIVQDVVVSADGNYAVSASWDKTLRLWNLATGNSE--ARFVGHTGDVLS--VAIDAN 119

Query: 215 PIRLCSGSDDSTVRVWKYIGD 235
             ++ S S D T+RVW  +GD
Sbjct: 120 SSKIISASRDKTIRVWNTVGD 140

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 56/242 (23%), Positives = 91/242 (37%), Gaps = 31/242 (12%)

Query: 3   LQLAKSLKLHNDKVWSIDFEPVR-GLLATGSTDRAIKVLQLKNGKENL-LDVLDDTVHKK 60
           L L  +L+ HN  V S+     +  LL +GS D+ +   +L   ++   + V     H  
Sbjct: 8   LVLRGTLEGHNGWVTSLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSH 67

Query: 61  AVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWS 120
            V+ V      +   + S+D T+ +W  +  + E          A   GH  +V  ++  
Sbjct: 68  IVQDVVVSADGNYAVSASWDKTLRLWNLATGNSE----------ARFVGHTGDVLSVAID 117

Query: 121 QDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNL--------- 171
            +   + + SRDK++ +W T       +C  VL  H+  V  V    K NL         
Sbjct: 118 ANSSKIISASRDKTIRVWNTVG-----DCAYVLLGHTDWVTKVRVAPK-NLEDGEVDDGR 171

Query: 172 --LASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRV 229
               S+  D  VR W   +D +   A   GH   I  +      D     S   D  + V
Sbjct: 172 ITFVSAGMDKIVRSWSLNEDSYRIEADFIGHNNYI--NVVQPSPDGSLAASAGKDGQIYV 229

Query: 230 WK 231
           W 
Sbjct: 230 WN 231

 Score = 31.6 bits (70), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 39/79 (49%), Gaps = 9/79 (11%)

Query: 14  DKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTV--HKKA----VRSVAW 67
           D+V+++ F P R  L T +T   IK+  L+N  E L+D L      + KA      S+AW
Sbjct: 245 DEVFALAFSPSRFWL-TAATASGIKIYDLEN--EVLIDELKPEFAGYTKAQDPHAVSLAW 301

Query: 68  RPHSDLLAAGSFDSTISIW 86
                 L AG  D+ I +W
Sbjct: 302 SADGQTLFAGYTDNVIRVW 320

>CAGL0M05335g complement(569132..571552) similar to sp|P38129
           Saccharomyces cerevisiae YBR198c Transcription
           initiation factor TFIID 90, hypothetical start
          Length = 806

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 89/219 (40%), Gaps = 21/219 (9%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHS 71
           H+  V+S  F P    L +GS D+ +K+  +    +    +++   H   V  V + P  
Sbjct: 532 HSGTVYSTSFSPDNMYLVSGSEDKTVKLWSM----DTHTALVNYKGHNHPVWDVKFSPLG 587

Query: 72  DLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSR 131
              A+ S D T  +W          A   +  L I  GH N+V  +S+  +GC + T S 
Sbjct: 588 HYFASASHDQTARLW----------ACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSS 637

Query: 132 DKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDW 191
           DK+  +W+        + + +   H+  V           LA+ S D  + +W D     
Sbjct: 638 DKTCRMWDVSTG----DSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGVICLW-DIGTGK 692

Query: 192 ECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
               +    +  +    F+KE +   L SG  D +VRVW
Sbjct: 693 RIKQMRGHGKNAVHSLSFNKEGN--VLISGGADHSVRVW 729

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 76/176 (43%), Gaps = 19/176 (10%)

Query: 10  KLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRP 69
           K HN  VW + F P+    A+ S D+  ++       +++  +     H   V +V++ P
Sbjct: 572 KGHNHPVWDVKFSPLGHYFASASHDQTARLWAC----DHIYPLRIFAGHTNDVDTVSFHP 627

Query: 70  HSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATC 129
           +   +  GS D T  +W     D+  G  + + L     GH   V     S DG  LAT 
Sbjct: 628 NGCYVFTGSSDKTCRMW-----DVSTGDSVRLFL-----GHTAPVLSTQVSPDGRWLATG 677

Query: 130 SRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKH-NLLASSSYDDTVRIW 184
           S D  + +W+        + I  ++ H ++  H +   K  N+L S   D +VR+W
Sbjct: 678 SEDGVICLWDIGTG----KRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVW 729

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 65/256 (25%), Positives = 103/256 (40%), Gaps = 36/256 (14%)

Query: 39  VLQLKNGKENLLDVLDDTVHK--KAVRSVAWRPHSDLLAAGSFDSTISIWT--QSDLDLE 94
            ++L N +  L  V   T H   + + S+ +     L AAG  DS I IW+   S L   
Sbjct: 451 AIKLDNLQAALPSVCMYTFHNTNRDMTSLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINP 510

Query: 95  EGAKLEMELLA------IIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYE 148
           + +  + +  +       + GH   V   S+S D   L + S DK+V +W  D     + 
Sbjct: 511 KYSSSQFDRFSQDNTCSTLVGHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMD----THT 566

Query: 149 CISVLQEHSQDVKHVVWHTKHNLL----ASSSYDDTVRIWKDYDDDWECAAVLTGHEGTI 204
            +   + H+    H VW  K + L    AS+S+D T R+W    D      +  GH   +
Sbjct: 567 ALVNYKGHN----HPVWDVKFSPLGHYFASASHDQTARLWA--CDHIYPLRIFAGHTNDV 620

Query: 205 WCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSP 264
               F    +   + +GS D T R+W     D            L   H + +     SP
Sbjct: 621 DTVSF--HPNGCYVFTGSSDKTCRMWDVSTGD---------SVRLFLGHTAPVLSTQVSP 669

Query: 265 SGR-IASVGADGVLAV 279
            GR +A+   DGV+ +
Sbjct: 670 DGRWLATGSEDGVICL 685

 Score = 28.9 bits (63), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 40/95 (42%), Gaps = 5/95 (5%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVH-KKAVRSVAWRPH 70
           H   V S    P    LATGS D  I +  +  GK     +     H K AV S+++   
Sbjct: 658 HTAPVLSTQVSPDGRWLATGSEDGVICLWDIGTGKR----IKQMRGHGKNAVHSLSFNKE 713

Query: 71  SDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLA 105
            ++L +G  D ++ +W       E+G + E    A
Sbjct: 714 GNVLISGGADHSVRVWDVKHGTTEQGPEPEQPFNA 748

>ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH]
           complement(387122..388393) [1272 bp, 423 aa]
          Length = 423

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 112/236 (47%), Gaps = 27/236 (11%)

Query: 57  VHKKAVRSVAWRPH-SDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVK 115
            HK+    +A+ PH S  L +GS D+T+++W     D+E   K +    +I+  H++ V 
Sbjct: 184 FHKENGYGLAFNPHISGELLSGSDDTTVALW-----DIEAAKKPK----SILTSHDDIVN 234

Query: 116 GISWSQ-DGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKH--NLL 172
            + W + +  +  T S DK++ + +     E  + +           + +  +KH  NLL
Sbjct: 235 DVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPF-----NTLSFSKHSRNLL 289

Query: 173 ASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW-- 230
           A++  D  + ++ D  D      V++GH+ ++   +FS   D I   SGSD   + +W  
Sbjct: 290 AAAGVDSQIYLY-DMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAI-IWDL 347

Query: 231 KYIGDD--EDDQQEWVCESTLPNA-HRSQIYGVAWSPSGR--IASVGADGVLAVYK 281
             IG +  +DD  +   E  + +A HRS +   +++P     +AS   D V+  +K
Sbjct: 348 TQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWK 403

>CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30, hypothetical start
          Length = 673

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 76/158 (48%), Gaps = 23/158 (14%)

Query: 73  LLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRD 132
           LL  GS+D+T++IW     DL  G     +L+  + GH + VK + +  D   L T S D
Sbjct: 346 LLFTGSYDTTVAIW-----DLFTG-----KLIRRLTGHSDGVKTLYF--DDQKLITGSLD 393

Query: 133 KSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWE 192
           K++ +W         ECIS  + H+  V  V  H K  ++ S S D TV++W  + +   
Sbjct: 394 KTIRVWNYITG----ECISTYRGHTDSVMSVDSHKK--IIVSGSADKTVKVW--HVESRT 445

Query: 193 CAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
           C   L GH  T W +            S SDD+T+R+W
Sbjct: 446 CYT-LKGH--TEWVNCVKLHPKSFSCYSCSDDTTIRMW 480

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 57/272 (20%), Positives = 100/272 (36%), Gaps = 74/272 (27%)

Query: 4   QLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVR 63
           +L + L  H+D V ++ F+  +  L TGS D+ I+V     G+     +     H  +V 
Sbjct: 365 KLIRRLTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNYITGEC----ISTYRGHTDSVM 418

Query: 64  SVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDG 123
           SV    H  ++ +GS D T+ +W            +E      ++GH   V  +      
Sbjct: 419 SVD--SHKKIIVSGSADKTVKVW-----------HVESRTCYTLKGHTEWVNCVKLHPKS 465

Query: 124 CLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHT---KHNL--------- 171
               +CS D ++ +W+         C+ V + H   V+ V+  T     NL         
Sbjct: 466 FSCYSCSDDTTIRMWDI----RTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGE 521

Query: 172 ---------------------------------LASSSYDDTVRIWKDYDDDWECAAVLT 198
                                            L S + D+T+++W+       C     
Sbjct: 522 EDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSG--RCIRTQF 579

Query: 199 GHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
           GH   +W  D +   D  R+ SGS D ++++W
Sbjct: 580 GHVEGVW--DIA--ADNFRIISGSHDGSIKIW 607

 Score = 37.0 bits (84), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 33/65 (50%), Gaps = 6/65 (9%)

Query: 169 HNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVR 228
           + LL + SYD TV IW  +    +    LTGH   +    F    D  +L +GS D T+R
Sbjct: 344 YRLLFTGSYDTTVAIWDLFTG--KLIRRLTGHSDGVKTLYF----DDQKLITGSLDKTIR 397

Query: 229 VWKYI 233
           VW YI
Sbjct: 398 VWNYI 402

>YLR208W (SEC13) [3609] chr12 (559553..560446) Component of the
           COPII coat of vesicles involved in endoplasmic reticulum
           to Golgi transport, contains six WD (WD-40) repeats [894
           bp, 297 aa]
          Length = 297

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 77/175 (44%), Gaps = 25/175 (14%)

Query: 123 GCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVW-HTKH-NLLASSSYDDT 180
           G  LATCS DK++ I+E +  GE ++ I  L  H   V  V W H K   +LAS SYD  
Sbjct: 21  GKRLATCSSDKTIKIFEVE--GETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGK 78

Query: 181 VRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQ 240
           V IWK+ +  W   AV   H  ++    ++  E    L   S D  V V ++       +
Sbjct: 79  VLIWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGPLLLVASSDGKVSVVEF-------K 131

Query: 241 QEWVCESTLPNAHRSQIYGVAWSP--------------SGRIASVGADGVLAVYK 281
           +       + +AH   +   +W+P              S +  + GAD ++ ++K
Sbjct: 132 ENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWK 186

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 112/274 (40%), Gaps = 61/274 (22%)

Query: 28  LATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAW--RPHSDLLAAGSFDSTISI 85
           LAT S+D+ IK+ +++     L+D L  T H+  V  V W       +LA+ S+D  + I
Sbjct: 24  LATCSSDKTIKIFEVEGETHKLIDTL--TGHEGPVWRVDWAHPKFGTILASCSYDGKVLI 81

Query: 86  WTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWS--QDGCLLATCSRDKSVWIWETDEA 143
           W +     E G   ++ + A+   H   V  + W+  + G LL   S D  V + E  E 
Sbjct: 82  WKE-----ENGRWSQIAVHAV---HSASVNSVQWAPHEYGPLLLVASSDGKVSVVEFKEN 133

Query: 144 GEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGT 203
           G     I  +  H+  V    W                      ++D E       H GT
Sbjct: 134 GTTSPII--IDAHAIGVNSASWAP-----------------ATIEEDGE-------HNGT 167

Query: 204 IWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWS 263
                    ++  +  +G  D+ V++WKY      D Q +V ESTL   H   +  VAWS
Sbjct: 168 ---------KESRKFVTGGADNLVKIWKY----NSDAQTYVLESTL-EGHSDWVRDVAWS 213

Query: 264 PS----GRIASVGADGVLAVYKEKQNDSEVSEWE 293
           P+      +ASV  D    ++ +   D+E   W+
Sbjct: 214 PTVLLRSYLASVSQDRTCIIWTQ---DNEQGPWK 244

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 66/251 (26%), Positives = 104/251 (41%), Gaps = 35/251 (13%)

Query: 4   QLAKSLKLHNDKVWSIDF-EPVRG-LLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKA 61
           +L  +L  H   VW +D+  P  G +LA+ S D  + + + +NG+ + + V    VH  +
Sbjct: 44  KLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQIAV--HAVHSAS 101

Query: 62  VRSVAWRPH--SDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISW 119
           V SV W PH    LL   S D  +S+     ++ +E          II+ H   V   SW
Sbjct: 102 VNSVQWAPHEYGPLLLVASSDGKVSV-----VEFKENGTTSP---IIIDAHAIGVNSASW 153

Query: 120 -------------SQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWH 166
                        +++     T   D  V IW+ +   + Y   S L+ HS  V+ V W 
Sbjct: 154 APATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWS 213

Query: 167 TK---HNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEG---TIWCSDFSKEEDPIRLCS 220
                 + LAS S D T  IW   ++       L   E     +W + +S   + + L  
Sbjct: 214 PTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSG 273

Query: 221 GSDDSTVRVWK 231
           G  D+ V +WK
Sbjct: 274 G--DNKVTLWK 282

 Score = 36.6 bits (83), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 56/123 (45%), Gaps = 12/123 (9%)

Query: 28  LATGSTDRAIKVLQLKNGKENLLDVLDDTV--HKKAVRSVAWRPHSDL---LAAGSFDST 82
             TG  D  +K+ +  +  +    VL+ T+  H   VR VAW P   L   LA+ S D T
Sbjct: 173 FVTGGADNLVKIWKYNSDAQTY--VLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRT 230

Query: 83  ISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDE 142
             IWTQ   D E+G   +  L    E   + +   SWS  G +LA    D  V +W+ + 
Sbjct: 231 CIIWTQ---DNEQGPWKKTLLKE--EKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENL 285

Query: 143 AGE 145
            G+
Sbjct: 286 EGK 288

>YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription
           inhibitor, required for periodic repression of 3 of the
           4 histone gene loci and for autogenous repression of
           HTA1-HTB1 locus by H2A and H2B, member of WD (WD-40)
           repeat family [2523 bp, 840 aa]
          Length = 840

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 67/137 (48%), Gaps = 16/137 (11%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEE------GAKLEME---LLAIIE 108
           H  ++  V + P    LA+GS D  + IW    LD E+      G++ E E   +   + 
Sbjct: 78  HTGSITCVKFSPDGKYLASGSDDRILLIWA---LDEEQSSQPAFGSEHEREHWTVRKRLV 134

Query: 109 GHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTK 168
            H+N+++ I W+ D  +L T   D+SV +W     G  +E +     H   VK VV+   
Sbjct: 135 AHDNDIQDICWAPDSSILVTVGLDRSVIVWN----GSTFEKLKRFDVHQSLVKGVVFDPA 190

Query: 169 HNLLASSSYDDTVRIWK 185
           +   A++S D T++I++
Sbjct: 191 NKYFATTSDDRTMKIFR 207

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 88/224 (39%), Gaps = 32/224 (14%)

Query: 74  LAAGSFDSTISIWT-QSDLDLEEGAKLEMEL---------LAIIEGHENEVKGISWSQDG 123
           LA G  D  I IW+  S L   E   L  E+         L  +  H   +  + +S DG
Sbjct: 32  LATGGLDGKIRIWSIDSILRCMELESLTPEIPLPQDLQMPLCSMSRHTGSITCVKFSPDG 91

Query: 124 CLLATCSRDKSVWIWETDE-------AGEEYE-----CISVLQEHSQDVKHVVWHTKHNL 171
             LA+ S D+ + IW  DE        G E+E         L  H  D++ + W    ++
Sbjct: 92  KYLASGSDDRILLIWALDEEQSSQPAFGSEHEREHWTVRKRLVAHDNDIQDICWAPDSSI 151

Query: 172 LASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIR--LCSGSDDSTVRV 229
           L +   D +V +W      +E       H+  +    F    DP      + SDD T+++
Sbjct: 152 LVTVGLDRSVIVWN--GSTFEKLKRFDVHQSLVKGVVF----DPANKYFATTSDDRTMKI 205

Query: 230 WKY--IGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASV 271
           ++Y   GD     +  + E    +   +     +WSP G+  +V
Sbjct: 206 FRYHKTGDISFTIEHIITEPFKESPLTTYFRRPSWSPDGQHIAV 249

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 68/168 (40%), Gaps = 29/168 (17%)

Query: 1   MPLQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDD----- 55
           MPL    S+  H   +  + F P    LA+GS DR + +  L   + +      +     
Sbjct: 70  MPLC---SMSRHTGSITCVKFSPDGKYLASGSDDRILLIWALDEEQSSQPAFGSEHEREH 126

Query: 56  -TVHKKAV------RSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIE 108
            TV K+ V      + + W P S +L     D ++ +W  S            E L   +
Sbjct: 127 WTVRKRLVAHDNDIQDICWAPDSSILVTVGLDRSVIVWNGS----------TFEKLKRFD 176

Query: 109 GHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEH 156
            H++ VKG+ +       AT S D+++ I+   + G+    IS   EH
Sbjct: 177 VHQSLVKGVVFDPANKYFATTSDDRTMKIFRYHKTGD----ISFTIEH 220

 Score = 35.8 bits (81), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 69/183 (37%), Gaps = 44/183 (24%)

Query: 108 EGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQE--HSQDVKHVVW 165
           E  + E+  +  S DG  LAT   D  + IW  D      E  S+  E    QD++  + 
Sbjct: 14  ESRKYEIYTVDVSHDGKRLATGGLDGKIRIWSIDSILRCMELESLTPEIPLPQDLQMPL- 72

Query: 166 HTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDS 225
                                      C+  ++ H G+I C  FS   D   L SGSDD 
Sbjct: 73  ---------------------------CS--MSRHTGSITCVKFS--PDGKYLASGSDDR 101

Query: 226 TVRVW--------KYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSP-SGRIASVGADGV 276
            + +W        +     E +++ W     L  AH + I  + W+P S  + +VG D  
Sbjct: 102 ILLIWALDEEQSSQPAFGSEHEREHWTVRKRL-VAHDNDIQDICWAPDSSILVTVGLDRS 160

Query: 277 LAV 279
           + V
Sbjct: 161 VIV 163

 Score = 30.8 bits (68), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 46/92 (50%), Gaps = 4/92 (4%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHS 71
           ++DKV   D + +  ++AT   D+++ V      +  +L   D  +  K++  ++W P  
Sbjct: 313 NDDKVHHFD-KNIDSVVATAGQDKSLAVWSTSRPRP-ILVAFD--IANKSITDMSWNPDG 368

Query: 72  DLLAAGSFDSTISIWTQSDLDLEEGAKLEMEL 103
            LL   S DS+I+++   + +L +   LE  +
Sbjct: 369 SLLFVASLDSSITLFKFENNELGKPIPLEKNM 400

>AFL038C [3155] [Homologous to ScYGL100W (SEH1) - SH]
           (367581..368573) [993 bp, 330 aa]
          Length = 330

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 55/251 (21%), Positives = 98/251 (39%), Gaps = 30/251 (11%)

Query: 103 LLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKH 162
           +     GHE+ V  I +   G  +ATCS D+ + ++  D+   E+      + H   V  
Sbjct: 1   MKPFTTGHEDLVHDICYDFYGRHVATCSSDQHIKVFRLDKDTNEWTLSDSWKGHDSSVVA 60

Query: 163 VVWHTKH--NLLASSSYDDTVRIWKDYDD-------DWECAAVLTGHEGTIWCSDFSKEE 213
           + W +     +LAS SY+ T+++W++  D        W     L    G ++   F+   
Sbjct: 61  LDWASPEYGRILASVSYNKTIKVWEEDPDAPEGSGRRWTRLCTLNDATGPLYSVKFAPGH 120

Query: 214 DPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCES------TLPNAHRSQIYGVAWSPSG- 266
             +RL +  +D  +R++  +  +  D + W   S      T P +H    + + W PS  
Sbjct: 121 LGLRLGAIGNDGVLRIYDAL--EPSDLRSWTLTSEVKVLATPPASHLQSDFSLDWCPSRF 178

Query: 267 ---RIASVGADGVLAVYKEKQNDSEVSEWEISATYKAAHTVYEINTVKWVNIDGK--EML 321
              R+     D      + K            A     H    I +V W    G+  +++
Sbjct: 179 SAERLVVCALDQAFVYERNKAGK------LFQAARLPGHQGL-IRSVSWAPSFGRWHQLI 231

Query: 322 ITAGDDGRVNL 332
            T   DGRV +
Sbjct: 232 ATGSKDGRVRI 242

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 75/171 (43%), Gaps = 25/171 (14%)

Query: 5   LAKSLKLHNDKVWSIDFEPVRG---LLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKA 61
           LA     H    +S+D+ P R     L   + D+A    + K GK  L        H+  
Sbjct: 157 LATPPASHLQSDFSLDWCPSRFSAERLVVCALDQAFVYERNKAGK--LFQAARLPGHQGL 214

Query: 62  VRSVAWRPH----SDLLAAGSFDSTISIWTQSD---------------LDLEEGAKLEME 102
           +RSV+W P       L+A GS D  + I+  ++                D      + ++
Sbjct: 215 IRSVSWAPSFGRWHQLIATGSKDGRVRIFQLTEKLDATDDASTDDASTDDAGPAPHISVQ 274

Query: 103 LLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVL 153
           LL+    H+ EV  +SW+  G +L++   D  V +W++  +  E++C+SV+
Sbjct: 275 LLSEHADHKGEVWSVSWNLTGTILSSSGDDGKVRLWKSSFS-NEFKCMSVI 324

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 56/123 (45%), Gaps = 26/123 (21%)

Query: 105 AIIEGHENEVKGISWSQDGC----LLATCSRDKSVWIWETDE------------------ 142
           A + GH+  ++ +SW+        L+AT S+D  V I++  E                  
Sbjct: 206 ARLPGHQGLIRSVSWAPSFGRWHQLIATGSKDGRVRIFQLTEKLDATDDASTDDASTDDA 265

Query: 143 AGEEYECISVLQEHSQ---DVKHVVWHTKHNLLASSSYDDTVRIWK-DYDDDWECAAVLT 198
               +  + +L EH+    +V  V W+    +L+SS  D  VR+WK  + ++++C +V+ 
Sbjct: 266 GPAPHISVQLLSEHADHKGEVWSVSWNLTGTILSSSGDDGKVRLWKSSFSNEFKCMSVIC 325

Query: 199 GHE 201
             +
Sbjct: 326 AQK 328

 Score = 28.9 bits (63), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 54/242 (22%), Positives = 94/242 (38%), Gaps = 27/242 (11%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDT--VHKKAVRSVAWRP 69
           H D V  I ++     +AT S+D+ IKV +L          L D+   H  +V ++ W  
Sbjct: 8   HEDLVHDICYDFYGRHVATCSSDQHIKVFRLDKDTNEW--TLSDSWKGHDSSVVALDWAS 65

Query: 70  --HSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQD--GCL 125
             +  +LA+ S++ TI +W + D D  EG+      L  +      +  + ++    G  
Sbjct: 66  PEYGRILASVSYNKTIKVW-EEDPDAPEGSGRRWTRLCTLNDATGPLYSVKFAPGHLGLR 124

Query: 126 LATCSRDKSVWIWETDEAGE--------EYECISVLQ-EHSQDVKHVVW---HTKHNLLA 173
           L     D  + I++  E  +        E + ++     H Q    + W         L 
Sbjct: 125 LGAIGNDGVLRIYDALEPSDLRSWTLTSEVKVLATPPASHLQSDFSLDWCPSRFSAERLV 184

Query: 174 SSSYDDTVRIWKDYDDDWECAAVLTGHEGTI----WCSDFSKEEDPIRLCSGSDDSTVRV 229
             + D      ++       AA L GH+G I    W   F +    I   +GS D  VR+
Sbjct: 185 VCALDQAFVYERNKAGKLFQAARLPGHQGLIRSVSWAPSFGRWHQLI--ATGSKDGRVRI 242

Query: 230 WK 231
           ++
Sbjct: 243 FQ 244

>Kwal_23.6240
          Length = 913

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 63/169 (37%), Gaps = 48/169 (28%)

Query: 108 EGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHT 167
           +GH +    +++S DG  + T S D  + IW+         C+   QEH+  V  + +  
Sbjct: 338 QGHFDATNAVTYSPDGSRVVTASEDGKIKIWDVVSGF----CLVTFQEHTAAVSALAFAK 393

Query: 168 KHNLLASSSYDDTVRIW-----------------------KDYDDDWECAA--------- 195
           +  +L S+S D TVR W                        D   +  CA          
Sbjct: 394 RGQVLFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCLAADPSGEVVCAGSVDSFAVHV 453

Query: 196 ----------VLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIG 234
                      L GHEG + C  FS+E     L S S D T+R+W   G
Sbjct: 454 WSVQTGQLVETLDGHEGPVSCLSFSQENSV--LASASWDKTIRIWSIFG 500

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 75/186 (40%), Gaps = 30/186 (16%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGH----ENE 113
           H+K V+ VA  P   LL +                 E+G  + +   A    H    +  
Sbjct: 54  HRKNVQCVALNPQGTLLLSVD---------------EDGRAILVNFRAKTVLHHFNFKEP 98

Query: 114 VKGISWSQDGCLLA-TCSRDKSVWIWETDEAGEEYECISVLQE-----HSQDVKHVVWHT 167
           V  + +S DG + A  C R   V +W+T +  E+ +    ++      H  ++  + W  
Sbjct: 99  VSDLKFSPDGKVFAIACGR--FVQVWKTPDVAEDRQFAPFVRHRVHAGHFSNIISLTWSR 156

Query: 168 KHNLLASSSYDDTVRIWK-DYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDST 226
               L S+S D T RIW  D  +    +    GH   +  + FS +++  R+ + S D  
Sbjct: 157 DSRFLISTSKDLTARIWSLDSQEKGLASVTFAGHRDYVMGAFFSADQE--RIYTVSKDGA 214

Query: 227 VRVWKY 232
           V  W+Y
Sbjct: 215 VFQWEY 220

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 49/89 (55%), Gaps = 11/89 (12%)

Query: 65  VAWRPHSDLLAAGSFDS-TISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDG 123
           +A  P  +++ AGS DS  + +W+     ++ G     +L+  ++GHE  V  +S+SQ+ 
Sbjct: 432 LAADPSGEVVCAGSVDSFAVHVWS-----VQTG-----QLVETLDGHEGPVSCLSFSQEN 481

Query: 124 CLLATCSRDKSVWIWETDEAGEEYECISV 152
            +LA+ S DK++ IW      ++ E + V
Sbjct: 482 SVLASASWDKTIRIWSIFGRSQQVEPLEV 510

 Score = 30.8 bits (68), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 29/139 (20%), Positives = 62/139 (44%), Gaps = 13/139 (9%)

Query: 11  LHNDKVWSIDFEPVRGLLATGSTDRAIKVLQL-KNGKENLLDVLDDTV-----HKKAVRS 64
           +HN K ++ ++E  + +       +   +L + ++G+  L++    TV      K+ V  
Sbjct: 43  IHN-KSYTFEYEHRKNVQCVALNPQGTLLLSVDEDGRAILVNFRAKTVLHHFNFKEPVSD 101

Query: 65  VAWRPHSDL--LAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQD 122
           + + P   +  +A G F   + +W   D+  E+          +  GH + +  ++WS+D
Sbjct: 102 LKFSPDGKVFAIACGRF---VQVWKTPDV-AEDRQFAPFVRHRVHAGHFSNIISLTWSRD 157

Query: 123 GCLLATCSRDKSVWIWETD 141
              L + S+D +  IW  D
Sbjct: 158 SRFLISTSKDLTARIWSLD 176

 Score = 29.3 bits (64), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 62/130 (47%), Gaps = 16/130 (12%)

Query: 22  EPVRGLLATGSTDR-AIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHSDLLAAGSFD 80
           +P   ++  GS D  A+ V  ++ G+  L++ LD   H+  V  +++   + +LA+ S+D
Sbjct: 435 DPSGEVVCAGSVDSFAVHVWSVQTGQ--LVETLDG--HEGPVSCLSFSQENSVLASASWD 490

Query: 81  STISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWET 140
            TI IW+        G   ++E L +      +V  +S   DG  +A  + D  +  ++ 
Sbjct: 491 KTIRIWSIF------GRSQQVEPLEVYA----DVLSLSVRPDGNEVAAATLDGQILFFDV 540

Query: 141 DEAGEEYECI 150
            E G++   I
Sbjct: 541 HE-GKQVNAI 549

>KLLA0C08976g 784536..787271 highly similar to sgd|S0000653
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 64/169 (37%), Gaps = 48/169 (28%)

Query: 108 EGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHT 167
           +GH + + G+ +S DG  + T S +  + IW+         C++   EH+  V  V +  
Sbjct: 338 QGHFDTLNGLCYSPDGSKIVTASHEGKIKIWDVASGF----CLATFDEHAGGVSAVEFAK 393

Query: 168 KHNLLASSSYDDTVRIWK-----------------------DYDDDWECAA--------- 195
           K  +L S+S D TV+ W                        D   +  CA          
Sbjct: 394 KGQVLFSASLDGTVKAWDLIRYRNFRTFTATERIQFNSLAVDPSGEVVCAGSEDSFDIFV 453

Query: 196 ----------VLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIG 234
                      L+GHEG I C  FS E     L S S D T+RVW   G
Sbjct: 454 WSVQTGQLVDTLSGHEGPISCLSFSNENGV--LASASWDKTIRVWSLFG 500

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 55/127 (43%), Gaps = 11/127 (8%)

Query: 113 EVKGISWSQDGCLLA-TCSRDKSVWIWETDEAGEEYECISVLQE-----HSQDVKHVVWH 166
           +V  + +S DG L A  C R   + IW T E  E+ +    ++      H  D+  + W 
Sbjct: 98  KVYDLKFSPDGKLFALACGR--FLQIWRTPETTEDRQFAPFVRYRIHAGHFSDITSLTWS 155

Query: 167 TKHNLLASSSYDDTVRIWKDYDDDWECAA-VLTGHEGTIWCSDFSKEEDPIRLCSGSDDS 225
                + S+S D T RIW    ++   A+    GH   +  + FS +++ I     S D 
Sbjct: 156 KDSRFIISTSKDLTARIWSVNSEEKNLASTTFAGHRDNVIGAYFSDDQEKIYTV--SKDG 213

Query: 226 TVRVWKY 232
            +  W+Y
Sbjct: 214 ALFQWEY 220

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 68/148 (45%), Gaps = 20/148 (13%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIK---VLQLKNGKENLLDVLDDTVHKKAVRSVAWR 68
           H   V +++F     +L + S D  +K   +++ +N +            +    S+A  
Sbjct: 382 HAGGVSAVEFAKKGQVLFSASLDGTVKAWDLIRYRNFRTF------TATERIQFNSLAVD 435

Query: 69  PHSDLLAAGSFDST-ISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLA 127
           P  +++ AGS DS  I +W+     ++ G     +L+  + GHE  +  +S+S +  +LA
Sbjct: 436 PSGEVVCAGSEDSFDIFVWS-----VQTG-----QLVDTLSGHEGPISCLSFSNENGVLA 485

Query: 128 TCSRDKSVWIWETDEAGEEYECISVLQE 155
           + S DK++ +W      ++ E   V  +
Sbjct: 486 SASWDKTIRVWSLFGRSQQVEPFEVFSD 513

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 36/82 (43%), Gaps = 7/82 (8%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGI 117
           H   + S+ W   S  + + S D T  IW+ +     E   L     A   GH + V G 
Sbjct: 145 HFSDITSLTWSKDSRFIISTSKDLTARIWSVN----SEEKNLASTTFA---GHRDNVIGA 197

Query: 118 SWSQDGCLLATCSRDKSVWIWE 139
            +S D   + T S+D +++ WE
Sbjct: 198 YFSDDQEKIYTVSKDGALFQWE 219

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 41/93 (44%), Gaps = 6/93 (6%)

Query: 51  DVLDDTVHKKAVRSVAWRPHSDL--LAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIE 108
           +VL     K+ V  + + P   L  LA G F   + IW   +   E+          I  
Sbjct: 88  NVLHHFNFKEKVYDLKFSPDGKLFALACGRF---LQIWRTPETT-EDRQFAPFVRYRIHA 143

Query: 109 GHENEVKGISWSQDGCLLATCSRDKSVWIWETD 141
           GH +++  ++WS+D   + + S+D +  IW  +
Sbjct: 144 GHFSDITSLTWSKDSRFIISTSKDLTARIWSVN 176

>KLLA0F10791g complement(991642..993279) similar to sp|P26309
           Saccharomyces cerevisiae YGL116w CDC20 cell division
           control protein, hypothetical start
          Length = 545

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/184 (28%), Positives = 85/184 (46%), Gaps = 22/184 (11%)

Query: 108 EGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHT 167
           E H+ EV G+S+ +DG  LA+ + D +V IW+T +  +    I   + H   VK + WH 
Sbjct: 330 ERHQGEVCGLSFREDGIQLASGANDNTVMIWDTRQNNDP---IWTKRNHKAAVKAISWHP 386

Query: 168 K-HNLLAS--SSYDDTVRIWKDYDDDWECAAVLTGHEGTI--WCSDFSKE----EDPIRL 218
           +  NLLA+   S D  +  W     +     + TG + +   W   +SK     +  I  
Sbjct: 387 EITNLLATGGGSLDKHIHFWNTTTGN-RLGTIDTGSQVSSLHWGQSYSKHSGCMDTEIVA 445

Query: 219 CSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSG-RIASVGADGVL 277
             G+ ++ + ++ Y      + +  V E  +  AH S+I     SP G  IASVG D  L
Sbjct: 446 TGGTPNNCITIYNY------ETKFKVAE--IQQAHDSRIVSSQLSPDGTTIASVGGDENL 497

Query: 278 AVYK 281
             Y+
Sbjct: 498 KFYR 501

>CAGL0K09284g 914937..917672 highly similar to sp|P25635
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/216 (23%), Positives = 82/216 (37%), Gaps = 58/216 (26%)

Query: 108 EGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHT 167
           +GH +    +++S DG  + T + D  + +W+         C++  +EH+  V  V +  
Sbjct: 338 QGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVASGF----CLATFEEHTSAVTAVQFAK 393

Query: 168 KHNLLASSSYDDTVRIWK--DYDD----------DWECAAV------------------- 196
           K  +L S+S D TVR W    Y +           + C AV                   
Sbjct: 394 KGQVLFSASLDGTVRAWDLIRYRNFRVFTATERVQFTCLAVEPSGEVVSAGSTDSFDVFV 453

Query: 197 -----------LTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVC 245
                      L+GHEG + C  FS E     L S S D T+R+W   G  +  +     
Sbjct: 454 WSVQTGQLLDTLSGHEGPVSCLAFSMENAV--LASASWDKTIRIWSIFGRSQQVE----- 506

Query: 246 ESTLPNAHRSQIYGVAWSPSGRIASVGA-DGVLAVY 280
               P    + I  +  +P G+  +V    G L ++
Sbjct: 507 ----PLEVFADILAITITPDGKHVAVSTLKGQLTIF 538

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 54/123 (43%), Gaps = 9/123 (7%)

Query: 117 ISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQE-----HSQDVKHVVWHTKHNL 171
           + +S DG   A  +  + + IW+T +  ++ +    ++      H QD+    W      
Sbjct: 102 VKFSPDGRYFA-LAVGRFLQIWKTPDVSQDRQFAPFVRYRVHAGHFQDITSFTWSHDSRF 160

Query: 172 LASSSYDDTVRIWKDYDDDWE-CAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
           L ++S D T R+W    +D E  A  L GH   +  + F+  ++ I     S D  V  W
Sbjct: 161 LLTTSKDLTSRVWSINSEDKELVATTLAGHRDYVLGAYFNSTQEKIYTI--SKDGAVFTW 218

Query: 231 KYI 233
           +YI
Sbjct: 219 EYI 221

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 75/165 (45%), Gaps = 25/165 (15%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIK---VLQLKNGKENLLDVLDDTVHKKAVRSVAWR 68
           H   V ++ F     +L + S D  ++   +++ +N +      +     +     +A  
Sbjct: 382 HTSAVTAVQFAKKGQVLFSASLDGTVRAWDLIRYRNFR------VFTATERVQFTCLAVE 435

Query: 69  PHSDLLAAGSFDST-ISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLA 127
           P  ++++AGS DS  + +W+     ++ G     +LL  + GHE  V  +++S +  +LA
Sbjct: 436 PSGEVVSAGSTDSFDVFVWS-----VQTG-----QLLDTLSGHEGPVSCLAFSMENAVLA 485

Query: 128 TCSRDKSVWIWETDEAGEEYECISVLQE-----HSQDVKHVVWHT 167
           + S DK++ IW      ++ E + V  +      + D KHV   T
Sbjct: 486 SASWDKTIRIWSIFGRSQQVEPLEVFADILAITITPDGKHVAVST 530

 Score = 37.0 bits (84), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 40/178 (22%), Positives = 74/178 (41%), Gaps = 20/178 (11%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHS 71
           H D   S+ + P    + T + D  IKV  + +G    L   ++  H  AV +V +    
Sbjct: 340 HFDATNSLTYSPDGSRVVTAAEDGKIKVWDVASGF--CLATFEE--HTSAVTAVQFAKKG 395

Query: 72  DLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHEN-EVKGISWSQDGCLLATCS 130
            +L + S D T+  W     DL     +      +    E  +   ++    G +++  S
Sbjct: 396 QVLFSASLDGTVRAW-----DL-----IRYRNFRVFTATERVQFTCLAVEPSGEVVSAGS 445

Query: 131 RDK-SVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDY 187
            D   V++W         + +  L  H   V  + +  ++ +LAS+S+D T+RIW  +
Sbjct: 446 TDSFDVFVWSVQTG----QLLDTLSGHEGPVSCLAFSMENAVLASASWDKTIRIWSIF 499

 Score = 34.3 bits (77), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 70/179 (39%), Gaps = 18/179 (10%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTD-RAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPH 70
           H   + + D      LL +  TD RAI    L N K    +VL     K    SV + P 
Sbjct: 54  HRKNIATFDVNKQGTLLLSVDTDGRAI----LVNFKTR--NVLHHFNFKDKCYSVKFSPD 107

Query: 71  SDL--LAAGSFDSTISIWTQSDL--DLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLL 126
                LA G F   + IW   D+  D +    +   + A   GH  ++   +WS D   L
Sbjct: 108 GRYFALAVGRF---LQIWKTPDVSQDRQFAPFVRYRVHA---GHFQDITSFTWSHDSRFL 161

Query: 127 ATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWK 185
            T S+D +  +W  +   +E    + L  H   V    +++    + + S D  V  W+
Sbjct: 162 LTTSKDLTSRVWSINSEDKEL-VATTLAGHRDYVLGAYFNSTQEKIYTISKDGAVFTWE 219

>KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces
           cerevisiae YNL317w PFS2 polyadenylation factor I subunit
           2 required for mRNA 3 -end processing, bridges two mRNA
           3 -end processing factors singleton, start by similarity
          Length = 452

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 74/174 (42%), Gaps = 17/174 (9%)

Query: 57  VHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKG 116
            H  AV  + +    D + +GS D  + IW Q + ++         +  + + H   V+ 
Sbjct: 121 AHDSAVTVMTYSHTGDWMVSGSADGELKIW-QPNFNM---------VKVMDQAHMECVRE 170

Query: 117 ISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSS 176
           IS+S       +CS D  + IW      +E     VL  H  DVK   WH K  L+ S S
Sbjct: 171 ISFSPTDQKFVSCSDDNVLKIWNFSNGQQE----RVLSGHHWDVKSCDWHPKMGLIVSGS 226

Query: 177 YDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
            D+ ++ W        C + + G + TI  + F  ++  + L   S D T +V+
Sbjct: 227 KDNLIKFWDPRSG--SCVSTMLGFKHTIISTKFQPKQGNL-LSVISKDKTCKVY 277

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/233 (21%), Positives = 97/233 (41%), Gaps = 29/233 (12%)

Query: 59  KKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGIS 118
           K  + ++ W P    L   +++   S+W+ S  + E          +I++ H++ V  ++
Sbjct: 81  KHVIPALTWTPEGRRLVVATYNGEFSLWSGSSFNFE----------SIMQAHDSAVTVMT 130

Query: 119 WSQDGCLLATCSRDKSVWIWETDEAGEEYECISVL-QEHSQDVKHVVWHTKHNLLASSSY 177
           +S  G  + + S D  + IW+ +     +  + V+ Q H + V+ + +        S S 
Sbjct: 131 YSHTGDWMVSGSADGELKIWQPN-----FNMVKVMDQAHMECVREISFSPTDQKFVSCSD 185

Query: 178 DDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDE 237
           D+ ++IW   +   E   VL+GH   +   D+  +   I   SGS D+ ++ W       
Sbjct: 186 DNVLKIWNFSNGQQE--RVLSGHHWDVKSCDWHPKMGLI--VSGSKDNLIKFW------- 234

Query: 238 DDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASV-GADGVLAVYKEKQNDSEV 289
            D +   C ST+     + I        G + SV   D    VY  +Q   E+
Sbjct: 235 -DPRSGSCVSTMLGFKHTIISTKFQPKQGNLLSVISKDKTCKVYDIRQQAKEL 286

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 59/130 (45%), Gaps = 11/130 (8%)

Query: 16  VWSIDFEPVRG-LLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHSD-L 73
           + S  F+P +G LL+  S D+  KV  ++   + L  V DD  +     ++ W P  + +
Sbjct: 252 IISTKFQPKQGNLLSVISKDKTCKVYDIRQQAKELFSVRDDVDY----MTLQWHPIDETV 307

Query: 74  LAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDK 133
              G +D +I        DL +  +       I   HE  V  +++S  G ++A+ S+D+
Sbjct: 308 FTVGCYDGSIK-----HFDLSQENQPNKPTHNIPYAHEKCVTSLAYSPIGHIMASASKDR 362

Query: 134 SVWIWETDEA 143
           ++  W    A
Sbjct: 363 TIRFWTRSRA 372

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 94/228 (41%), Gaps = 29/228 (12%)

Query: 10  KLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRP 69
           + H + V  I F P      + S D  +K+    NG++    VL    H   V+S  W P
Sbjct: 162 QAHMECVREISFSPTDQKFVSCSDDNVLKIWNFSNGQQE--RVLSG--HHWDVKSCDWHP 217

Query: 70  HSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISW-SQDGCLLAT 128
              L+ +GS D+ I  W     D   G+      ++ + G ++ +    +  + G LL+ 
Sbjct: 218 KMGLIVSGSKDNLIKFW-----DPRSGS-----CVSTMLGFKHTIISTKFQPKQGNLLSV 267

Query: 129 CSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHT-KHNLLASSSYDDTVRIW--- 184
            S+DK+  +++  +  +  E  SV  +   D   + WH     +     YD +++ +   
Sbjct: 268 ISKDKTCKVYDIRQQAK--ELFSVRDD--VDYMTLQWHPIDETVFTVGCYDGSIKHFDLS 323

Query: 185 KDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIR--LCSGSDDSTVRVW 230
           ++   +     +   HE  +    +S    PI   + S S D T+R W
Sbjct: 324 QENQPNKPTHNIPYAHEKCVTSLAYS----PIGHIMASASKDRTIRFW 367

>YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that
           targets proteins for ubiquitination by interacting with
           the SCF complex (Skp1p-Cdc53p-Cdc34p), regulates sulfur
           assimilation genes in response to S-adenosylmethionine
           levels, contains five WD (WD-40) repeats [1923 bp, 640
           aa]
          Length = 640

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/158 (33%), Positives = 75/158 (47%), Gaps = 23/158 (14%)

Query: 73  LLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRD 132
           LL  GS+DSTI IW     DL  G     +L+  + GH + VK + +  D   L T S D
Sbjct: 314 LLFTGSYDSTIGIW-----DLFTG-----KLIRRLSGHSDGVKTLYF--DDRKLITGSLD 361

Query: 133 KSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWE 192
           K++ +W         ECIS  + HS  V  V  + K  ++ S S D TV++W  + +   
Sbjct: 362 KTIRVWNYITG----ECISTYRGHSDSVLSVDSYQK--VIVSGSADKTVKVW--HVESRT 413

Query: 193 CAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
           C   L GH  T W +            S SDD+T+R+W
Sbjct: 414 CYT-LRGH--TEWVNCVKLHPKSFSCFSCSDDTTIRMW 448

 Score = 35.0 bits (79), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 6/65 (9%)

Query: 169 HNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVR 228
           + LL + SYD T+ IW  +    +    L+GH   +    F    D  +L +GS D T+R
Sbjct: 312 YRLLFTGSYDSTIGIWDLFTG--KLIRRLSGHSDGVKTLYF----DDRKLITGSLDKTIR 365

Query: 229 VWKYI 233
           VW YI
Sbjct: 366 VWNYI 370

 Score = 34.3 bits (77), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 62/257 (24%), Positives = 100/257 (38%), Gaps = 55/257 (21%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHS 71
           H+D V S+D    + ++ +GS D+ +KV  +++     L       H + V  V   P S
Sbjct: 381 HSDSVLSVD--SYQKVIVSGSADKTVKVWHVESRTCYTL-----RGHTEWVNCVKLHPKS 433

Query: 72  DLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGI---------SWSQD 122
               + S D+TI +W     D+   +      L +  GH  +V+ I         + + D
Sbjct: 434 FSCFSCSDDTTIRMW-----DIRTNS-----CLKVFRGHVGQVQKIIPLTIKDVENLATD 483

Query: 123 GCLLATCSRDKSVWIW---ETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDD 179
                +  +D         E+D    E E  +VL E+     H         L S   D+
Sbjct: 484 NTSDGSSPQDDPTMTDGADESDTPSNEQE--TVLDENIPYPTH---------LLSCGLDN 532

Query: 180 TVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDD 239
           T+++W       +C     GH   +W  D +   D  R+ SGS D +++VW        D
Sbjct: 533 TIKLWDV--KTGKCIRTQFGHVEGVW--DIA--ADNFRIISGSHDGSIKVW--------D 578

Query: 240 QQEWVCESTLPNAHRSQ 256
            Q   C  T  N  R Q
Sbjct: 579 LQSGKCMHTF-NGRRLQ 594

>Kwal_26.8776
          Length = 433

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 88/328 (26%), Positives = 130/328 (39%), Gaps = 49/328 (14%)

Query: 2   PLQLAKSLKLHNDKVWSIDFEPV-RGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKK 60
           P +L + +  HN  V  +  +PV     ATGS D  IKV  + +GK      L  T H  
Sbjct: 110 PWKLMRVINGHNGWVRCVCPDPVDNAWFATGSNDTTIKVWDMASGKLK----LTLTGHVM 165

Query: 61  AVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWS 120
            VRSVA      L+ + S D  +  W     DLE  A +         GH + V  +   
Sbjct: 166 TVRSVAVSQRHPLMFSASEDKMVKCW-----DLERNAAIR-----DYHGHFSGVNTVDVH 215

Query: 121 QDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDT 180
               L+A+  RD  V +W+          +  L  H   +  V        + S S D T
Sbjct: 216 PTLDLIASAGRDAVVRLWDI----RTRLPVMTLAGHKSPINQVKCFPVDPQIMSCSSDAT 271

Query: 181 VRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQ 240
           VR+W       +   +LT H  ++        E  +   S SD   VR W++     D Q
Sbjct: 272 VRLWDIRAG--KATKILTHHSKSVRAIAAHPAESSVATASTSD---VRSWRH----SDGQ 322

Query: 241 QEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYKEKQNDSEVSEWEISATYKA 300
                   L N H S+  G+  S      SV ADGVL       +D  +S ++    YK+
Sbjct: 323 -------LLTNYH-SEGIGIINS-----LSVNADGVLF---GGGDDGNLSFFD----YKS 362

Query: 301 AHTVYEINTVKWV-NIDGKEMLITAGDD 327
            H   E+ T K   ++D +  +++A  D
Sbjct: 363 GHKYQELPTTKIPGSLDSERGILSASFD 390

>YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and
           COMPASS complex, has several WD (WD-40) repeats and may
           be involved in chromatin remodeling [948 bp, 315 aa]
          Length = 315

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 76/190 (40%), Gaps = 32/190 (16%)

Query: 56  TVHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVK 115
           T H +    + W P    +A  S D ++ I             L   LL    GH   V 
Sbjct: 52  TSHARPFSELCWSPDGQCIATASDDFSVEI-----------IHLSYGLLHTFIGHTAPVI 100

Query: 116 GISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHV-VWHTKHNLLAS 174
            +++++ G LL T S D+S+ IW+T         +  +  HS+ V  V V     ++L+S
Sbjct: 101 SLTFNRKGNLLFTSSMDESIKIWDTLNG----SLMKTISAHSEAVVSVDVPMNDSSILSS 156

Query: 175 SSYDDTVRIWK----------DYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDD 224
            SYD  +RI+            YD DW+         G +  S     E+   L   S D
Sbjct: 157 GSYDGLIRIFDAETGHCLKTLTYDKDWK------RENGVVPISQVKFSENARYLLVKSLD 210

Query: 225 STVRVWKYIG 234
             V++W  IG
Sbjct: 211 GVVKIWDCIG 220

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 55/126 (43%), Gaps = 8/126 (6%)

Query: 105 AIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVV 164
            ++  H      + WS DG  +AT S D SV I         Y  +     H+  V  + 
Sbjct: 49  TLVTSHARPFSELCWSPDGQCIATASDDFSVEIIHL-----SYGLLHTFIGHTAPVISLT 103

Query: 165 WHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDD 224
           ++ K NLL +SS D++++IW   +        ++ H   +   D    +  I L SGS D
Sbjct: 104 FNRKGNLLFTSSMDESIKIWDTLNGSL--MKTISAHSEAVVSVDVPMNDSSI-LSSGSYD 160

Query: 225 STVRVW 230
             +R++
Sbjct: 161 GLIRIF 166

 Score = 33.5 bits (75), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 60/132 (45%), Gaps = 13/132 (9%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSV-AWRPH 70
           H   V S+ F     LL T S D +IK+    NG  +L+  +  + H +AV SV      
Sbjct: 95  HTAPVISLTFNRKGNLLFTSSMDESIKIWDTLNG--SLMKTI--SAHSEAVVSVDVPMND 150

Query: 71  SDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGIS---WSQDGCLLA 127
           S +L++GS+D  I I+     D E G  L+          EN V  IS   +S++   L 
Sbjct: 151 SSILSSGSYDGLIRIF-----DAETGHCLKTLTYDKDWKRENGVVPISQVKFSENARYLL 205

Query: 128 TCSRDKSVWIWE 139
             S D  V IW+
Sbjct: 206 VKSLDGVVKIWD 217

>Scas_707.22
          Length = 730

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/202 (23%), Positives = 94/202 (46%), Gaps = 28/202 (13%)

Query: 4   QLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVR 63
           +  K L  H   VW++ ++   G++ +GSTDR++++  +K G      V     H   VR
Sbjct: 387 KFLKELSGHEGGVWALKYD-ADGIIVSGSTDRSVRIWDIKRGC--CTHVFKG--HTSTVR 441

Query: 64  SVAWRPHSDL--LAAGSFDSTISIWTQSDLDLEEGAKLEMELL-----------AIIEGH 110
            +    + ++  +  GS D+T+ +W    L  EE    E+ ++            ++ GH
Sbjct: 442 CLEIVTYKNMKYIVTGSRDNTLHVW---KLIKEEKFDGELPMVYNTPEENPYFVGVLRGH 498

Query: 111 ENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHN 170
              V+ IS    G ++ + S D ++ +W+      + +C+ VL  H+  +   ++  K  
Sbjct: 499 MASVRTISG--HGNIVISGSYDNNLMVWDI----AQMKCLYVLIGHTDRIYSTIYDHKRQ 552

Query: 171 LLASSSYDDTVRIWKDYDDDWE 192
              S+S D T+++W D D+ W 
Sbjct: 553 RCISASMDSTIKVW-DLDNIWN 573

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 43/82 (52%), Gaps = 11/82 (13%)

Query: 164 VWHTKHN---LLASSSYDDTVRIWKDYDDDWE---CAAVLTGHEGTIWCSDFSKEEDPIR 217
           VW  K++   ++ S S D +VRIW     D +   C  V  GH  T+ C +    ++   
Sbjct: 399 VWALKYDADGIIVSGSTDRSVRIW-----DIKRGCCTHVFKGHTSTVRCLEIVTYKNMKY 453

Query: 218 LCSGSDDSTVRVWKYIGDDEDD 239
           + +GS D+T+ VWK I +++ D
Sbjct: 454 IVTGSRDNTLHVWKLIKEEKFD 475

 Score = 32.3 bits (72), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 28/147 (19%), Positives = 61/147 (41%), Gaps = 30/147 (20%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGI 117
           H  +VR+++   H +++ +GS+D+ + +W  +          +M+ L ++ GH + +   
Sbjct: 498 HMASVRTISG--HGNIVISGSYDNNLMVWDIA----------QMKCLYVLIGHTDRIYST 545

Query: 118 SWSQDGCLLATCSRDKSVWIWETDEAGEEYECISV----------------LQEHSQDVK 161
            +        + S D ++ +W+ D       C  +                LQ H+  V 
Sbjct: 546 IYDHKRQRCISASMDSTIKVWDLDNIWNNGNCTIITNSATPCTKITGSMLTLQGHTALVG 605

Query: 162 HVVWHTKHNLLASSSYDDTVRIWKDYD 188
            +    K+  L S++ D ++R W   D
Sbjct: 606 LLRLSDKY--LVSAAADGSLRGWDSND 630

 Score = 30.0 bits (66), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 3/34 (8%)

Query: 197 LTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
           L+GHEG +W   +  + D I + SGS D +VR+W
Sbjct: 392 LSGHEGGVWALKY--DADGI-IVSGSTDRSVRIW 422

>YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation factor I
           subunit 2 required for mRNA 3'-end processing, bridges
           two mRNA 3'-end processing factors, has WD (WD-40)
           repeats [1398 bp, 465 aa]
          Length = 465

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 82/188 (43%), Gaps = 21/188 (11%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGI 117
           H  AV ++ +   SD + +G  D  I IW  +   ++E          I   H   ++ +
Sbjct: 134 HDSAVTTMKYSHDSDWMISGDADGMIKIWQPNFSMVKE----------IDAAHTESIRDM 183

Query: 118 SWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSY 177
           ++S +     TCS D  + IW      +E     VL  H  DVK   WH +  L+AS+S 
Sbjct: 184 AFSSNDSKFVTCSDDNILKIWNFSNGKQE----RVLSGHHWDVKSCDWHPEMGLIASASK 239

Query: 178 DDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDE 237
           D+ V++W     +  C + +   + T+  + F   +  + L + S D + RV+    D  
Sbjct: 240 DNLVKLWDPRSGN--CISSILKFKHTVLKTRFQPTKGNL-LMAISKDKSCRVF----DIR 292

Query: 238 DDQQEWVC 245
              +E +C
Sbjct: 293 YSMKELMC 300

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 62/270 (22%), Positives = 114/270 (42%), Gaps = 36/270 (13%)

Query: 9   LKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLD-DTVHKKAVRSVAW 67
           ++ H+  V ++ +      + +G  D  IK+ Q      N   V + D  H +++R +A+
Sbjct: 131 MQAHDSAVTTMKYSHDSDWMISGDADGMIKIWQ-----PNFSMVKEIDAAHTESIRDMAF 185

Query: 68  RPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLA 127
             +       S D+ + IW  S+   E           ++ GH  +VK   W  +  L+A
Sbjct: 186 SSNDSKFVTCSDDNILKIWNFSNGKQER----------VLSGHHWDVKSCDWHPEMGLIA 235

Query: 128 TCSRDKSVWIWETDEAGEEYECI-SVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKD 186
           + S+D  V +W+         CI S+L+     +K     TK NLL + S D + R+   
Sbjct: 236 SASKDNLVKLWDPRSGN----CISSILKFKHTVLKTRFQPTKGNLLMAISKDKSCRV--- 288

Query: 187 YDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGD-DEDDQQEWVC 245
           +D  +    ++   + T +    + E  PI      ++S   +  Y G     D  + + 
Sbjct: 289 FDIRYSMKELMCVRDETDY---MTLEWHPI------NESMFTLACYDGSLKHFDLLQNLN 339

Query: 246 ES--TLPNAHRSQIYGVAWSPSGRIASVGA 273
           E   T+P AH   I  ++++P G I +  A
Sbjct: 340 EPILTIPYAHDKCITSLSYNPVGHIFATAA 369

 Score = 29.3 bits (64), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 42  LKNGKENLLDVLDDTVHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQS 89
           L+N  E +L +     H K + S+++ P   + A  + D TI  WT++
Sbjct: 335 LQNLNEPILTI--PYAHDKCITSLSYNPVGHIFATAAKDRTIRFWTRA 380

>KLLA0B01958g join(170646..170663,170896..173550) similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
           coatomer complex beta chain (beta -cop) of secretory
           pathway vesicles, hypothetical start
          Length = 890

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 82/182 (45%), Gaps = 25/182 (13%)

Query: 9   LKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWR 68
            + H D + SI   P +  + TGS D  IK   L N ++N       T H+  V SVA+ 
Sbjct: 93  FEAHPDYIRSIAVHPTKPFVLTGSDDLTIK---LWNWEKNWGCQQTFTGHEHFVMSVAFN 149

Query: 69  PH-SDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWS-----QD 122
           P   +  A+G  D TI +W+    D+             ++ HE   KG+++      QD
Sbjct: 150 PKDPNQFASGCLDHTIKVWSIGQ-DVPN---------FTLKAHE--TKGVNYVDYYPLQD 197

Query: 123 GCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVR 182
              L T S D ++ +W+          ++ L+ H  +V + V+H    ++ S S D T++
Sbjct: 198 KPYLITTSDDGTIKVWDYQTKSN----VATLEGHMANVSYAVFHPTLPIIISGSEDGTLK 253

Query: 183 IW 184
           IW
Sbjct: 254 IW 255

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 60/265 (22%), Positives = 117/265 (44%), Gaps = 34/265 (12%)

Query: 7   KSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVA 66
           +S+ L +  V +  F   +  +  GS D  ++V     G++    V +   H   +RS+A
Sbjct: 49  RSIPLCDAPVRAGRFIARKNWVVVGSDDFKLRVYNYNTGEK----VTEFEAHPDYIRSIA 104

Query: 67  WRPHSDLLAAGSFDSTISIWT-QSDLDLEEGAKLEMELLAIIEGHENEVKGISWS-QDGC 124
             P    +  GS D TI +W  + +   ++             GHE+ V  ++++ +D  
Sbjct: 105 VHPTKPFVLTGSDDLTIKLWNWEKNWGCQQ----------TFTGHEHFVMSVAFNPKDPN 154

Query: 125 LLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHN--LLASSSYDDTVR 182
             A+   D ++ +W     G++    ++    ++ V +V ++   +   L ++S D T++
Sbjct: 155 QFASGCLDHTIKVWSI---GQDVPNFTLKAHETKGVNYVDYYPLQDKPYLITTSDDGTIK 211

Query: 183 IWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQE 242
           +W DY       A L GH   +  + F     PI + SGS+D T+++W        +   
Sbjct: 212 VW-DYQTK-SNVATLEGHMANVSYAVFHPTL-PI-IISGSEDGTLKIW--------NANT 259

Query: 243 WVCESTLPNAHRSQIYGVAWSPSGR 267
           +  E TL N    + + +A  PSG+
Sbjct: 260 YKLEKTL-NIGLERSWCIATHPSGK 283

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 53/117 (45%), Gaps = 18/117 (15%)

Query: 218 LCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSP--SGRIASVGADG 275
           + +GSDD T+++W +       ++ W C+ T    H   +  VA++P    + AS   D 
Sbjct: 112 VLTGSDDLTIKLWNW-------EKNWGCQQTF-TGHEHFVMSVAFNPKDPNQFASGCLDH 163

Query: 276 VLAVYKEKQNDSEVSEWEISATYKAAHTVYEINTVKWVNIDGKEMLITAGDDGRVNL 332
            + V+   Q   +V  + + A     H    +N V +  +  K  LIT  DDG + +
Sbjct: 164 TIKVWSIGQ---DVPNFTLKA-----HETKGVNYVDYYPLQDKPYLITTSDDGTIKV 212

>Kwal_0.212
          Length = 303

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 96/227 (42%), Gaps = 23/227 (10%)

Query: 8   SLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAW 67
           S + H   V SI F+     + + S D  IKV  ++        V  +  H+ AV  V  
Sbjct: 70  SFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPS-----VQRNYKHQAAVNEVVI 124

Query: 68  RPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLA 127
            P+   L +   D  + IW     DL E   +      +    +  ++ +S + DG +L 
Sbjct: 125 HPNQGELISCDQDGNVRIW-----DLGENQCVHQ----LAPEDDTPLQSLSVASDGSMLV 175

Query: 128 TCSRDKSVWIWE----TDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRI 183
             +   + ++W+    TD A  +   ++  + H++ +  V+  +    LA+ S D T R+
Sbjct: 176 AGNNKGNCYVWQMPHQTDAANPKP--VTKFRSHAKYITRVLLSSDVKHLATCSADHTARV 233

Query: 184 WKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
           W   DD+++    L  H+  +W   FS   D   L +   D  VR+W
Sbjct: 234 WS-IDDNFQLETTLDNHQRWVWDCAFSA--DSAYLVTACSDHYVRLW 277

 Score = 36.2 bits (82), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 51/125 (40%), Gaps = 8/125 (6%)

Query: 107 IEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWH 166
            EGH   V  I++ Q+   + + S D ++ +W+      +        +H   V  VV H
Sbjct: 71  FEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRN-----YKHQAAVNEVVIH 125

Query: 167 TKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDST 226
                L S   D  VRIW D  ++ +C   L   + T   S  S   D   L +G++   
Sbjct: 126 PNQGELISCDQDGNVRIW-DLGEN-QCVHQLAPEDDTPLQS-LSVASDGSMLVAGNNKGN 182

Query: 227 VRVWK 231
             VW+
Sbjct: 183 CYVWQ 187

>AER280C [2782] [Homologous to ScYML102W (CAC2) - SH]
           (1148956..1150488) [1533 bp, 510 aa]
          Length = 510

 Score = 54.7 bits (130), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 92/208 (44%), Gaps = 32/208 (15%)

Query: 6   AKSLKLH---NDKVWSIDFEPV------RGLLATGSTDRAIKVLQL-----KNGKENLLD 51
           A SL+++   +  ++SI F+P          L T   D   +V QL     + GK + +D
Sbjct: 3   ASSLQIYWHESQPIYSISFQPSLPGSSGAPRLVTAGGDNKARVWQLNFDSERPGKVDSID 62

Query: 52  VLDD-TVHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDL-------------DLEEGA 97
            L   T H++AV    + P  D+LA    D  + +W ++D              D +E  
Sbjct: 63  FLSSLTQHEQAVNVARFNPSGDVLATAGDDGLLLLWKKNDTIVKEFGIDDDEFADFKESW 122

Query: 98  KLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHS 157
            +  +L  +     +E+  ++WS     + T   D  V I++  E      C++ + EH+
Sbjct: 123 CVVEKLRTVSTIGTSEIYDLAWSPCAKYIVTGCMDNGVRIFDIAEK----TCVAHVVEHN 178

Query: 158 QDVKHVVWHTKHNLLASSSYDDTVRIWK 185
             V+ VVW  ++  + S S D +V I+K
Sbjct: 179 HYVQGVVWDPQNEYIISQSADRSVHIYK 206

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/106 (22%), Positives = 50/106 (47%), Gaps = 12/106 (11%)

Query: 56  TVHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVK 115
           T+    +  +AW P +  +  G  D+ + I+     D+ E        +A +  H + V+
Sbjct: 133 TIGTSEIYDLAWSPCAKYIVTGCMDNGVRIF-----DIAEKT-----CVAHVVEHNHYVQ 182

Query: 116 GISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVK 161
           G+ W      + + S D+SV I++ + + E +  I+ L+ H + +K
Sbjct: 183 GVVWDPQNEYIISQSADRSVHIYKIETSTEGH--ITGLKLHHKIMK 226

>CAGL0A02772g complement(289274..290599) similar to sp|P40968
           Saccharomyces cerevisiae YDR364c CDC40, hypothetical
           start
          Length = 441

 Score = 54.3 bits (129), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 61/318 (19%), Positives = 121/318 (38%), Gaps = 53/318 (16%)

Query: 1   MPLQLAKSLKLHNDKVWSIDFEPVRG-LLATGSTDRAIKVLQLKNGKENLLDVLDDTVHK 59
           +P ++    K H++   S+   P  G L+ +G  D  +K+    + ++ L D +    H 
Sbjct: 136 LPKKVIYRYKGHHNGTTSLRLLPGTGHLILSGGNDNTVKLWDFYHDRKCLRDFVG---HS 192

Query: 60  KAVRSVAWRPHSDLLAAGSFDSTISIW---------------TQSDLDLEEGAKLEM--- 101
           K ++++ +   S    +GS+D  + IW               T +  +    +  E    
Sbjct: 193 KPIKTLDFTSDSSQFLSGSYDQQVKIWDTETGKVTKRLNTYSTPNSAEFRPTSGNEFVVG 252

Query: 102 -----------------ELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAG 144
                             L+ + + H + +  I +  DG    + S DK++ IW  ++  
Sbjct: 253 LSSSKIKHYDTRVSEKDGLVQVYDHHLSSILAIKYFPDGSKFISSSEDKTLRIW-NNQVN 311

Query: 145 EEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDD-DWECAAVLTGHEGT 203
              + IS   +HS  + ++  H +HN  ++ S D  +  +               GH   
Sbjct: 312 IPIKQISDTTQHS--MPYIGIHPEHNYFSTQSMDSVIYSYSMKPKYKMHPNKKFKGHNSA 369

Query: 204 IWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWS 263
            +    +   D   LCSG     + +W +      +    +C+  LP   +S I  V+W 
Sbjct: 370 GYGIGLTFSPDGRFLCSGDARGQLFLWDW------NTNRKLCDLKLPT--KSPITQVSWH 421

Query: 264 P--SGRIASVGADGVLAV 279
           P  + ++   G DG + V
Sbjct: 422 PKETSKVICSGPDGRIFV 439

>KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30 involved in regulation of
           sulfur assimilation genes and cell cycle progression,
           start by similarity
          Length = 623

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 50/158 (31%), Positives = 74/158 (46%), Gaps = 23/158 (14%)

Query: 73  LLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRD 132
           LL  GS+DST++IW     D + G      L+  + GH + VKGI +  D   + T S D
Sbjct: 324 LLFTGSYDSTVAIW-----DTKSG-----NLIRRLTGHTDGVKGIYF--DDQKMITASLD 371

Query: 133 KSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWE 192
           K++ +W          CIS  + H   V  V  + K  ++ S+S D TV++W  + +   
Sbjct: 372 KTIRVWNYITGS----CISTYRGHQDSVLSVDSYKK--IIVSASADKTVKVW--HVESRT 423

Query: 193 CAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
           C   L GH  T W +            S SDD T+R+W
Sbjct: 424 CYT-LRGH--TEWVNCVKLHPKSFTCYSSSDDKTLRMW 458

 Score = 35.4 bits (80), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 31/65 (47%), Gaps = 6/65 (9%)

Query: 169 HNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVR 228
           H LL + SYD TV IW     +      LTGH   +    F    D  ++ + S D T+R
Sbjct: 322 HRLLFTGSYDSTVAIWDTKSGNL--IRRLTGHTDGVKGIYF----DDQKMITASLDKTIR 375

Query: 229 VWKYI 233
           VW YI
Sbjct: 376 VWNYI 380

 Score = 35.4 bits (80), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 72/328 (21%), Positives = 110/328 (33%), Gaps = 94/328 (28%)

Query: 9   LKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWR 68
            K H D V S+ F     LL TGS D  + +   K+G  NL+  L  T H   V+ + + 
Sbjct: 308 FKGHMDGVLSLKFN--HRLLFTGSYDSTVAIWDTKSG--NLIRRL--TGHTDGVKGIYFD 361

Query: 69  PHSDLLAAGSFDSTISIW---TQSDLDLEEGAK--------------------------L 99
                +   S D TI +W   T S +    G +                          +
Sbjct: 362 DQK--MITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHV 419

Query: 100 EMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQD 159
           E      + GH   V  +          + S DK++ +W+         CI V + H   
Sbjct: 420 ESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDI----RTNSCIKVFRGHVGQ 475

Query: 160 VKHVVWHT---KHNL-----------------------------------LASSSYDDTV 181
           V+ V+  T     NL                                   L S S D+T+
Sbjct: 476 VQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTI 535

Query: 182 RIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQ 241
           ++W+       C     GH   +W  D +   D  R+ SGS D +++VW        D Q
Sbjct: 536 KLWEV--SSGRCIRTQFGHVEGVW--DIA--ADNFRIVSGSHDKSIKVW--------DLQ 581

Query: 242 EWVCESTLPNAHRSQIYGVAWSPSGRIA 269
              C  T    H++ I  V    S  ++
Sbjct: 582 NGKCIQTF-TGHKAPIVCVGIGDSSFVS 608

>CAGL0H03729g 342948..343859 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8, start by
           similarity
          Length = 303

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 90/225 (40%), Gaps = 19/225 (8%)

Query: 8   SLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAW 67
           S + H   V S+ F+     + T S D  IKV  +++       V  +  H   V  V  
Sbjct: 70  SFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVWDIRSPS-----VPRNYKHNAPVNEVVI 124

Query: 68  RPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLA 127
            P+   L +   D  I IW     DL E          +    +  ++ +S + DG +L 
Sbjct: 125 HPNQGELISCDRDGNIRIW-----DLGENQCTHQ----LTPEDDVPLQSLSVASDGSMLV 175

Query: 128 TCSRDKSVWIWETDEA--GEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWK 185
             +   + ++WE          +  +  + H   +  V+  +    +A+ S D T RIW 
Sbjct: 176 AANNKGNCYVWEMPNHTDASNLKPATKFKAHPSYITRVLLSSDVKHMATCSADHTARIWS 235

Query: 186 DYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
             +D++   + L GH+  +W   FS   D   L + S D  VR+W
Sbjct: 236 -VEDNFNLESTLDGHQRWVWDCAFSA--DSAYLVTASSDHYVRLW 277

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 52/128 (40%), Gaps = 8/128 (6%)

Query: 104 LAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHV 163
           +A  EGH   V  +S+ QD   + T S D ++ +W+          +    +H+  V  V
Sbjct: 68  VASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVWDIRSPS-----VPRNYKHNAPVNEV 122

Query: 164 VWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSD 223
           V H     L S   D  +RIW   ++  +C   LT  E  +     S   D   L + ++
Sbjct: 123 VIHPNQGELISCDRDGNIRIWDLGEN--QCTHQLTP-EDDVPLQSLSVASDGSMLVAANN 179

Query: 224 DSTVRVWK 231
                VW+
Sbjct: 180 KGNCYVWE 187

>Kwal_26.7570
          Length = 218

 Score = 52.4 bits (124), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 76/179 (42%), Gaps = 21/179 (11%)

Query: 58  HKKAVRSVAWRP-HSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKG 116
           H   V S+A  P   +LL +GS D ++  W  +  D + G  +         GH + V+ 
Sbjct: 16  HNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRS-----FRGHSHIVQD 70

Query: 117 ISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSS 176
            + + DG    + S DK+V +WE        +CI     H  DV  V    + + + S+S
Sbjct: 71  CTVTPDGEYALSASWDKTVRLWELATG----KCIQRFVGHKSDVLSVTIDRRASQIVSAS 126

Query: 177 YDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDF------SKEEDPIRLCSGSDDSTVRV 229
            D TV++W       EC   L GH    W S        S E++ + + S   D  V+V
Sbjct: 127 RDKTVKVWNTLG---ECMVTLLGHND--WVSQVRVAPNESPEDETVTVISAGMDKVVKV 180

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 61/137 (44%), Gaps = 6/137 (4%)

Query: 101 MELLAIIEGHENEVKGISWSQ-DGCLLATCSRDKSVWIWETDEAGEEYEC-ISVLQEHSQ 158
           + L   +EGH   V  ++ S     LL + SRDKS+  W+     ++Y   +   + HS 
Sbjct: 7   LVLRGTLEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSH 66

Query: 159 DVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRL 218
            V+            S+S+D TVR+W+      +C     GH+  +      +     ++
Sbjct: 67  IVQDCTVTPDGEYALSASWDKTVRLWELATG--KCIQRFVGHKSDVLSVTIDRRAS--QI 122

Query: 219 CSGSDDSTVRVWKYIGD 235
            S S D TV+VW  +G+
Sbjct: 123 VSASRDKTVKVWNTLGE 139

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 73/163 (44%), Gaps = 17/163 (10%)

Query: 3   LQLAKSLKLHNDKVWSIDFEPVR-GLLATGSTDRAIKVLQLKNGKENL-LDVLDDTVHKK 60
           L L  +L+ HN  V S+   P +  LL +GS D+++   +L    +   + V     H  
Sbjct: 7   LVLRGTLEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSH 66

Query: 61  AVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWS 120
            V+     P  +   + S+D T+ +W     +L  G  ++  +     GH+++V  ++  
Sbjct: 67  IVQDCTVTPDGEYALSASWDKTVRLW-----ELATGKCIQRFV-----GHKSDVLSVTID 116

Query: 121 QDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHV 163
           +    + + SRDK+V +W T       EC+  L  H+  V  V
Sbjct: 117 RRASQIVSASRDKTVKVWNTLG-----ECMVTLLGHNDWVSQV 154

 Score = 28.5 bits (62), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 3/44 (6%)

Query: 195 AVLTGHEGTIWCSDFSKEE-DPIRLCSGSDDSTVRVWKYIGDDE 237
             L GH G  W +  +     P  L SGS D ++  WK  GDD+
Sbjct: 11  GTLEGHNG--WVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQ 52

>AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH]
           complement(216252..216269,216423..218903) [2499 bp, 832
           aa]
          Length = 832

 Score = 53.9 bits (128), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 75/313 (23%), Positives = 120/313 (38%), Gaps = 64/313 (20%)

Query: 9   LKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTV--HKKAVRSVA 66
            + H D + ++   P R  + + S D  +K   L N ++N    L+ T   H+  V SV 
Sbjct: 93  FEAHPDYIRALAVHPTRSYVLSASDDLTVK---LWNWEKNW--ALEQTFEGHEHFVMSVT 147

Query: 67  WRPH-SDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCL 125
           + P   +  A    D T+ IW+      +E +   +   A +E   N V    + QD   
Sbjct: 148 FNPKDPNTFATACLDHTVKIWSLG----QETSNFTLR--AHLEKGVNFVDYYPF-QDKPY 200

Query: 126 LATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWK 185
           L T S D++V +W+     +   C++ L+ H  +V + V+H    ++ S S D TV+IW 
Sbjct: 201 LITSSDDRTVKVWDY----QTKSCVATLEGHLSNVSYAVYHPMLPIIISGSEDGTVKIWN 256

Query: 186 D------------YDDDWECAAVLTGHEGTIWC------SDFSKEEDPIRL--------- 218
                         +  W  AA  TG    I        +  +   D  RL         
Sbjct: 257 SNTYKLERTLNLGLERSWCVAAHPTGKRNFIAAGFDNGFTVLAIGNDEPRLSLDPVGKLV 316

Query: 219 -CSGSDDSTVRVWKYI--GDDEDD--------QQEWVCESTLPNAHRSQIYGVAWSPSGR 267
            C G   S   V   +  G++E +         +E       P A +        SP+GR
Sbjct: 317 WCGGKTSSATDVLTAVIRGNEEAEDGAVLSLQSKELGTVDVFPQALKH-------SPNGR 369

Query: 268 IASVGADGVLAVY 280
             +V  DG   VY
Sbjct: 370 FVTVVGDGEFVVY 382

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 84/335 (25%), Positives = 130/335 (38%), Gaps = 51/335 (15%)

Query: 1   MPLQLAKSLKLHNDKVWSIDFEPVRG-LLATGSTDRAIKVLQLKNGKENLLDVLDDTVHK 59
           M L+  K+     D+V  IDF P    +L T  + RA    ++ N  E   +V   +V +
Sbjct: 1   MKLETKKTFVSRTDRVKGIDFHPSEPWVLITLYSGRA----EIWN-YETQTEVRSISVCE 55

Query: 60  KAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISW 119
             VR+  + P    +  GS D  I ++  +            E +   E H + ++ ++ 
Sbjct: 56  APVRAGKFIPRKSWIIVGSDDFKIRVFNYN----------TGEKVVDFEAHPDYIRALAV 105

Query: 120 SQDGCLLATCSRDKSV--WIWETDEAGEEYECISVLQEHSQDVKHVVWHTK-HNLLASSS 176
                 + + S D +V  W WE + A E+       + H   V  V ++ K  N  A++ 
Sbjct: 106 HPTRSYVLSASDDLTVKLWNWEKNWALEQ-----TFEGHEHFVMSVTFNPKDPNTFATAC 160

Query: 177 YDDTVRIWKDYDDDWECAAVLTGH-EGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGD 235
            D TV+IW    +       L  H E  +   D+   +D   L + SDD TV+VW Y   
Sbjct: 161 LDHTVKIWSLGQE--TSNFTLRAHLEKGVNFVDYYPFQDKPYLITSSDDRTVKVWDY--- 215

Query: 236 DEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYKEKQNDSEVSEWEIS 295
                Q   C +TL   H S +    + P   I   G++           D  V  W  S
Sbjct: 216 -----QTKSCVATL-EGHLSNVSYAVYHPMLPIIISGSE-----------DGTVKIWN-S 257

Query: 296 ATYKAAHTVYEINTVKW---VNIDGKEMLITAGDD 327
            TYK   T+       W    +  GK   I AG D
Sbjct: 258 NTYKLERTLNLGLERSWCVAAHPTGKRNFIAAGFD 292

 Score = 33.1 bits (74), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 56/248 (22%), Positives = 96/248 (38%), Gaps = 50/248 (20%)

Query: 99  LEMELLAIIEGHENEVKGISW--SQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEH 156
           +++E         + VKGI +  S+   L+   S    +W +ET     E   ISV +  
Sbjct: 1   MKLETKKTFVSRTDRVKGIDFHPSEPWVLITLYSGRAEIWNYETQT---EVRSISVCEAP 57

Query: 157 SQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPI 216
            +  K +    + + +   S D  +R++ +Y+         TG +      DF    D I
Sbjct: 58  VRAGKFI---PRKSWIIVGSDDFKIRVF-NYN---------TGEK----VVDFEAHPDYI 100

Query: 217 R----------LCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSP-- 264
           R          + S SDD TV++W +       ++ W  E T    H   +  V ++P  
Sbjct: 101 RALAVHPTRSYVLSASDDLTVKLWNW-------EKNWALEQTF-EGHEHFVMSVTFNPKD 152

Query: 265 SGRIASVGADGVLAVYKEKQNDSEVSEWEISATYKAAHTVYEINTVKWVNIDGKEMLITA 324
               A+   D  + ++   Q   E S + + A     H    +N V +     K  LIT+
Sbjct: 153 PNTFATACLDHTVKIWSLGQ---ETSNFTLRA-----HLEKGVNFVDYYPFQDKPYLITS 204

Query: 325 GDDGRVNL 332
            DD  V +
Sbjct: 205 SDDRTVKV 212

>Kwal_27.12239
          Length = 316

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 76/189 (40%), Gaps = 32/189 (16%)

Query: 56  TVHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVK 115
           T+H + +  + W P S  +A  S D TI I             +    L  + GH   V 
Sbjct: 55  TLHSRPLSDLCWSPDSQCIATASDDFTIII-----------THIVFGELHRLVGHTAPVT 103

Query: 116 GISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHV-VWHTKHNLLAS 174
            + ++  G LL +CS D+S+ IW+          +  L  HS+ V  + +     ++L+S
Sbjct: 104 SVKYTMKGNLLCSCSMDESIKIWDILSG----TLLRTLSAHSEPVVSIDLPPFDPSILSS 159

Query: 175 SSYDDTVRIWK----------DYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDD 224
            SYD  +RI+            YD DW+         G +  S      +   L   S D
Sbjct: 160 GSYDGLIRIFDTATGHCLKTLTYDKDWQ------SENGVVPISQVKFSRNGKYLLVKSLD 213

Query: 225 STVRVWKYI 233
             +++W ++
Sbjct: 214 GILKIWDFV 222

>KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces
           cerevisiae YML102w CAC2 chromatin assembly complex,
           subunit p60, start by similarity
          Length = 493

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 73/314 (23%), Positives = 123/314 (39%), Gaps = 55/314 (17%)

Query: 16  VWSIDFEPV-------RGLLATGSTDRAIKVLQLK----NGKENLLDVLDD-TVHKKAVR 63
           ++S+ F+P+       R L  +G  D  I+V QL     +GK   +D L   T H++AV 
Sbjct: 17  IYSLCFQPLSETNQNTRRLFTSGG-DNKIRVWQLNESENDGKIETIDFLSSLTQHEQAVN 75

Query: 64  SVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIE------------GHE 111
              +    D LA    D  + +W +++  ++E    + E     E               
Sbjct: 76  VCRFNKQGDTLATAGDDGLLLLWKKNETMVKEFGVDDDEFQDFKESWAVWKRLRSGSASN 135

Query: 112 NEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNL 171
            E+  ISW+  G  +A  S D +V ++  D+     + +  + EH+  V+ +VW  +   
Sbjct: 136 AEIYDISWNPQGTCIAIASLDNTVRVFNVDQG----KVVGHITEHNHYVQGIVWDPQGEF 191

Query: 172 LASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWK 231
           + S S D ++ I K   +D E        +G    +   K E P R   G         K
Sbjct: 192 IVSQSADRSLAICKMIYEDNEV-------KGLQLVNKILKSELPRRKNPGE--------K 236

Query: 232 YIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYKEKQNDSEVSE 291
            +  D+          TLP+  R     ++ SP G +  V A GV       +ND +   
Sbjct: 237 ELDFDKSKVTFLFHNETLPSFFRR----LSMSPCGSLLCVPA-GVF------RNDEQTDA 285

Query: 292 WEISATYKAAHTVY 305
              +  Y  A  +Y
Sbjct: 286 SNNNPEYANAVYIY 299

>YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-binding
           protein, inhibits ARP2/3-stimulated actin nucleation,
           contains WD (WD-40) repeats [1956 bp, 651 aa]
          Length = 651

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 71/294 (24%), Positives = 126/294 (42%), Gaps = 46/294 (15%)

Query: 9   LKLHNDKVWSIDFEPVRG-LLATGSTDRAIKVLQLKNGKENLLDVLDD------------ 55
            + H  +V   DF+P     +A+GS D  I +  +    +   D +D+            
Sbjct: 77  FRGHTAQVLDTDFDPFNDHRIASGSDDSKIGIWDIPENYK-FHDHVDEDGEPIDIKPVKF 135

Query: 56  -TVHKKAVRSVAWRP-HSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENE 113
            T H + V  V + P   ++LA+ S D T+ +W     ++E G  +      I   H + 
Sbjct: 136 LTGHARKVGHVLYHPVAENVLASSSGDYTVKLW-----NVETGKDM------ITLKHPDM 184

Query: 114 VKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHS-QDVKHVVWHTKHNLL 172
           V  +S+S DG  LAT +RDK + +W       E + +S    H+    + VVW    + L
Sbjct: 185 VTSMSFSYDGNYLATVARDKKLRVWNI----REEKIVSEGPAHTGAKNQRVVWLGNSDRL 240

Query: 173 ASSSY----DDTVRIWKDYD-DDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTV 227
           A++ +    D  + IW  ++ +  +     T  + +     F  E + I    G  D  +
Sbjct: 241 ATTGFSKLSDRQIGIWDAFNIEKGDLGGFYTVDQSSGILMPFYDEGNKILYLVGKGDGNI 300

Query: 228 RVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYK 281
           R +++  D+  +  E+  +ST   A R    G A +P  R+ +V  + VL  +K
Sbjct: 301 RYYEFQNDELFELSEF--QST--EAQR----GFAVAPK-RMVNVKENEVLKGFK 345

>Kwal_56.23685
          Length = 1102

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 65/137 (47%), Gaps = 6/137 (4%)

Query: 106 IIEGHENEVKGISWSQDGC-LLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVV 164
           ++ GH   +  I++      +LATCS D  V  W+       Y   SV    +  VK   
Sbjct: 109 VLHGHSRAITDINFHPTHPEILATCSIDAYVHAWDMRSPRRAYYSASVWSAGASQVK--- 165

Query: 165 WHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDD 224
           W+ K++ + +S++ + V IW D         VL GH  ++   DFSK  D   + S S+D
Sbjct: 166 WNYKNSNVMASAHSNDVYIW-DLRKGCTPLHVLQGHVNSVNSIDFSKF-DETEIMSSSND 223

Query: 225 STVRVWKYIGDDEDDQQ 241
            TV+ W Y   D++ Q+
Sbjct: 224 GTVKFWDYSLSDKEPQR 240

>CAGL0M04081g complement(450572..451939) highly similar to sp|P42841
           Saccharomyces cerevisiae YNL317w PFS2 polyadenylation
           factor I, hypothetical start
          Length = 455

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 78/173 (45%), Gaps = 17/173 (9%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGI 117
           H  +V ++ +    D + +G  D TI IW Q + ++ +      EL  I   H   ++ +
Sbjct: 123 HDTSVTTMKYSHAGDWMISGDADGTIKIW-QPNFNMVK------ELDRI---HTEGIRDV 172

Query: 118 SWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSY 177
           ++S +     TCS D  + IW      +E     VL  H  DV+   WH +  L+ S S 
Sbjct: 173 AFSNNDSKFVTCSDDNILKIWNFSNGQQE----RVLSGHHWDVRSCDWHPELGLIVSGSK 228

Query: 178 DDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
           D+ V++W       +C + L   + T+  + F   +  + L + S D + RV+
Sbjct: 229 DNLVKLWDPRSG--QCVSTLLKFKHTVLKTRFQPTKGNL-LAAISKDKSCRVF 278

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/192 (22%), Positives = 79/192 (41%), Gaps = 28/192 (14%)

Query: 59  KKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGIS 118
           K  + ++ W P    L   +F    S+W  S    E           I++ H+  V  + 
Sbjct: 82  KHVIPAIQWSPEGRRLIVATFSGEFSLWNGSSFTFE----------TIMQAHDTSVTTMK 131

Query: 119 WSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQE-HSQDVKHVVWHTKHNLLASSSY 177
           +S  G  + +   D ++ IW+ +     +  +  L   H++ ++ V +    +   + S 
Sbjct: 132 YSHAGDWMISGDADGTIKIWQPN-----FNMVKELDRIHTEGIRDVAFSNNDSKFVTCSD 186

Query: 178 DDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDE 237
           D+ ++IW   +   E   VL+GH   +   D+  E   I   SGS D+ V++W       
Sbjct: 187 DNILKIWNFSNGQQE--RVLSGHHWDVRSCDWHPELGLI--VSGSKDNLVKLW------- 235

Query: 238 DDQQEWVCESTL 249
            D +   C STL
Sbjct: 236 -DPRSGQCVSTL 246

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 51/233 (21%), Positives = 92/233 (39%), Gaps = 26/233 (11%)

Query: 3   LQLAKSL-KLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKA 61
             + K L ++H + +  + F        T S D  +K+    NG++    VL    H   
Sbjct: 155 FNMVKELDRIHTEGIRDVAFSNNDSKFVTCSDDNILKIWNFSNGQQE--RVLSG--HHWD 210

Query: 62  VRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQ 121
           VRS  W P   L+ +GS D+ + +W     D   G  +      +++     +K      
Sbjct: 211 VRSCDWHPELGLIVSGSKDNLVKLW-----DPRSGQCVS----TLLKFKHTVLKTRFQPT 261

Query: 122 DGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHT-KHNLLASSSYDDT 180
            G LLA  S+DKS  +++   +  E  C+        D   + W T   ++     YD +
Sbjct: 262 KGNLLAAISKDKSCRVFDLRASMNELMCV----RDEVDFMELEWSTINESMFTVGCYDGS 317

Query: 181 VRIWK-DYDDDWECAAVLTGHEGTIWCSDFSKEEDPIR--LCSGSDDSTVRVW 230
           ++ +    D +     +   HE  I    +    +P+   L + + D T+R W
Sbjct: 318 LKHFDLGQDTEKPIHIIPFAHEKCISAIAY----NPVGHILATAAKDRTIRFW 366

 Score = 33.5 bits (75), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 31/63 (49%), Gaps = 1/63 (1%)

Query: 27  LLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHSDLLAAGSFDSTISIW 86
           +   G  D ++K   L    E  + ++    H+K + ++A+ P   +LA  + D TI  W
Sbjct: 308 MFTVGCYDGSLKHFDLGQDTEKPIHIIP-FAHEKCISAIAYNPVGHILATAAKDRTIRFW 366

Query: 87  TQS 89
           T++
Sbjct: 367 TRA 369

>KLLA0C16643g complement(1457590..1458498) highly similar to
           sp|Q04491 Saccharomyces cerevisiae YLR208w SEC13 protein
           transport protein, start by similarity
          Length = 302

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 88/208 (42%), Gaps = 37/208 (17%)

Query: 102 ELLAIIEGHENEVKGISWSQD--GCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQD 159
           +L+  ++GHE  V  + W+    G +LA+CS D  V IW+  E    +  I+  + HS  
Sbjct: 44  KLVDTLQGHEGPVWQVDWAHPKFGVILASCSYDGKVLIWK--EVNGRWSQIAAHEVHSAS 101

Query: 160 VKHVVW--HTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGH----------------- 200
           V  + W  H    LL ++S D  V + +  ++      ++  H                 
Sbjct: 102 VNSIQWAPHEYGPLLLAASSDGKVSVVEFKENGTTSPIIIDAHSIGANTACWAPATLQQQ 161

Query: 201 --EGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIY 258
             +GT   S  +  +   R  +G  D+ V++WKY      D   ++ E TL   H   + 
Sbjct: 162 SNQGT---SGSASPQQVRRFVTGGADNLVKIWKY----NSDAATYLLEHTL-EGHSDWVR 213

Query: 259 GVAWSPS----GRIASVGADGVLAVYKE 282
            VAWSP+      +ASV  D    ++ +
Sbjct: 214 DVAWSPTVLSRSYLASVSQDRTCIIWTQ 241

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 83/203 (40%), Gaps = 39/203 (19%)

Query: 123 GCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVW-HTKHN-LLASSSYDDT 180
           G  LATCS D +V I+E +  GE ++ +  LQ H   V  V W H K   +LAS SYD  
Sbjct: 21  GKRLATCSSDHTVKIFEVE--GETHKLVDTLQGHEGPVWQVDWAHPKFGVILASCSYDGK 78

Query: 181 VRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQ 240
           V IWK+ +  W   A    H  ++    ++  E    L + S D  V V ++       +
Sbjct: 79  VLIWKEVNGRWSQIAAHEVHSASVNSIQWAPHEYGPLLLAASSDGKVSVVEF-------K 131

Query: 241 QEWVCESTLPNAHRSQIYGVAWSPSG-------------------RIASVGADGVLAVYK 281
           +       + +AH        W+P+                    R  + GAD ++ ++K
Sbjct: 132 ENGTTSPIIIDAHSIGANTACWAPATLQQQSNQGTSGSASPQQVRRFVTGGADNLVKIWK 191

Query: 282 EKQNDSEVSEWEISATYKAAHTV 304
              +         +ATY   HT+
Sbjct: 192 YNSD---------AATYLLEHTL 205

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 66/248 (26%), Positives = 105/248 (42%), Gaps = 24/248 (9%)

Query: 4   QLAKSLKLHNDKVWSIDF-EPVRG-LLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKA 61
           +L  +L+ H   VW +D+  P  G +LA+ S D  + + +  NG+ +   +    VH  +
Sbjct: 44  KLVDTLQGHEGPVWQVDWAHPKFGVILASCSYDGKVLIWKEVNGRWS--QIAAHEVHSAS 101

Query: 62  VRSVAWRPH--SDLLAAGSFDSTISI------WTQSDLDLEE---GAKLEMELLAIIEGH 110
           V S+ W PH    LL A S D  +S+       T S + ++    GA       A ++  
Sbjct: 102 VNSIQWAPHEYGPLLLAASSDGKVSVVEFKENGTTSPIIIDAHSIGANTACWAPATLQQQ 161

Query: 111 ENE-VKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHT-- 167
            N+   G +  Q      T   D  V IW+ +     Y     L+ HS  V+ V W    
Sbjct: 162 SNQGTSGSASPQQVRRFVTGGADNLVKIWKYNSDAATYLLEHTLEGHSDWVRDVAWSPTV 221

Query: 168 -KHNLLASSSYDDTVRIWKD--YDDDWECAAVLT-GHEGTIWCSDFSKEEDPIRLCSGSD 223
              + LAS S D T  IW     +D W+   +        +W + +S   + + L  G  
Sbjct: 222 LSRSYLASVSQDRTCIIWTQDSKEDTWKKTLLKEDKFPDVLWRASWSLSGNILALSCG-- 279

Query: 224 DSTVRVWK 231
           D+TV +WK
Sbjct: 280 DNTVTLWK 287

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 88/214 (41%), Gaps = 33/214 (15%)

Query: 10  KLHNDKVWSIDFEP--VRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAW 67
           ++H+  V SI + P     LL   S+D  + V++ K        ++D   H     +  W
Sbjct: 96  EVHSASVNSIQWAPHEYGPLLLAASSDGKVSVVEFKENGTTSPIIID--AHSIGANTACW 153

Query: 68  RPHS------------------DLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEG 109
            P +                       G  D+ + IW  +     + A   +E    +EG
Sbjct: 154 APATLQQQSNQGTSGSASPQQVRRFVTGGADNLVKIWKYNS----DAATYLLE--HTLEG 207

Query: 110 HENEVKGISWSQ---DGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVK-HVVW 165
           H + V+ ++WS        LA+ S+D++  IW  D   + ++   + ++   DV     W
Sbjct: 208 HSDWVRDVAWSPTVLSRSYLASVSQDRTCIIWTQDSKEDTWKKTLLKEDKFPDVLWRASW 267

Query: 166 HTKHNLLASSSYDDTVRIWK-DYDDDWECAAVLT 198
               N+LA S  D+TV +WK + +  WE A  +T
Sbjct: 268 SLSGNILALSCGDNTVTLWKENLEGKWEPAGQVT 301

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 64/141 (45%), Gaps = 10/141 (7%)

Query: 150 ISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDF 209
           +++   HS+ +   V       LA+ S D TV+I++   +  +    L GHEG +W  D+
Sbjct: 2   VTINNAHSELIHDAVLDYYGKRLATCSSDHTVKIFEVEGETHKLVDTLQGHEGPVWQVDW 61

Query: 210 SKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSP---SG 266
           +  +  + L S S D  V +WK +         W  +      H + +  + W+P     
Sbjct: 62  AHPKFGVILASCSYDGKVLIWKEVNG------RW-SQIAAHEVHSASVNSIQWAPHEYGP 114

Query: 267 RIASVGADGVLAVYKEKQNDS 287
            + +  +DG ++V + K+N +
Sbjct: 115 LLLAASSDGKVSVVEFKENGT 135

 Score = 29.6 bits (65), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 55/121 (45%), Gaps = 21/121 (17%)

Query: 217 RLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGR---IASVGA 273
           RL + S D TV++++  G+            TL   H   ++ V W+       +AS   
Sbjct: 23  RLATCSSDHTVKIFEVEGETHK------LVDTL-QGHEGPVWQVDWAHPKFGVILASCSY 75

Query: 274 DGVLAVYKEKQNDSEVSEWEISATYKAAHTVYE--INTVKWVNIDGKEMLITAGDDGRVN 331
           DG + ++KE         W    +  AAH V+   +N+++W   +   +L+ A  DG+V+
Sbjct: 76  DGKVLIWKEVNG-----RW----SQIAAHEVHSASVNSIQWAPHEYGPLLLAASSDGKVS 126

Query: 332 L 332
           +
Sbjct: 127 V 127

>Sklu_2114.2 YDR128W, Contig c2114 598-4020 reverse complement
          Length = 1140

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 62/128 (48%), Gaps = 6/128 (4%)

Query: 106 IIEGHENEVKGISW-SQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVV 164
           I+ GH   +  I++      +LATCS D  V  W+       Y   S  +  +  VK   
Sbjct: 109 ILHGHFRAITDINFHPHHPEILATCSVDTYVLAWDMRSPQRPYYSTSEWRAGASQVK--- 165

Query: 165 WHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDD 224
           W+ +++ + +SS+ D V IW D          L GHEG++   DF+K ++   + S S+D
Sbjct: 166 WNFRNSNIMASSHSDHVCIW-DLRKGCTPLYTLQGHEGSVNNIDFNKAKE-TEIMSSSND 223

Query: 225 STVRVWKY 232
            TV+ W Y
Sbjct: 224 GTVKFWDY 231

>KLLA0D07546g complement(647984..649927) some similarities with
           sp|P07834 Saccharomyces cerevisiae YFL009w CDC4 cell
           division control protein, hypothetical start
          Length = 647

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 89/189 (47%), Gaps = 25/189 (13%)

Query: 9   LKLHNDKVWSIDFEPVRG-LLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAW 67
           L  H   VW++ F  V G +L +GSTDR++++  ++ GK     V     H   VR +  
Sbjct: 296 LNGHEGGVWALKF--VDGKILVSGSTDRSVRIWNIETGK--CTHVFKG--HTSTVRCLEV 349

Query: 68  RPHSD--LLAAGSFDSTISIWTQSDL-DLEEGAKLEM---------ELLAIIEGHENEVK 115
             + D   +  GS D+T+ +W    + +L++G++  +           + ++ GH + V+
Sbjct: 350 VEYGDSKYIVTGSRDNTLHVWKLPPMKELDKGSQEPIFYRTPEENPYFVGVLRGHMSSVR 409

Query: 116 GISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASS 175
            +S    G ++ + S D ++ +W+       Y    +L  H+  V   ++  K N   S+
Sbjct: 410 TVS--GHGRIVISGSYDHNLMVWDIISMKLLY----ILTGHTDRVYSTIYDYKRNRCISA 463

Query: 176 SYDDTVRIW 184
           S D TV IW
Sbjct: 464 SMDTTVMIW 472

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 2/70 (2%)

Query: 171 LLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
           +L S S D +VRIW    +  +C  V  GH  T+ C +  +  D   + +GS D+T+ VW
Sbjct: 313 ILVSGSTDRSVRIWNI--ETGKCTHVFKGHTSTVRCLEVVEYGDSKYIVTGSRDNTLHVW 370

Query: 231 KYIGDDEDDQ 240
           K     E D+
Sbjct: 371 KLPPMKELDK 380

 Score = 34.7 bits (78), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 41/85 (48%), Gaps = 12/85 (14%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGI 117
           H  +VR+V+   H  ++ +GS+D  + +W     D+     + M+LL I+ GH + V   
Sbjct: 404 HMSSVRTVSG--HGRIVISGSYDHNLMVW-----DI-----ISMKLLYILTGHTDRVYST 451

Query: 118 SWSQDGCLLATCSRDKSVWIWETDE 142
            +        + S D +V IW+ + 
Sbjct: 452 IYDYKRNRCISASMDTTVMIWDLEN 476

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 3/35 (8%)

Query: 197 LTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWK 231
           L GHEG +W   F    D   L SGS D +VR+W 
Sbjct: 296 LNGHEGGVWALKFV---DGKILVSGSTDRSVRIWN 327

>Sklu_2442.2 YNL006W, Contig c2442 3831-4742
          Length = 303

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 94/227 (41%), Gaps = 23/227 (10%)

Query: 8   SLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAW 67
           S + H   V SI F+     + + S D  IKV  ++        V  +  H   V  V  
Sbjct: 70  SFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPS-----VQRNYKHHAPVNEVVI 124

Query: 68  RPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLA 127
            P+   L +   D  I IW     DL E          +    +  ++ +S + DG +L 
Sbjct: 125 HPNQGELISCDQDGNIRIW-----DLGENQCTHQ----LTPEDDTPLQSLSIASDGSMLV 175

Query: 128 TCSRDKSVWIWE----TDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRI 183
             +   + ++W+    TD A    + ++  + H++ +  V+  +    LA+ S D T R+
Sbjct: 176 AGNNKGNCYVWQMPNHTDAA--NLKPVTKFRSHTKYITRVLLSSDVKHLATCSADHTARV 233

Query: 184 WKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
           W   +D+++    L GH+  +W   FS   D   L +   D  VR+W
Sbjct: 234 WS-IEDNFKLETTLDGHQRWVWDCAFSA--DSAYLVTACSDHYVRLW 277

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 52/125 (41%), Gaps = 8/125 (6%)

Query: 107 IEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWH 166
            EGH   V  IS+ QD   + + S D ++ +W+      +        +H   V  VV H
Sbjct: 71  FEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPSVQRN-----YKHHAPVNEVVIH 125

Query: 167 TKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDST 226
                L S   D  +RIW D  ++ +C   LT  + T   S  S   D   L +G++   
Sbjct: 126 PNQGELISCDQDGNIRIW-DLGEN-QCTHQLTPEDDTPLQS-LSIASDGSMLVAGNNKGN 182

Query: 227 VRVWK 231
             VW+
Sbjct: 183 CYVWQ 187

 Score = 33.9 bits (76), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 51/125 (40%), Gaps = 13/125 (10%)

Query: 27  LLATGSTDRAIKVLQLKNGKE--NLLDVLDDTVHKKAVRSVAWRPHSDLLAAGSFDSTIS 84
           +L  G+      V Q+ N  +  NL  V     H K +  V        LA  S D T  
Sbjct: 173 MLVAGNNKGNCYVWQMPNHTDAANLKPVTKFRSHTKYITRVLLSSDVKHLATCSADHTAR 232

Query: 85  IWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWE--TDE 142
           +W+     +E+  KLE  L    +GH+  V   ++S D   L T   D  V +W+  T E
Sbjct: 233 VWS-----IEDNFKLETTL----DGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTRE 283

Query: 143 AGEEY 147
              +Y
Sbjct: 284 IVRQY 288

>Sklu_2416.5 YNL317W, Contig c2416 8692-10071
          Length = 459

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 65/153 (42%), Gaps = 16/153 (10%)

Query: 57  VHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKG 116
            H  AV ++ +    D L +G  D  I IW Q + ++         +  + + H   V+ 
Sbjct: 121 AHDSAVTTMEYSHAGDWLISGDSDGIIKIW-QPNFNM---------VKVLDQAHMECVRD 170

Query: 117 ISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSS 176
           +S+S       TCS D  + IW      +E     VL  H  DVK   WH    L+ S S
Sbjct: 171 VSFSGTDSKFVTCSDDNILKIWNFSNGQQE----RVLSGHHWDVKSCDWHPTMGLIVSGS 226

Query: 177 YDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDF 209
            D+ +++W       +C + + G + TI  + F
Sbjct: 227 KDNLIKLWDPRSG--QCISTILGFKHTIIKTKF 257

 Score = 50.8 bits (120), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 51/243 (20%), Positives = 100/243 (41%), Gaps = 31/243 (12%)

Query: 59  KKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGIS 118
           K  + ++ W P    L   ++    S+W  S  + E          +I++ H++ V  + 
Sbjct: 81  KHVIPAIKWTPEGRRLVVATYSGEFSLWNGSTFNFE----------SIMQAHDSAVTTME 130

Query: 119 WSQDGCLLATCSRDKSVWIWETDEAGEEYECISVL-QEHSQDVKHVVWHTKHNLLASSSY 177
           +S  G  L +   D  + IW+ +     +  + VL Q H + V+ V +    +   + S 
Sbjct: 131 YSHAGDWLISGDSDGIIKIWQPN-----FNMVKVLDQAHMECVRDVSFSGTDSKFVTCSD 185

Query: 178 DDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDE 237
           D+ ++IW   +   E   VL+GH   +   D+        + SGS D+ +++W       
Sbjct: 186 DNILKIWNFSNGQQE--RVLSGHHWDVKSCDWHPTMG--LIVSGSKDNLIKLW------- 234

Query: 238 DDQQEWVCESTLPNAHRSQIYGVAWSPS--GRIASVGADGVLAVYKEKQNDSEVSEWEIS 295
            D +   C ST+    +  I    + P+    +A V  D    ++  +QN  E+  +   
Sbjct: 235 -DPRSGQCISTI-LGFKHTIIKTKFQPTKGNLLAVVAKDKSCKIFDIRQNMKELKSFRDE 292

Query: 296 ATY 298
           + Y
Sbjct: 293 SDY 295

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 78/177 (44%), Gaps = 19/177 (10%)

Query: 9   LKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWR 68
           ++ H+  V ++++      L +G +D  IK+ Q      N++ VLD   H + VR V++ 
Sbjct: 119 MQAHDSAVTTMEYSHAGDWLISGDSDGIIKIWQ---PNFNMVKVLDQ-AHMECVRDVSFS 174

Query: 69  PHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLAT 128
                    S D+ + IW  S+   E           ++ GH  +VK   W     L+ +
Sbjct: 175 GTDSKFVTCSDDNILKIWNFSNGQQER----------VLSGHHWDVKSCDWHPTMGLIVS 224

Query: 129 CSRDKSVWIWETDEAGEEYECIS-VLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIW 184
            S+D  + +W+        +CIS +L      +K     TK NLLA  + D + +I+
Sbjct: 225 GSKDNLIKLWDPRSG----QCISTILGFKHTIIKTKFQPTKGNLLAVVAKDKSCKIF 277

 Score = 33.1 bits (74), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 46/218 (21%), Positives = 82/218 (37%), Gaps = 59/218 (27%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHS 71
           H + V  + F        T S D  +K+    NG++    VL    H   V+S  W P  
Sbjct: 164 HMECVRDVSFSGTDSKFVTCSDDNILKIWNFSNGQQE--RVLSG--HHWDVKSCDWHPTM 219

Query: 72  DLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQ-DGCLLATCS 130
            L+ +GS D+ I +W     D   G     + ++ I G ++ +    +    G LLA  +
Sbjct: 220 GLIVSGSKDNLIKLW-----DPRSG-----QCISTILGFKHTIIKTKFQPTKGNLLAVVA 269

Query: 131 RDKSVWIWETDEAGEEYECIS-------------------------------VLQE---- 155
           +DKS  I++  +  +E +                                  +LQ+    
Sbjct: 270 KDKSCKIFDIRQNMKELKSFRDESDYMSLTWHPINESIFTVGCYDGSLKHFDLLQDTGSS 329

Query: 156 ---------HSQDVKHVVWHTKHNLLASSSYDDTVRIW 184
                    H + +  + ++   ++LAS+S D T+R W
Sbjct: 330 NSFHDIPYAHDKCITSLSYNPVGHILASASKDRTIRFW 367

 Score = 32.3 bits (72), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 43/92 (46%), Gaps = 8/92 (8%)

Query: 4   QLAKSLKLHNDK--VWSIDFEPVR-GLLATGSTDRAIK---VLQLKNGKENLLDVLDDTV 57
           Q  K LK   D+    S+ + P+   +   G  D ++K   +LQ      +  D+     
Sbjct: 281 QNMKELKSFRDESDYMSLTWHPINESIFTVGCYDGSLKHFDLLQDTGSSNSFHDI--PYA 338

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQS 89
           H K + S+++ P   +LA+ S D TI  WT+S
Sbjct: 339 HDKCITSLSYNPVGHILASASKDRTIRFWTRS 370

>KLLA0F22000g complement(2044973..2047354) similar to sp|P42935
           Saccharomyces cerevisiae YGR200c ELP2 90 kDa subunit of
           elongator and elongating RNA polymerase II holoenzyme
           singleton, start by similarity
          Length = 793

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 72/311 (23%), Positives = 124/311 (39%), Gaps = 48/311 (15%)

Query: 20  DFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTV---HKKAVRSVAWR---PHSDL 73
           + E  + +LA G T+  + +  L +  E +  +   T    H+  ++S+ +R   P   L
Sbjct: 159 EIEKTQFILAIGGTNVNVFIYSLVSNSEGVSKLEFATKLEGHEDWIKSLVFRETVPGDYL 218

Query: 74  LAAGSFDSTISIW---TQSDLDLEEGAKLEMELL--------------------AIIEGH 110
           LA+GS D  I +W   T   +D  E  + ++ LL                    A+I GH
Sbjct: 219 LASGSQDRYIRLWRIRTNEKIDTSEEDEKKLTLLSNKIYKFDISADVHVAINFEALIMGH 278

Query: 111 ENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHV------- 163
           ++ +  + W +    L T + D +V +WE D     + C S L E S             
Sbjct: 279 DDWISSLQWHKTKLQLLTSTADTAVMVWEPDTISGIWICSSRLGELSSKGASTATGSSGG 338

Query: 164 ----VW--HTKHNLLASSSYDDTVRIWKDYDD-DWECAAVLTGHEGTIWCSDFSKEEDPI 216
               +W  H   +++ ++    + RIW   D   W+    +TG   ++  +D +   D  
Sbjct: 339 FWSCIWFTHDGKDVILTNGKTGSWRIWTSTDGLLWDQELGITGATKSV--TDVAWSIDGN 396

Query: 217 RLCSGSDDSTVRV---WKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGA 273
            L S S D T R+   WKY     + +    CE   P  H   +  V    + R  S G 
Sbjct: 397 YLLSTSLDQTTRLFAEWKYETSGVERKTPSWCEMARPQIHGYDMLCVEPISNTRFVSGGD 456

Query: 274 DGVLAVYKEKQ 284
           + +L  + E +
Sbjct: 457 EKILRSFDEPK 467

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/141 (20%), Positives = 58/141 (41%), Gaps = 8/141 (5%)

Query: 103 LLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGE----EYECISVLQEHSQ 158
           +   ++GH  EV  + + +   ++ + S D  V +W   +  E    E ECI V++ H  
Sbjct: 48  VFKTLKGHTAEVTCVRFVKGTDMMVSASEDFEVRVWNFPKLREGHMDEVECIQVIKHHKH 107

Query: 159 DVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGT--IWCSDFSKEEDPI 216
            +   V+    NLL     D ++ +W   +D +      +  +G   +  S    E+   
Sbjct: 108 TI--TVFAVLKNLLVVGCADGSISVWSFIEDQYVLQEEFSVQKGVFPLCLSMHEIEKTQF 165

Query: 217 RLCSGSDDSTVRVWKYIGDDE 237
            L  G  +  V ++  + + E
Sbjct: 166 ILAIGGTNVNVFIYSLVSNSE 186

 Score = 37.0 bits (84), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 58/125 (46%), Gaps = 12/125 (9%)

Query: 133 KSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIW------KD 186
           K++ +W++ +    +     L+ H+ +V  V +    +++ S+S D  VR+W      + 
Sbjct: 33  KTIALWKSMDTSH-HGVFKTLKGHTAEVTCVRFVKGTDMMVSASEDFEVRVWNFPKLREG 91

Query: 187 YDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEW-VC 245
           + D+ EC  V+  H+ TI      K      L  G  D ++ VW +I D    Q+E+ V 
Sbjct: 92  HMDEVECIQVIKHHKHTITVFAVLKN----LLVVGCADGSISVWSFIEDQYVLQEEFSVQ 147

Query: 246 ESTLP 250
           +   P
Sbjct: 148 KGVFP 152

 Score = 36.6 bits (83), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 82/197 (41%), Gaps = 20/197 (10%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGI 117
           H   V  V +   +D++ + S D  + +W    L   EG   E+E + +I+ H++ +   
Sbjct: 55  HTAEVTCVRFVKGTDMMVSASEDFEVRVWNFPKL--REGHMDEVECIQVIKHHKHTITVF 112

Query: 118 SWSQDGCLLATCSRDKSVWIWETDE--AGEEYE--------CISVLQEHSQDVKHVVWHT 167
           +  ++  ++       SVW +  D+    EE+         C+S+ +         +  T
Sbjct: 113 AVLKNLLVVGCADGSISVWSFIEDQYVLQEEFSVQKGVFPLCLSMHEIEKTQFILAIGGT 172

Query: 168 KHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDP--IRLCSGSDDS 225
             N+   S   ++  + K      E A  L GHE  I    F +E  P    L SGS D 
Sbjct: 173 NVNVFIYSLVSNSEGVSK-----LEFATKLEGHEDWIKSLVF-RETVPGDYLLASGSQDR 226

Query: 226 TVRVWKYIGDDEDDQQE 242
            +R+W+   +++ D  E
Sbjct: 227 YIRLWRIRTNEKIDTSE 243

 Score = 32.0 bits (71), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 43/104 (41%), Gaps = 9/104 (8%)

Query: 180 TVRIWKDYDDDWE-CAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDED 238
           T+ +WK  D         L GH   + C  F K  D   + S S+D  VRVW +    E 
Sbjct: 34  TIALWKSMDTSHHGVFKTLKGHTAEVTCVRFVKGTD--MMVSASEDFEVRVWNFPKLREG 91

Query: 239 DQQEWVCESTLP-NAHRSQIYGVAWSPSGRIASVG-ADGVLAVY 280
              E  C   +  + H   ++ V       +  VG ADG ++V+
Sbjct: 92  HMDEVECIQVIKHHKHTITVFAVL----KNLLVVGCADGSISVW 131

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 51/234 (21%), Positives = 94/234 (40%), Gaps = 35/234 (14%)

Query: 107 IEGHENEVKGISWSQDGCLLATCSRDKSVW--IWETDEAGEEYECISVLQEHSQDVKHVV 164
           + GH  E+  I  S D  L+AT  +  +    +    +A    +   VL  H+  +  + 
Sbjct: 555 LYGHGYEISCIDVSPDRKLIATACKSNNAQHAVIRLFDAENWNQLPQVLPFHNLTITKLR 614

Query: 165 WHTKHNLLASSSYDDTVRIW-KDYDDDWECAAVLTG-----HEGTIWCSDFSKEEDPIRL 218
           +   +  L S S D    +W +++D++   + VL       H   IW +D+      +  
Sbjct: 615 FSKDNRYLLSVSRDRLWSLWERNFDNN---SFVLRSFKEKPHSRIIWDADWVPLAKGLAF 671

Query: 219 CSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRS-------QIYGVAWSPSGRIASV 271
            + S D T++ W+   +DE    E      L N+ R         ++   ++    +A  
Sbjct: 672 ITASRDKTLKFWRLSKEDEATSVE------LENSIRFSEPVTSISVHKDLYNEKVLLAVG 725

Query: 272 GADGVLAV--YKEKQNDSEVSEWEISATYKAAHTVYEINTVKWVNI--DGKEML 321
              G + +  Y E  ND    +W I+   K       IN ++W N+  +GK +L
Sbjct: 726 FESGAIRILSYTESFNDITEIDWAITPADK-------INRLRWSNLVENGKLLL 772

>CAGL0J04818g 455846..457810 highly similar to sp|Q06440
           Saccharomyces cerevisiae YLR429w CRN1, start by
           similarity
          Length = 654

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 71/295 (24%), Positives = 127/295 (43%), Gaps = 49/295 (16%)

Query: 9   LKLHNDKVWSIDFEPVR-GLLATGSTDRAIKV-------LQLKNG-KENLLDVLDD---T 56
            + H  +V   DF+P     +A+ S D  I +         LK+G  E + D+      T
Sbjct: 77  FRGHTAQVLDTDFDPFDDNRVASSSDDGKIGIWDIPQDYSILKSGDNEEIKDIEPTKFLT 136

Query: 57  VHKKAVRSVAWRPHS-DLLAAGSFDSTISIWTQSDLDLEEGA---KLEMELLAIIEGHEN 112
            H + V  + + P + D+LA+ S D T+ IW     ++E G    KL+         H +
Sbjct: 137 GHSRKVGHILYHPTAKDVLASSSLDYTVRIW-----NVETGEDIYKLK---------HPD 182

Query: 113 EVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHS-QDVKHVVWHTKHNL 171
            V  +S+S DG  LAT +RDK + +W       E + +S    H+    + VVW      
Sbjct: 183 MVTSMSFSYDGTHLATVARDKKLRVWNV----REEKVVSEGAAHAGAKNQRVVWLGNSER 238

Query: 172 LASSSY----DDTVRIWKDYD-DDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDST 226
           LA++ +    D  + IW  ++ +  +     T  + +     F  + + I   +G  D  
Sbjct: 239 LATTGFSKLSDRQIGIWDAFNLEKGDLGGFYTVDQSSGILMPFYDDGNKILYLAGKGDGN 298

Query: 227 VRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYK 281
           +R +++    ++D+   + E     A R    G A +P  R+ ++  + V+  YK
Sbjct: 299 IRYYEF----QNDELFELSEFQSIEAQR----GFAVTPK-RLVNIRENEVMKCYK 344

>Sklu_1645.2 YGL116W, Contig c1645 887-2650 reverse complement
          Length = 587

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 89/194 (45%), Gaps = 25/194 (12%)

Query: 98  KLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHS 157
           +++  +++  + H  EV G+S+ +DG  LA+ S D SV IW+T  +  ++    V + H+
Sbjct: 362 RIKNHIVSAWQEHSGEVCGLSYRKDGLQLASGSNDNSVMIWDTRTSMPQF----VKRNHT 417

Query: 158 QDVKHVVWHTK-HNLLASSS--YDDTVRIWKDYDDDWECAAVLTGHE------GTIWCSD 208
             VK + W     NLLA+     D  +  W +       +++ TG +      G  +  D
Sbjct: 418 AAVKAISWCPDVPNLLATGGGQTDKYIHFW-NTTTGARVSSINTGSQVSSLQWGQSYNGD 476

Query: 209 FSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSG-R 267
               E  I    G+ ++ + V+ Y      + +  V E  +  AH S+I     SP G  
Sbjct: 477 IMNRE--IVATGGNPENAISVYNY------ETRFKVAE--IVQAHDSRICSSQLSPDGTT 526

Query: 268 IASVGADGVLAVYK 281
           +A+VG D  L  YK
Sbjct: 527 LATVGGDENLKFYK 540

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 72/184 (39%), Gaps = 27/184 (14%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGI 117
           H   V  +++R     LA+GS D+++ IW           +  M    +   H   VK I
Sbjct: 374 HSGEVCGLSYRKDGLQLASGSNDNSVMIW---------DTRTSMPQF-VKRNHTAAVKAI 423

Query: 118 SWSQD-GCLLATCS--RDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHN---- 170
           SW  D   LLAT     DK +  W T         +S +   SQ V  + W   +N    
Sbjct: 424 SWCPDVPNLLATGGGQTDKYIHFWNTTTGAR----VSSINTGSQ-VSSLQWGQSYNGDIM 478

Query: 171 ---LLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTV 227
              ++A+    +      +Y+  ++ A ++  H+  I  S  S   D   L +   D  +
Sbjct: 479 NREIVATGGNPENAISVYNYETRFKVAEIVQAHDSRICSSQLS--PDGTTLATVGGDENL 536

Query: 228 RVWK 231
           + +K
Sbjct: 537 KFYK 540

 Score = 28.5 bits (62), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 50/253 (19%), Positives = 106/253 (41%), Gaps = 38/253 (15%)

Query: 83  ISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDE 142
           ++I  +S L L  G   ++ LL   E     +  ++WS D C ++    D +  IW+   
Sbjct: 265 LAIALESSLYLWNGESGDVTLLTEFEAET--ISSVTWSDDDCHVSIGKSDGNTEIWDV-- 320

Query: 143 AGEEYECISVLQEHSQDVKHVVWHTK--HNLLASSSYDDTVRIWKDYDDDWECAAVLTGH 200
                E +S+++     +   +        L+A  +    ++I  D        +    H
Sbjct: 321 -----ETMSLVRTMRSGLGVRIGSQSWLDTLVACGTKSGEIQI-NDVRIKNHIVSAWQEH 374

Query: 201 EGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGV 260
            G + C   S  +D ++L SGS+D++V +W    D      ++V  +     H + +  +
Sbjct: 375 SGEV-CG-LSYRKDGLQLASGSNDNSVMIW----DTRTSMPQFVKRN-----HTAAVKAI 423

Query: 261 AWSPSGRIASVGADGVLAVYKEKQNDSEVSEWEIS--ATYKAAHTVYEINTVKW-----V 313
           +W P   + ++ A G        Q D  +  W  +  A   + +T  ++++++W      
Sbjct: 424 SWCPD--VPNLLATG------GGQTDKYIHFWNTTTGARVSSINTGSQVSSLQWGQSYNG 475

Query: 314 NIDGKEMLITAGD 326
           +I  +E++ T G+
Sbjct: 476 DIMNREIVATGGN 488

>Scas_585.8
          Length = 460

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 78/188 (41%), Gaps = 21/188 (11%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGI 117
           H  AV  + +    D + +G  D  I IW Q + ++ +    E E       H   ++ I
Sbjct: 130 HDSAVSCIQYSHAGDWMCSGDADGGIKIW-QPNFNMVK----EFE-----NAHTECIRDI 179

Query: 118 SWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSY 177
           S+S +     TCS D  + IW       E      L  H  D+K   WH +  L+ S+S 
Sbjct: 180 SFSNNDSKFVTCSDDNVLKIWNFSNGQVE----RTLSGHHWDIKSCDWHPEMGLIVSASK 235

Query: 178 DDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDE 237
           D+ V++W       +C + +   + T+  + F      + L + S D + RV+    D  
Sbjct: 236 DNLVKLWDPRSG--QCISTIIKFKHTVLKTRFQPTRGNL-LAAISKDKSCRVF----DIR 288

Query: 238 DDQQEWVC 245
              +E +C
Sbjct: 289 HSMKELMC 296

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/216 (21%), Positives = 79/216 (36%), Gaps = 57/216 (26%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGK-ENLLDVLDDTVHKKAVRSVAWRPH 70
           H + +  I F        T S D  +K+    NG+ E  L     + H   ++S  W P 
Sbjct: 172 HTECIRDISFSNNDSKFVTCSDDNVLKIWNFSNGQVERTL-----SGHHWDIKSCDWHPE 226

Query: 71  SDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCS 130
             L+ + S D+ + +W     D   G  +      II+     +K       G LLA  S
Sbjct: 227 MGLIVSASKDNLVKLW-----DPRSGQCIS----TIIKFKHTVLKTRFQPTRGNLLAAIS 277

Query: 131 RDKSVWIWETDEAGEEYECIS-------------------------------VLQE---- 155
           +DKS  +++   + +E  C+                                +LQ+    
Sbjct: 278 KDKSCRVFDIRHSMKELMCVRDEVDYMTLTWNPINESMFTVGNYDGAMKYFDLLQDLEGP 337

Query: 156 -------HSQDVKHVVWHTKHNLLASSSYDDTVRIW 184
                  H + V  + ++   N+LAS+S D T+R W
Sbjct: 338 SHVIPYAHDKCVTSMAYNPAGNILASASKDRTIRFW 373

 Score = 37.7 bits (86), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 1/63 (1%)

Query: 27  LLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHSDLLAAGSFDSTISIW 86
           +   G+ D A+K   L    E    V+    H K V S+A+ P  ++LA+ S D TI  W
Sbjct: 315 MFTVGNYDGAMKYFDLLQDLEGPSHVIP-YAHDKCVTSMAYNPAGNILASASKDRTIRFW 373

Query: 87  TQS 89
           T++
Sbjct: 374 TRA 376

>Kwal_14.1710
          Length = 574

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 91/194 (46%), Gaps = 25/194 (12%)

Query: 98  KLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHS 157
           +++  +++  E H+ EV GI++  DG  LA+ S D +V IW+T  +  ++    + ++H+
Sbjct: 349 RIKNHIVSTWEEHKGEVCGIAYRPDGLQLASGSNDNTVAIWDTRTSLPQH----IKRQHT 404

Query: 158 QDVKHVVWHTK-HNLLASSS--YDDTVRIWKDYDDDWECAAVLTG------HEGTIWCSD 208
             VK + W     NLLA+     D  +  W +        ++ TG      H G  + S+
Sbjct: 405 AAVKALAWSPDISNLLATGGGQTDKHIHFW-NTTTGARTGSINTGSQVSSLHWGQSYNSN 463

Query: 209 FSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRI 268
             + E  I    G  ++ V ++ Y      D +  V E  + +AH ++I     SP G +
Sbjct: 464 AIQRE--IVATGGIPENAVSIYNY------DTKFKVAE--IVHAHEARICSSQLSPDGTV 513

Query: 269 -ASVGADGVLAVYK 281
            A+VG D  L  YK
Sbjct: 514 LATVGGDENLKFYK 527

>Scas_719.52
          Length = 628

 Score = 51.6 bits (122), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 67/293 (22%), Positives = 126/293 (43%), Gaps = 44/293 (15%)

Query: 9   LKLHNDKVWSIDFEPVRG-LLATGSTDRAIKV------------LQLKNGKENLLDVLDD 55
            + H  +V   DF+P    ++A+ S D  I +            L      +N+  V   
Sbjct: 77  FRGHTAQVLDTDFDPFNDHIIASSSDDSKIGIWKIPEDYSFQHYLDPDGEPKNIKPVKFL 136

Query: 56  TVHKKAVRSVAWRPHS-DLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEV 114
           + H + V  V + P + ++LA+ S D T+ +W     ++E G  +      I   H + V
Sbjct: 137 SGHSRKVGHVLFHPVAENVLASSSLDYTVKLW-----NIETGEAV------ITLKHPDMV 185

Query: 115 KGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHS-QDVKHVVWHTKHNLLA 173
             +S+S  G  LAT  RDK + +W+  E     + +S    H+    + VVW    + LA
Sbjct: 186 TSMSFSYGGNHLATVCRDKKLRVWDIREG----KIVSEGPAHAGAKNQRVVWLGNSDRLA 241

Query: 174 SSSY----DDTVRIWKDYD-DDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVR 228
           ++ +    D  + IW  ++ +  +     T  + +     F  + + I   +G  D  +R
Sbjct: 242 TTGFSRLSDRQIGIWDAFNLEKGDLGGFYTVDQSSGILMPFYDDGNKILYLAGKGDGNIR 301

Query: 229 VWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYK 281
            +++  D+  +  E+  +ST   A R    G A +P  R+ ++  + VL  +K
Sbjct: 302 YYEFQNDELFELSEF--QST--EAQR----GFAVAPK-RMVNIKENEVLKCFK 345

>ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH]
           complement(375532..376881) [1350 bp, 449 aa]
          Length = 449

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 59/256 (23%), Positives = 96/256 (37%), Gaps = 57/256 (22%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGI 117
           H  AV  + +    D L +G  D TI IW Q + ++ +          +   H   ++ I
Sbjct: 120 HDSAVTVMQYSHAGDWLISGDADGTIKIW-QPNFNMVK---------VLDRAHTECMRDI 169

Query: 118 SWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSY 177
           S+S       TCS D  + IW      +E     VL  H  DVK   WH K  L+ S S 
Sbjct: 170 SFSYSDQKFVTCSDDNVLKIWNFSNGQQE----RVLSGHHWDVKSCDWHPKMGLIVSGSK 225

Query: 178 DDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW------- 230
           D+ +++W D       + +L G + T+  + F   +  + L   S D +++++       
Sbjct: 226 DNLIKLW-DPRTGRNVSTIL-GLKHTVIKTKFQPTQGNL-LAVVSKDKSIKIYDMRQHMR 282

Query: 231 --KYIGDD-------------------------------EDDQQEWVCESTLPNAHRSQI 257
             + I DD                                D+        T+P AH   +
Sbjct: 283 ELQTIRDDMDYMSLSWHPINETIFSVGCYNGAIKHFDLLHDNSNSTPACHTIPYAHEKSV 342

Query: 258 YGVAWSPSGRIASVGA 273
             +A+SP G I +  A
Sbjct: 343 TSLAYSPVGHILASAA 358

 Score = 47.4 bits (111), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 36/173 (20%), Positives = 77/173 (44%), Gaps = 20/173 (11%)

Query: 59  KKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGIS 118
           K  + ++ W P    L   ++    S+W  S  + E          +I++ H++ V  + 
Sbjct: 79  KHVIPAITWTPEGRRLVVATYSGEFSLWNGSSFNFE----------SIMQAHDSAVTVMQ 128

Query: 119 WSQDGCLLATCSRDKSVWIWETDEAGEEYECISVL-QEHSQDVKHVVWHTKHNLLASSSY 177
           +S  G  L +   D ++ IW+ +     +  + VL + H++ ++ + +        + S 
Sbjct: 129 YSHAGDWLISGDADGTIKIWQPN-----FNMVKVLDRAHTECMRDISFSYSDQKFVTCSD 183

Query: 178 DDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
           D+ ++IW   +   E   VL+GH   +   D+  +   I   SGS D+ +++W
Sbjct: 184 DNVLKIWNFSNGQQE--RVLSGHHWDVKSCDWHPKMGLI--VSGSKDNLIKLW 232

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 85/185 (45%), Gaps = 18/185 (9%)

Query: 4   QLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVR 63
           Q  + L  H+  V S D+ P  GL+ +GS D  IK+   + G+ N+  +L     K  V 
Sbjct: 196 QQERVLSGHHWDVKSCDWHPKMGLIVSGSKDNLIKLWDPRTGR-NVSTILG---LKHTVI 251

Query: 64  SVAWRP-HSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQ- 121
              ++P   +LLA  S D +I I+     D+ +  +   EL  I +  + +   +SW   
Sbjct: 252 KTKFQPTQGNLLAVVSKDKSIKIY-----DMRQHMR---ELQTIRD--DMDYMSLSWHPI 301

Query: 122 DGCLLATCSRDKSVWIWET--DEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDD 179
           +  + +    + ++  ++   D +     C ++   H + V  + +    ++LAS++ D 
Sbjct: 302 NETIFSVGCYNGAIKHFDLLHDNSNSTPACHTIPYAHEKSVTSLAYSPVGHILASAAKDR 361

Query: 180 TVRIW 184
           T+R W
Sbjct: 362 TIRFW 366

 Score = 32.3 bits (72), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 44/115 (38%), Gaps = 46/115 (40%)

Query: 21  FEPVRG-LLATGSTDRAIKVLQLK---------------------------------NGK 46
           F+P +G LLA  S D++IK+  ++                                 NG 
Sbjct: 255 FQPTQGNLLAVVSKDKSIKIYDMRQHMRELQTIRDDMDYMSLSWHPINETIFSVGCYNGA 314

Query: 47  ENLLDVLDDT------------VHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQS 89
               D+L D              H+K+V S+A+ P   +LA+ + D TI  W +S
Sbjct: 315 IKHFDLLHDNSNSTPACHTIPYAHEKSVTSLAYSPVGHILASAAKDRTIRFWARS 369

>KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777.1
           Kluyveromyces lactis CRN1 homologue, start by similarity
          Length = 707

 Score = 51.2 bits (121), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 70/296 (23%), Positives = 126/296 (42%), Gaps = 50/296 (16%)

Query: 9   LKLHNDKVWSIDFEPVRG-LLATGSTDRAIKVLQL------------KNGKENLLDVLDD 55
            + H  +V   DF P    ++A+GS D  I + ++            +   ++L  V   
Sbjct: 89  FRGHTAQVLDTDFSPFNDHIVASGSDDGKIGIWEIPEDYGLHEYVDEEGNPKDLKPVRML 148

Query: 56  TVHKKAVRSVAWRPHS-DLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEV 114
           + H + V  + + P + ++LA+ S D T+ IW   D+  EE  K  ++       H + V
Sbjct: 149 SGHSRKVGHLLFHPLAENILASSSLDYTVKIW---DISQEE-VKFTLK-------HPDMV 197

Query: 115 KGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHS-QDVKHVVWHTKHNLLA 173
             +S+S DG  L T SRDK + +W+        + +S    HS    + VVW    + +A
Sbjct: 198 TSMSFSYDGKHLVTVSRDKKLRVWDV----RAEKIVSEGPAHSGAKNQRVVWLGDTDKVA 253

Query: 174 SSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSD--------FSKEEDPIRLCSGSDDS 225
           ++ +    R+       W+   +  G+ G  +  D        F  + + I   +G  D 
Sbjct: 254 TTGFS---RLSDRQIGVWDAFNLEKGNLGGFYNVDQSSGILMPFYDDSNRILYVAGKGDG 310

Query: 226 TVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYK 281
            +R +++  D+  +  E+  +ST P        G A +P  R  +V  + VL  YK
Sbjct: 311 NIRYFEFQNDELYELSEY--QSTEPQR------GFAVAPK-RSVNVKENEVLKAYK 357

>KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP 52 KD protein, start
           by similarity
          Length = 459

 Score = 50.4 bits (119), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 66/159 (41%), Gaps = 16/159 (10%)

Query: 65  VAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGC 124
           V   P +  + + SFD T   W   D        ++   + I EGH  EV  +S+  DG 
Sbjct: 269 VRCHPCNSFIGSTSFDKT---WILID-------TVKQAPILIQEGHSAEVFSLSFHNDGS 318

Query: 125 LLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIW 184
           L++T   D    IW+        + I  LQ HS+ +  V W      LAS S D T+++W
Sbjct: 319 LVSTAGLDAIALIWDIRSG----KNIMSLQGHSKPIYSVDWSQNGYQLASGSGDGTIKVW 374

Query: 185 KDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSD 223
            D         +L  H   +    F+K+     + SG D
Sbjct: 375 -DIRKKGNVETIL-AHNSIVSQVKFNKQNGGYLVSSGYD 411

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 65/144 (45%), Gaps = 17/144 (11%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGI 117
           H   V S+++     L++    D+   IW     D+  G  + M L    +GH   +  +
Sbjct: 304 HSAEVFSLSFHNDGSLVSTAGLDAIALIW-----DIRSGKNI-MSL----QGHSKPIYSV 353

Query: 118 SWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKH-NLLASSS 176
            WSQ+G  LA+ S D ++ +W+  + G     +  +  H+  V  V ++ ++   L SS 
Sbjct: 354 DWSQNGYQLASGSGDGTIKVWDIRKKGN----VETILAHNSIVSQVKFNKQNGGYLVSSG 409

Query: 177 YDDTVRIWKDYDDDWECAAVLTGH 200
           YD  V I+   D +W     L GH
Sbjct: 410 YDKKVNIFN--DGNWIKERSLEGH 431

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 60/280 (21%), Positives = 118/280 (42%), Gaps = 42/280 (15%)

Query: 56  TVHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVK 115
            + +K +  +   P  DL+A GS+   +S+   S   +     L             ++ 
Sbjct: 176 VIDEKPISEINTSPGGDLMACGSWSGNLSLVDNSLSKIYCNRSLS----------GTKIS 225

Query: 116 GISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASS 175
           G+ WS D   +  C+ D  + I+   ++G+E   + +L ++      V  H  ++ + S+
Sbjct: 226 GLDWSVDSKNIFVCTHDGRIVIY---DSGDE-TTVKILYKNDARFAQVRCHPCNSFIGST 281

Query: 176 SYDDTVRIWKDYDDDWECAAVLT-GHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIG 234
           S+D T   W   D   +   ++  GH   ++   F    D   + +   D+   +W    
Sbjct: 282 SFDKT---WILIDTVKQAPILIQEGHSAEVFSLSF--HNDGSLVSTAGLDAIALIW---- 332

Query: 235 DDEDDQQEWVCESTLPNAHRSQIYGVAWSPSG-RIASVGADGVLAVYK-EKQNDSEVSEW 292
               D +      +L   H   IY V WS +G ++AS   DG + V+   K+ + E    
Sbjct: 333 ----DIRSGKNIMSL-QGHSKPIYSVDWSQNGYQLASGSGDGTIKVWDIRKKGNVE---- 383

Query: 293 EISATYKAAHTVYEINTVKWVNIDGKEMLITAGDDGRVNL 332
               T  A +++  ++ VK+   +G   L+++G D +VN+
Sbjct: 384 ----TILAHNSI--VSQVKFNKQNGG-YLVSSGYDKKVNI 416

>Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement
          Length = 760

 Score = 50.8 bits (120), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 61/133 (45%), Gaps = 22/133 (16%)

Query: 58  HKKAVRSVAWRPH-SDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKG 116
           H+  V  VA+ P   +  A+   D T+ IW+      ++     M          +E +G
Sbjct: 21  HEHFVMCVAFNPKDPNTFASACLDHTVKIWSLG----QQSPNFTMT--------AHETRG 68

Query: 117 ISWS-----QDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNL 171
           +++      QD   L T S D+SV IW+     +   C++ L+ H  +V + ++H    +
Sbjct: 69  VNFVDYYPLQDKPYLITSSDDRSVKIWDY----QTKSCVATLEGHMANVSYAIFHPSLPI 124

Query: 172 LASSSYDDTVRIW 184
           + S S D TV+IW
Sbjct: 125 IISGSEDGTVKIW 137

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 63/148 (42%), Gaps = 19/148 (12%)

Query: 135 VWIWETDEAGEEYECISVLQEHSQDVKHVVWHTK-HNLLASSSYDDTVRIWKDYDDDWEC 193
           +W WE + A E+       + H   V  V ++ K  N  AS+  D TV+IW         
Sbjct: 5   LWNWEKNWALEQ-----TFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSL--GQQSP 57

Query: 194 AAVLTGHEGT-IWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNA 252
              +T HE   +   D+   +D   L + SDD +V++W Y        Q   C +TL   
Sbjct: 58  NFTMTAHETRGVNFVDYYPLQDKPYLITSSDDRSVKIWDY--------QTKSCVATL-EG 108

Query: 253 HRSQIYGVAWSPSGRIASVGA-DGVLAV 279
           H + +    + PS  I   G+ DG + +
Sbjct: 109 HMANVSYAIFHPSLPIIISGSEDGTVKI 136

 Score = 32.0 bits (71), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 40/88 (45%), Gaps = 10/88 (11%)

Query: 19  IDFEPV--RGLLATGSTDRAIKV--LQLKNGKENLLDVLDDTVHKKAVRSVAWRPHSDLL 74
           +D+ P+  +  L T S DR++K+   Q K+    L        H   V    + P   ++
Sbjct: 72  VDYYPLQDKPYLITSSDDRSVKIWDYQTKSCVATL------EGHMANVSYAIFHPSLPII 125

Query: 75  AAGSFDSTISIWTQSDLDLEEGAKLEME 102
            +GS D T+ IW  +   LE+   L +E
Sbjct: 126 ISGSEDGTVKIWNANTYKLEKTLNLGLE 153

>Scas_603.5
          Length = 589

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 98/236 (41%), Gaps = 39/236 (16%)

Query: 11  LHNDKVWSIDFEPVRGLLAT-GSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRP 69
           ++ D V  +DF+    +L T G  + +IKV  L+   +    V+D   H  +V  +   P
Sbjct: 292 VYTDTVTCLDFDLSTKMLYTAGKYNTSIKVWDLETNDQ----VMDLDDHIASVTCMQLHP 347

Query: 70  HSDLLAAGSFDSTISIWTQSDLDLEEGAKLEM-----ELLAIIEGHENEVKGISWSQDGC 124
            S  L  GS D+T+ +W   DL L     L+        +   E H  E+  +S+  D  
Sbjct: 348 DSKTLITGSKDATLKLW---DLGLAPQTSLDSTSNIDSCINTFEAHTAEITSVSY--DNE 402

Query: 125 LLATCSRDKSVWIWETDEAGEEYECISVLQ-----EHSQDVKHVVWHTKHNL---LASSS 176
            L + SRDKS+  W+         C+  L+         ++K        ++   LA+ S
Sbjct: 403 YLLSASRDKSIRQWDLTTGN----CVQTLEATLSHNSGTNIKDSTVEALQSVGAALATGS 458

Query: 177 YDDTVRIWKDYDDDWECAAV---LTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRV 229
            D  +R+W     D     V   L  H+G I    F    D  ++ +GS D+ + V
Sbjct: 459 KDGIIRLW-----DLRSGKVVRTLLKHQGPITSLQF----DSTKIITGSTDANISV 505

>AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH]
           (1146710..1147672) [963 bp, 320 aa]
          Length = 320

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 75/190 (39%), Gaps = 32/190 (16%)

Query: 55  DTVHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEV 114
           +T H + +  + W P S  +A+GS D T+ I             LE   L  + GH   V
Sbjct: 51  ETTHTEPINDICWSPDSACVASGSEDFTVEI-----------THLEYGRLHKLRGHSAPV 99

Query: 115 KGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHV-VWHTKHNLLA 173
             + ++  G LL T S D+S+  W+          +  +  HS  V  +        +L+
Sbjct: 100 LSVVFNCKGNLLCTASVDESIKQWDVLSG----TLLKTMSAHSDPVVSIDTPDCDATILS 155

Query: 174 SSSYDDTVRIWK----------DYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSD 223
           S SYD  +RI+            YD DW+        +G +  S      +   L   S 
Sbjct: 156 SGSYDGLIRIFDTESGHCLKTLTYDKDWQ------TDDGVVPISQVKFSRNGKFLLVRSL 209

Query: 224 DSTVRVWKYI 233
           D  V++W +I
Sbjct: 210 DGVVKLWDFI 219

>Scas_673.11
          Length = 434

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 56/241 (23%), Positives = 100/241 (41%), Gaps = 38/241 (15%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGI 117
           H  +V ++A  P   L+  G  D+   +WT              +    +EGH   V   
Sbjct: 68  HTDSVFTIAHHPTLPLVVTGGGDNVAHLWTSH--------SQPPKFAGTLEGHTESVVAS 119

Query: 118 SWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKH----NLLA 173
           +++ DG  L T      + + +++++G ++   S LQE    V+ VVW   H     + A
Sbjct: 120 AFTHDGQFLVTADMTGKIMVHKSNKSGSQWSLTSTLQE----VEEVVWLKCHPVISGVFA 175

Query: 174 SSSYDDTVRIWKDYDDDWECAAVLTG--HEGTIWCSDF---SKEEDPIRLCSGSDDSTVR 228
             + D +V  ++  D+D     +++G  H+      +F    + E+ + L + S DS++ 
Sbjct: 176 FGATDGSVWCYQINDNDGSVEQLMSGFIHQQDCTMGEFINIDQGENVLELVTCSVDSSIV 235

Query: 229 VWK--------YIGDDEDDQQE--WVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLA 278
            W          I  DE    E  WV  +  P+   +         SG IA+   +GVLA
Sbjct: 236 GWNCFTAQPTFKITKDEIKGLEAPWVSLAVAPSKMTN-------GNSGIIAAGANNGVLA 288

Query: 279 V 279
           +
Sbjct: 289 I 289

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 40/189 (21%), Positives = 73/189 (38%), Gaps = 21/189 (11%)

Query: 139 ETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLT 198
           ET E       ++   +H+  V  +  H    L+ +   D+   +W  +    + A  L 
Sbjct: 51  ETMEIDMANNSVAYFDKHTDSVFTIAHHPTLPLVVTGGGDNVAHLWTSHSQPPKFAGTLE 110

Query: 199 GHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIY 258
           GH  ++  S F+ +   +     + D T ++  +  +    Q  W   STL      ++ 
Sbjct: 111 GHTESVVASAFTHDGQFLV----TADMTGKIMVHKSNKSGSQ--WSLTSTL-----QEVE 159

Query: 259 GVAW---SP--SGRIASVGADGVLAVYKEKQNDSEVSEWEISATYKAAHTVYEINTVKWV 313
            V W    P  SG  A    DG +  Y+   ND  V +      ++   T+ E     ++
Sbjct: 160 EVVWLKCHPVISGVFAFGATDGSVWCYQINDNDGSVEQLMSGFIHQQDCTMGE-----FI 214

Query: 314 NIDGKEMLI 322
           NID  E ++
Sbjct: 215 NIDQGENVL 223

>ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH]
           complement(140589..143003) [2415 bp, 804 aa]
          Length = 804

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 61/276 (22%), Positives = 113/276 (40%), Gaps = 45/276 (16%)

Query: 58  HKKAVRSVAWR---PHSDLLAAGSFDSTISIW-TQSDLDLEEGAKLEMELL--------- 104
           H+  ++ +A+R   P   +LA+G+ D  I +W  +++ ++EE    +++LL         
Sbjct: 214 HEDWIKDLAFRSNGPGDWMLASGAQDRYIRLWRIKANNNIEEEDPTKLKLLSNKIYKFQV 273

Query: 105 -----------AIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVL 153
                      A+I GH++ +  + W +  C L   + D SV +WE DE    + C S L
Sbjct: 274 TADLHLSINFEALIMGHDDWISSLQWHESKCQLLAATADTSVMLWEPDEISGIWVCASRL 333

Query: 154 QEHSQDVKHV-----------VWHTKHN--LLASSSYDDTVRIWKDYDD--DWECAAVLT 198
            E S                 +W    +   + ++    + R+W++  D   WE    +T
Sbjct: 334 GEFSSKGASTATGSAGGFWSCLWFATGDAEYILANGKTGSWRMWENRGDGGSWEQLPAIT 393

Query: 199 GHEGTIWCSDFSKEEDPIRLCSGSDDSTVRV---WKYIGDDEDDQQEWVCESTLPNAHRS 255
           G   ++  +D +       L + S D T R+   W Y GD    +  W  E   P  H  
Sbjct: 394 GPTRSV--TDVAWSPSGSYLLASSLDQTTRLYTRWMYEGDGSRRKHTW-HEFARPQIHGY 450

Query: 256 QIYGVAWSPSGRIASVGADGVLAVYKEKQNDSEVSE 291
            +  +      +  S G + VL  + E +  +++ E
Sbjct: 451 DMICLEPISDTQFISAGDEKVLRSFNEPRAIAKLLE 486

 Score = 47.8 bits (112), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 77/347 (22%), Positives = 134/347 (38%), Gaps = 100/347 (28%)

Query: 8   SLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKEN--LLDVLDDTVHKKAVRSV 65
           +LK HN +V S+ F     LL + S D  I V +   G E   L   L+    K +V S+
Sbjct: 74  TLKAHNAEVTSVKFIGAEKLLVSASADATINVWR---GDERWELAQTLEGP--KSSVTSL 128

Query: 66  AWRPHSDLLAAGSFDSTISIWTQSD-------------------LDLEE----------- 95
           A    + L+ AG  D T+S+W++ D                   L L++           
Sbjct: 129 A--VAAGLIVAGFADGTLSVWSEHDDAFVLSSQFLIRKGFLPLALALQKLSDGCYMLAVS 186

Query: 96  -------------GAKLEMELLAIIEGHENEVKGISWSQDGC---LLATCSRDKSVWIWE 139
                         A +++EL A +EGHE+ +K +++  +G    +LA+ ++D+ + +W 
Sbjct: 187 GTSTDLMVYSVCVAATVDVELSATVEGHEDWIKDLAFRSNGPGDWMLASGAQDRYIRLWR 246

Query: 140 T-------DEAGEEYECIS--------------------VLQEHSQDVKHVVWHTKHNLL 172
                   +E   + + +S                    ++  H   +  + WH     L
Sbjct: 247 IKANNNIEEEDPTKLKLLSNKIYKFQVTADLHLSINFEALIMGHDDWISSLQWHESKCQL 306

Query: 173 ASSSYDDTVRIWK--DYDDDWECAAVL-----------TGHEGTIWCSDFSKEEDPIRLC 219
            +++ D +V +W+  +    W CA+ L           TG  G  W   +    D   + 
Sbjct: 307 LAATADTSVMLWEPDEISGIWVCASRLGEFSSKGASTATGSAGGFWSCLWFATGDAEYIL 366

Query: 220 SGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSG 266
           +     + R+W+  GD       W     +    RS +  VAWSPSG
Sbjct: 367 ANGKTGSWRMWENRGDG----GSWEQLPAITGPTRS-VTDVAWSPSG 408

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 92/240 (38%), Gaps = 27/240 (11%)

Query: 107 IEGHENEVKGISWSQDGCLLATCSRDKS-----VWIWETDEAGEEYECISVLQEHSQDVK 161
           + GH  E+  +  S DG LLA+  +  +     V I+ T    +   C    + H+  + 
Sbjct: 567 LYGHGYEISCVDVSPDGKLLASACKSNNTSHAVVRIFSTHTWLQLPPCP---EFHNLTIT 623

Query: 162 HVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAV--LTGHEGTIWCSDFSKEEDPIRLC 219
            + +   +  L S S D    +W   DDD           H   IW  D+          
Sbjct: 624 RLRFSKDNRHLLSVSRDRMWAVWYRNDDDTFTLKYSDQKPHSRIIWDGDWLPASCGTAFV 683

Query: 220 SGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPS---GR-IASVGAD- 274
           + S D TV++W+  G     +  +  ES L    +  I  VA +P    GR + + G + 
Sbjct: 684 TASRDKTVKIWRLDG----QEGRFEVESNL--KLKEAITAVAVTPRLIEGRLLLAFGLES 737

Query: 275 GVLAVYKEKQNDSEVSEWEISATYKAAHTVYEINTVKWVNIDGKE--MLITAGDDGRVNL 332
           G + +Y      SE +  ++     A      IN ++W     KE  ML  A  D  V +
Sbjct: 738 GAVHIYTY----SERAFLQVLQLDSAIAPADRINRIRWNPAHHKENIMLSVASADSSVRI 793

>Sklu_2420.2 YPL151C, Contig c2420 3924-5249
          Length = 441

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 60/179 (33%), Positives = 81/179 (45%), Gaps = 29/179 (16%)

Query: 58  HKKAVRSVAWRP-HSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKG 116
           H   VR+VA  P  ++  A GS D+TI IW     DL  G KL++ L     GH   VK 
Sbjct: 128 HNGWVRTVAVDPIDNEWFATGSNDTTIKIW-----DLATG-KLKLTL----SGHIMTVKD 177

Query: 117 ISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSS 176
           I  S+    + + S DK V  W+     E+   I     H   V  V  H   NL+A++ 
Sbjct: 178 ICISKRHPYMFSASEDKLVKCWDL----EKNRVIRDYHGHLSGVHTVDIHPTLNLIATAG 233

Query: 177 YDDTVRIWKDYDDDWECAAVLT--GHEGTI---WCSDFSKEEDPIRLCSGSDDSTVRVW 230
            D  VR+W    D      V+T  GH+  I    C       DP ++ S S D+TVR+W
Sbjct: 234 RDSVVRLW----DIRTKLPVMTMAGHKSPINRVKCLPV----DP-QVVSCSADATVRLW 283

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 63/272 (23%), Positives = 109/272 (40%), Gaps = 62/272 (22%)

Query: 2   PLQLAKSLKLHNDKVWSIDFEPVRGL-LATGSTDRAIKVLQLKNGKENL------LDVLD 54
           P +L + +  HN  V ++  +P+     ATGS D  IK+  L  GK  L      + V D
Sbjct: 118 PWKLMRVINGHNGWVRTVAVDPIDNEWFATGSNDTTIKIWDLATGKLKLTLSGHIMTVKD 177

Query: 55  DTVHKK--------------------------------AVRSVAWRPHSDLLAAGSFDST 82
             + K+                                 V +V   P  +L+A    DS 
Sbjct: 178 ICISKRHPYMFSASEDKLVKCWDLEKNRVIRDYHGHLSGVHTVDIHPTLNLIATAGRDSV 237

Query: 83  ISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDE 142
           + +W     D+    KL +  +A   GH++ +  +        + +CS D +V +W+   
Sbjct: 238 VRLW-----DIR--TKLPVMTMA---GHKSPINRVKCLPVDPQVVSCSADATVRLWDI-T 286

Query: 143 AGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGH-- 200
           AG   + + VL  H + V+ +  H     ++S+  DD +R WK  +       +LT    
Sbjct: 287 AG---KTLKVLTHHKRSVRDIGIHPGEFSISSACTDD-IRSWKLPE-----GQLLTNFQS 337

Query: 201 EGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKY 232
           E T   +  S  +D + L +GSD+  +  + Y
Sbjct: 338 EKTGIINTLSINQDDV-LFAGSDNGVLSFYDY 368

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 60/268 (22%), Positives = 102/268 (38%), Gaps = 59/268 (22%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHS 71
           H   V ++D  P   L+AT   D  +++  ++      L V+    HK  +  V   P  
Sbjct: 213 HLSGVHTVDIHPTLNLIATAGRDSVVRLWDIRTK----LPVMTMAGHKSPINRVKCLPVD 268

Query: 72  DLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQ-DGCLLATCS 130
             + + S D+T+ +W     D+  G  L+     ++  H+  V+ I     +  + + C+
Sbjct: 269 PQVVSCSADATVRLW-----DITAGKTLK-----VLTHHKRSVRDIGIHPGEFSISSACT 318

Query: 131 RDKSVWIWE-----TDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWK 185
            D   W        T+   E+   I+ L  +  DV          L A S  D+ V  + 
Sbjct: 319 DDIRSWKLPEGQLLTNFQSEKTGIINTLSINQDDV----------LFAGS--DNGVLSFY 366

Query: 186 DYD--------DDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDE 237
           DY         D  E    L    G I  S F  ++  +RL +G  D ++++WK    D+
Sbjct: 367 DYKTGHKYQQLDTTEIPGSLESERG-ILTSTF--DQTGLRLITGESDKSIKIWK---QDQ 420

Query: 238 DDQQEWVCESTLPNAHRSQIYGVAWSPS 265
           D   E                G+ W+PS
Sbjct: 421 DATPETYT-------------GLPWNPS 435

>KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomyces
           cerevisiae YLR222c, start by similarity
          Length = 814

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 73/292 (25%), Positives = 121/292 (41%), Gaps = 30/292 (10%)

Query: 1   MPLQLAKSLKLHNDKVWSIDFEPVRGL-LATGSTDRAIKVLQLKNGKENLLDVLDDTVHK 59
            P+++ K  + H D + S+D     GL +AT S D ++ + +     E+         H 
Sbjct: 379 FPIEV-KMYEGHTDLLNSLD-ATADGLWVATASKDHSVILWRYHAKYEDFYPYTKFVGHV 436

Query: 60  KAVRSVAW---RPHS--DLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLA--IIEGHEN 112
            +V +V      P S  + +   S D TI  W    +  +E   L +   +      HE 
Sbjct: 437 GSVNAVGLPNVMPRSWPEFIITASNDLTIKKWKVPKVTSDEPEDLILVKTSEYTRRAHEK 496

Query: 113 EVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLL 172
           ++  IS S +  L AT S DK+  IW  D+     E  + L  H + +  V +     LL
Sbjct: 497 DINAISISPNDSLFATASYDKTCKIWNLDDG----EFQATLANHKRGLWDVAFCQYDKLL 552

Query: 173 ASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIW-CSDFSKEEDPIRLCSGSDDSTVRVWK 231
           A+ S D T++IW    + +     L GH   +  CS  +K +   +L S   D  V +W 
Sbjct: 553 ATCSGDKTIKIWS--LESYAVVKTLEGHTNAVQRCSFINKNK---QLISTGADGLVIIW- 606

Query: 232 YIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGR-IASVGADGVLAVYKE 282
                  D        TL +AH ++I+ +A    G    +  ADG    +++
Sbjct: 607 -------DLSTGESVKTL-DAHNNRIWALAVMNDGESFVTADADGFFEFWRD 650

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 56/274 (20%), Positives = 101/274 (36%), Gaps = 74/274 (27%)

Query: 69  PHSDLLAAGSFDSTISIW---TQSDLDLEEGAKLEMELLAI--IEGHENEVKGISWSQDG 123
           P  D LA  +   T+ I    T S+ + E G   E   + +   EGH + +  +  + DG
Sbjct: 343 PKRDKLALATNSPTLRIIPTPTSSEEEFENGENKETFPIEVKMYEGHTDLLNSLDATADG 402

Query: 124 CLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVK-----HVVWHTKHNLLASSSYD 178
             +AT S+D SV +W      E++   +    H   V      +V+  +    + ++S D
Sbjct: 403 LWVATASKDHSVILWRYHAKYEDFYPYTKFVGHVGSVNAVGLPNVMPRSWPEFIITASND 462

Query: 179 DTVRIWK--------------------------------------------DYD------ 188
            T++ WK                                             YD      
Sbjct: 463 LTIKKWKVPKVTSDEPEDLILVKTSEYTRRAHEKDINAISISPNDSLFATASYDKTCKIW 522

Query: 189 --DDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCE 246
             DD E  A L  H+  +W   F + +  +  CSG  D T+++W          + +   
Sbjct: 523 NLDDGEFQATLANHKRGLWDVAFCQYDKLLATCSG--DKTIKIWSL--------ESYAVV 572

Query: 247 STLPNAHRSQIYGVAW-SPSGRIASVGADGVLAV 279
            TL   H + +   ++ + + ++ S GADG++ +
Sbjct: 573 KTL-EGHTNAVQRCSFINKNKQLISTGADGLVII 605

 Score = 33.9 bits (76), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 61/145 (42%), Gaps = 15/145 (10%)

Query: 4   QLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVR 63
           +   +L  H   +W + F     LLAT S D+ IK+  L++    ++  L+   H  AV+
Sbjct: 528 EFQATLANHKRGLWDVAFCQYDKLLATCSGDKTIKIWSLESYA--VVKTLEG--HTNAVQ 583

Query: 64  SVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDG 123
             ++   +  L +   D  + IW     DL  G     E +  ++ H N +  ++   DG
Sbjct: 584 RCSFINKNKQLISTGADGLVIIW-----DLSTG-----ESVKTLDAHNNRIWALAVMNDG 633

Query: 124 CLLATCSRDKSVWIWETDEAGEEYE 148
               T   D     W  D + EE+E
Sbjct: 634 ESFVTADADGFFEFWR-DNSEEEHE 657

>CAGL0C00737g complement(75028..77478) similar to tr|Q05946
           Saccharomyces cerevisiae YLR222c, hypothetical start
          Length = 816

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 61/264 (23%), Positives = 105/264 (39%), Gaps = 27/264 (10%)

Query: 28  LATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAW-----RPHSDLLAAGSFDST 82
           LAT S D+   +    N  +          H  +V +V       + +   +   S D T
Sbjct: 405 LATASKDKTAILWHWNNTSKRFYIYATFVGHAASVSAVCLPNVMEKNYPKYIITASNDLT 464

Query: 83  ISIWTQSDL--DLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWET 140
           +  W    +  DL E   +    +     HE ++  IS + +  + AT S DK+  +W  
Sbjct: 465 VKKWEIPPMKNDLNEVPFIVKSSIYTRHAHEKDINAISMAPNDSIFATASYDKTCKLWNV 524

Query: 141 DEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGH 200
           D      E ++ L  H + +  V +      +A+ S D TV+IW    + +     L GH
Sbjct: 525 DTG----EPVATLANHKRGLWDVSFCESEKWIATCSGDKTVKIWS--LESFTVLKTLEGH 578

Query: 201 EGTIW-CSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYG 259
              +  CS  +K++   +L S   D  ++VW     D        C   L + H ++I+ 
Sbjct: 579 TNAVQRCSFMNKQK---QLVSAGADGLIKVWDIASGD--------CIKNL-DGHSNRIWA 626

Query: 260 VAWSPSG-RIASVGADGVLAVYKE 282
           ++    G  I S  AD V   +K+
Sbjct: 627 LSVLEDGDLIISADADSVFQFWKD 650

 Score = 36.6 bits (83), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 47/232 (20%), Positives = 85/232 (36%), Gaps = 69/232 (29%)

Query: 106 IIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDV----- 160
           + EGH + +  ++ ++DG  LAT S+DK+  +W  +   + +   +    H+  V     
Sbjct: 385 LYEGHSDLLNSLACTEDGQWLATASKDKTAILWHWNNTSKRFYIYATFVGHAASVSAVCL 444

Query: 161 KHVVWHTKHNLLASSSYDDTVRIWK----------------------------------- 185
            +V+       + ++S D TV+ W+                                   
Sbjct: 445 PNVMEKNYPKYIITASNDLTVKKWEIPPMKNDLNEVPFIVKSSIYTRHAHEKDINAISMA 504

Query: 186 ---------DYD--------DDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVR 228
                     YD        D  E  A L  H+  +W   F + E  I  CSG  D TV+
Sbjct: 505 PNDSIFATASYDKTCKLWNVDTGEPVATLANHKRGLWDVSFCESEKWIATCSG--DKTVK 562

Query: 229 VWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAW-SPSGRIASVGADGVLAV 279
           +W          + +    TL   H + +   ++ +   ++ S GADG++ V
Sbjct: 563 IWSL--------ESFTVLKTL-EGHTNAVQRCSFMNKQKQLVSAGADGLIKV 605

 Score = 33.9 bits (76), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 57/132 (43%), Gaps = 14/132 (10%)

Query: 8   SLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAW 67
           +L  H   +W + F      +AT S D+ +K+  L++    +L  L+   H  AV+  ++
Sbjct: 532 TLANHKRGLWDVSFCESEKWIATCSGDKTVKIWSLESF--TVLKTLEG--HTNAVQRCSF 587

Query: 68  RPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLA 127
                 L +   D  I +W     D+  G     + +  ++GH N +  +S  +DG L+ 
Sbjct: 588 MNKQKQLVSAGADGLIKVW-----DIASG-----DCIKNLDGHSNRIWALSVLEDGDLII 637

Query: 128 TCSRDKSVWIWE 139
           +   D     W+
Sbjct: 638 SADADSVFQFWK 649

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 33/164 (20%), Positives = 70/164 (42%), Gaps = 27/164 (16%)

Query: 5   LAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRS 64
           + +SLK+ +   + +  +P   L+A G TD +I V+ ++NG            H      
Sbjct: 96  ITRSLKVSSPS-YVMTCDPTSTLVAIGGTDGSITVIDIENGY---------IAH------ 139

Query: 65  VAWRPHSDLLAAGSFDSTI--SIWTQSDLDLEEGAK----LEMELLAIIEGHENEVKGIS 118
            +++ H   +++  F   +  +IW     D    AK    +  +    ++ H + ++GI 
Sbjct: 140 -SFKGHGGTISSLKFYGELGTNIWLLGSGDTNGMAKVWDLVTRKCKFTVQEHSSAIRGID 198

Query: 119 WS----QDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQ 158
           ++    +D   L T  RD  + +W  +  G+  + +  +  H Q
Sbjct: 199 FTKNDDKDVLNLITGGRDNVLNLWRFNIKGKSSKLVKTIPAHLQ 242

>Scas_721.7
          Length = 325

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 75/187 (40%), Gaps = 33/187 (17%)

Query: 56  TVHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVK 115
           T H   +  VAW P +  LA+ S D TI I             L    L  + GH   V 
Sbjct: 54  TSHVAPISEVAWSPDNQCLASASDDFTIEI-----------THLTHGCLHRLMGHTAPVI 102

Query: 116 GISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDV--KHVVWHTKHNLLA 173
            ++++  G LL T S D+S+ IW+T         +  +  HS+ V    +      ++LA
Sbjct: 103 SLTYNDSGNLLFTSSMDESIKIWDTFHGA----ILKTISAHSESVVSLSICPDRDSSVLA 158

Query: 174 SSSYDDTVRIWK----------DYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSD 223
           S S+D  +R++            YD DW+        +G +  S      +   L   S 
Sbjct: 159 SGSFDGLIRLFDTRTGHCLKTLTYDKDWK------SDDGVVPISQVRFSPNGKFLLVSSF 212

Query: 224 DSTVRVW 230
           D  V++W
Sbjct: 213 DGIVKIW 219

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 80/183 (43%), Gaps = 25/183 (13%)

Query: 106 IIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVW 165
           I   H   +  ++WS D   LA+ S D ++ I           C+  L  H+  V  + +
Sbjct: 52  IPTSHVAPISEVAWSPDNQCLASASDDFTIEITHLTHG-----CLHRLMGHTAPVISLTY 106

Query: 166 HTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDS 225
           +   NLL +SS D++++IW  +         ++ H  ++       + D   L SGS D 
Sbjct: 107 NDSGNLLFTSSMDESIKIWDTFHG--AILKTISAHSESVVSLSICPDRDSSVLASGSFDG 164

Query: 226 TVRVW--------KYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGA-DGV 276
            +R++        K +  D+D + +   +  +P      I  V +SP+G+   V + DG+
Sbjct: 165 LIRLFDTRTGHCLKTLTYDKDWKSD---DGVVP------ISQVRFSPNGKFLLVSSFDGI 215

Query: 277 LAV 279
           + +
Sbjct: 216 VKI 218

>CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces
           cerevisiae YJL112w MDV1, hypothetical start
          Length = 711

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 64/253 (25%), Positives = 105/253 (41%), Gaps = 44/253 (17%)

Query: 4   QLAKSLKLHNDKVWSIDFEPVRGLLAT-GSTDRAIKVLQLKNGKENLLDVLDDTVHKKAV 62
           +L+   K H+D +  +DF+P    L T G  D  +K+      K+  +  ++   H   +
Sbjct: 395 KLSTIPKAHDDAITCLDFDPHFSTLCTAGYMDHIVKLWDYT--KKRQIGAMEG--HVATI 450

Query: 63  RSVAWRPHSDLLAAGSFDSTISIWTQSDL--DLEEGAKLEMELLAIIEGHENEVKGISWS 120
             +    + +++A GS D+T+ +W  +D+    EEG     E L  ++ H +EV  +   
Sbjct: 451 SCMQVDKNYNMVATGSKDATVKLWNANDVIGRYEEGN--NSEALHTLDAHLDEVSSLYI- 507

Query: 121 QDGCLLATCSRDKSVWIWETDEAGEEYECISVL-----------------QEHSQDVKHV 163
            DG  L T S+DK++  W+        +CI V                   E S  +K V
Sbjct: 508 -DGANLMTASQDKTIRRWDLYSG----KCIQVFDVNFPSLSAYKSSFMKSNEDSMILKTV 562

Query: 164 ------VWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIR 217
                    +    LA+ + D  +R+W       E   VL GH   I    F    D   
Sbjct: 563 NTPIIGSIQSFDAALATGTKDGLIRLWDMR--TGEVVRVLEGHMDAITSLKF----DATT 616

Query: 218 LCSGSDDSTVRVW 230
           + SGS D T+R+W
Sbjct: 617 IISGSLDGTIRLW 629

>YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative
           spliceosomal protein with similarity to S. pombe prp5p,
           has four WD (WD-40) repeats [1356 bp, 451 aa]
          Length = 451

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 81/178 (45%), Gaps = 27/178 (15%)

Query: 62  VRSVAWRP-HSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWS 120
           VR VA  P  ++    GS D+T+ +W     DL  G     +L   + GH   V+ ++ S
Sbjct: 142 VRCVAIDPVDNEWFITGSNDTTMKVW-----DLATG-----KLKTTLAGHVMTVRDVAVS 191

Query: 121 QDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDT 180
                L + S DK+V  W+     E+ + I     H   V+ V  H   +L+A++  D  
Sbjct: 192 DRHPYLFSVSEDKTVKCWDL----EKNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSV 247

Query: 181 VRIWKDYDDDWECAAV-LTGHEGTI---WCSDFSKEEDPIRLCSGSDDSTVRVWKYIG 234
           +++W   D       + L GH+G I    C+      DP ++ S S D+TVR+W  + 
Sbjct: 248 IKLW---DMRTRIPVITLVGHKGPINQVQCTPV----DP-QVVSSSTDATVRLWDVVA 297

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 78/177 (44%), Gaps = 23/177 (12%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGI 117
           H   VR+V+  P  DL+A    DS I +W           +  + ++ ++ GH+  +  +
Sbjct: 223 HLSGVRTVSIHPTLDLIATAGRDSVIKLWDM---------RTRIPVITLV-GHKGPINQV 272

Query: 118 SWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSY 177
             +     + + S D +V +W+   AG   + + VL  H + V+    H K   +AS+  
Sbjct: 273 QCTPVDPQVVSSSTDATVRLWDV-VAG---KTMKVLTHHKRSVRATALHPKEFSVASACT 328

Query: 178 DDTVRIWKDYDDDWECAAVLTGHEG--TIWCSDFSKEEDPIRLCSGSDDSTVRVWKY 232
           DD +R W   +      ++LT  E   T   +  S  +D + L +G D+  +  + Y
Sbjct: 329 DD-IRSWGLAE-----GSLLTNFESEKTGIINTLSINQDDV-LFAGGDNGVLSFYDY 378

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 56/215 (26%), Positives = 87/215 (40%), Gaps = 25/215 (11%)

Query: 2   PLQLAKSLKLHNDKVWSIDFEPVRGL-LATGSTDRAIKVLQLKNGKENLLDVLDDTV--H 58
           P +L++ +  H   V  +  +PV      TGS D  +KV  L  GK      L  T+  H
Sbjct: 128 PWKLSRVINGHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLATGK------LKTTLAGH 181

Query: 59  KKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGIS 118
              VR VA       L + S D T+  W     DLE+      +++    GH + V+ +S
Sbjct: 182 VMTVRDVAVSDRHPYLFSVSEDKTVKCW-----DLEKN-----QIIRDYYGHLSGVRTVS 231

Query: 119 WSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYD 178
                 L+AT  RD  + +W+          +  L  H   +  V        + SSS D
Sbjct: 232 IHPTLDLIATAGRDSVIKLWDM----RTRIPVITLVGHKGPINQVQCTPVDPQVVSSSTD 287

Query: 179 DTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEE 213
            TVR+W       +   VLT H+ ++  +    +E
Sbjct: 288 ATVRLWDVVAG--KTMKVLTHHKRSVRATALHPKE 320

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 40/178 (22%), Positives = 66/178 (37%), Gaps = 55/178 (30%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRP-- 69
           H   +  +   PV   + + STD  +++  +  GK   + VL  T HK++VR+ A  P  
Sbjct: 265 HKGPINQVQCTPVDPQVVSSSTDATVRLWDVVAGKT--MKVL--THHKRSVRATALHPKE 320

Query: 70  ---------------------------------------HSDLLAAGSFDSTISIWTQSD 90
                                                    D+L AG  +  +S +    
Sbjct: 321 FSVASACTDDIRSWGLAEGSLLTNFESEKTGIINTLSINQDDVLFAGGDNGVLSFY---- 376

Query: 91  LDLEEGAKLE----MELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAG 144
            D + G K +     E++  +EG E  V   ++ + G  L T   DKS+ IW+ DE  
Sbjct: 377 -DYKSGHKYQSLATREMVGSLEG-ERSVLCSTFDKTGLRLITGEADKSIKIWKQDETA 432

>Kwal_33.15591
          Length = 714

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 69/159 (43%), Gaps = 23/159 (14%)

Query: 76  AGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSV 135
           +GS+D+T  +W Q  L  E            ++GH   V  +    +     T S D ++
Sbjct: 120 SGSWDTTAKVWFQGALKHE------------LKGHTASVWDVKMLPEVGFYMTASADGTI 167

Query: 136 WIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAA 195
            +WE ++  + +  +     H+  ++H+         AS S D TV+I    D + +   
Sbjct: 168 KLWEGEKVLKTFTGL-----HTDVIRHIDIDASGEKFASCSNDGTVKI---NDMEGKTLK 219

Query: 196 VLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIG 234
            L GHE  ++   F+   D I   S  +D TVR+WK  G
Sbjct: 220 TLVGHESFVYSVKFAPNGDVI---SCGEDRTVRIWKADG 255

 Score = 36.2 bits (82), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 53/237 (22%), Positives = 102/237 (43%), Gaps = 39/237 (16%)

Query: 102 ELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVK 161
           +L A + GHE +VK ++   +   +ATCSRD SV +W+        +  +V+ +  + V 
Sbjct: 7   KLSATLSGHEQDVKSVAVLNNDT-VATCSRDGSVRLWKKGHNNLWQD--AVVYQSDEFVN 63

Query: 162 HVVWHTKHNLLASSSYDDTVR----IWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIR 217
            + +     LL     +  +     +  D   D E   VL GHE  +   + S+      
Sbjct: 64  SLCYDNTSGLLFCGGQNCLINSVSPLLGDVGQDSEF--VLIGHENNVCVLNSSQG----Y 117

Query: 218 LCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPS-GRIASVGADGV 276
           + SGS D+T +VW + G  + + +           H + ++ V   P  G   +  ADG 
Sbjct: 118 VLSGSWDTTAKVW-FQGALKHELK----------GHTASVWDVKMLPEVGFYMTASADGT 166

Query: 277 LAVYKEKQNDSEVSEWEISATYKAAHTVYEINTVKWVNIDGK-EMLITAGDDGRVNL 332
           + +++ ++         +  T+   HT    + ++ ++ID   E   +  +DG V +
Sbjct: 167 IKLWEGEK---------VLKTFTGLHT----DVIRHIDIDASGEKFASCSNDGTVKI 210

>KLLA0E24508g complement(2175775..2176758) similar to sp|P38123
           Saccharomyces cerevisiae YBR175w, start by similarity
          Length = 327

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 75/188 (39%), Gaps = 32/188 (17%)

Query: 56  TVHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVK 115
           T HK+ +  + W P S  +A+GS D T+ I             +    +  + GH   V 
Sbjct: 66  TTHKECINCLCWSPDSKCIASGSEDFTVEI-----------THIIYGRIRRLMGHTAPVI 114

Query: 116 GISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHV-VWHTKHNLLAS 174
            I ++  G +L + S D+S+  W           +  +  HS  V  + +     ++L+S
Sbjct: 115 SICYNNKGNILCSSSMDESIKEWHVLSGTA----LKTMSAHSDAVVSIDIPKFDSSILSS 170

Query: 175 SSYDDTVRIWK----------DYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDD 224
            SYD  +RI+            YD DW         +G +  S      +   L   S D
Sbjct: 171 GSYDGLIRIFDTESGHCLKTLTYDKDW------IAEDGVVPISTVKFSRNGKFLLVKSLD 224

Query: 225 STVRVWKY 232
           + V++W+Y
Sbjct: 225 NVVKLWEY 232

>CAGL0B03575g complement(357525..358784) similar to sp|P39984
           Saccharomyces cerevisiae YEL056w HAT2, hypothetical
           start
          Length = 419

 Score = 47.8 bits (112), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 59/252 (23%), Positives = 112/252 (44%), Gaps = 22/252 (8%)

Query: 43  KNGKENLLDVLDDTVHKKAVRSVAWRPHSDL-LAAGSFDSTISIWTQSDLDLEEGAKLEM 101
           KNG E LL  L+   H +    +A+  +    L +GS DS I++W  S+ +      +  
Sbjct: 165 KNGVEALLSTLE--YHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITF 222

Query: 102 ELLAIIEGHENEVKGISW-SQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDV 160
           E     + H + +  + W S +  +  + S D ++ +++   +    + I  +       
Sbjct: 223 E-----DAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSS----QIIHNINTKKPYN 273

Query: 161 KHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCS 220
                    NL A++  D+ V ++ D  D       +TGHE  +   +F    D I   S
Sbjct: 274 TLAFSPFSSNLFAAAGTDNLVYLY-DIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSS 332

Query: 221 GSDDSTVRVW--KYIGDD--EDDQQEWVCESTLPNA-HRSQIYGVAWSPSGR--IASVGA 273
           GSD  T+ VW  + IG +  +D+ ++   E  + +A H++ I  +A +P+    +AS   
Sbjct: 333 GSDRRTI-VWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEE 391

Query: 274 DGVLAVYKEKQN 285
           D ++ ++K   N
Sbjct: 392 DNIVQIWKCSSN 403

>Scas_680.11
          Length = 347

 Score = 47.8 bits (112), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 65/140 (46%), Gaps = 20/140 (14%)

Query: 152 VLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSK 211
           VL  H + +  V ++ + +LL S S D+   +W  Y  + E    L GH GTIW  D  K
Sbjct: 5   VLMGHERPLTQVKYNREGDLLFSCSKDNFASVW--YSVNGERLGTLNGHAGTIWSIDVDK 62

Query: 212 EEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASV 271
             +     +GS D ++++WK     E  +  +  +S +P      +  V++SP G   + 
Sbjct: 63  FTE--YCVTGSADYSIKMWKV----ETGENVYSWDSPVP------VKNVSFSPCGNYVAA 110

Query: 272 GADGVLA------VYKEKQN 285
             D V+       +Y+ K+N
Sbjct: 111 VLDNVMKYPGSINIYQLKRN 130

 Score = 36.2 bits (82), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 87/199 (43%), Gaps = 24/199 (12%)

Query: 8   SLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAW 67
           +L  H   +WSID +       TGS D +IK+ +++ G EN+    D  V    V++V++
Sbjct: 47  TLNGHAGTIWSIDVDKFTEYCVTGSADYSIKMWKVETG-ENVYS-WDSPV---PVKNVSF 101

Query: 68  RPHSDLLAA-----GSFDSTISIWT-QSDLDLEEGAKLEMELLAIIEGHENEVKGIS--W 119
            P  + +AA       +  +I+I+  + + +  E  +   E +  IE  E     +S  W
Sbjct: 102 SPCGNYVAAVLDNVMKYPGSINIYQLKRNPETNEIIEFVEEPIHKIETQEGLSAAVSADW 161

Query: 120 SQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYD- 178
           S +G  +    ++  V  ++ D   +  E I +   H   +  + +        +SS D 
Sbjct: 162 STEGKFIIAAHKEGEVSKYDVDNGLQFVESIKL---HKALITDLQFSPDRTYFITSSRDS 218

Query: 179 -------DTVRIWKDYDDD 190
                  +T+ + KD++ D
Sbjct: 219 HAHIVDVETLAVLKDFEID 237

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 28/139 (20%), Positives = 54/139 (38%), Gaps = 9/139 (6%)

Query: 3   LQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAV 62
           LQ  +S+KLH   +  + F P R    T S D    ++ ++      L VL D      +
Sbjct: 186 LQFVESIKLHKALITDLQFSPDRTYFITSSRDSHAHIVDVET-----LAVLKDFEIDCPL 240

Query: 63  RSVAWRPHSDLLAAG----SFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGIS 118
            +    P  + +  G    + D T +  ++   +     K+  E +  ++GH   +  ++
Sbjct: 241 NTACITPLKEFVILGGGQDARDVTTTSASEGKFEARFHHKIFEEEIGRVKGHFGPLNCVA 300

Query: 119 WSQDGCLLATCSRDKSVWI 137
            S  G    +   D  V +
Sbjct: 301 VSPQGTSYVSGGEDGLVRL 319

>CAGL0L03201g complement(366795..368534) some similarities with
           sp|P47025 Saccharomyces cerevisiae YJL112w MDV1 or
           sp|P36130 Saccharomyces cerevisiae YKR036c CAF4 CCR4,
           hypothetical start
          Length = 579

 Score = 47.8 bits (112), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 58/245 (23%), Positives = 109/245 (44%), Gaps = 33/245 (13%)

Query: 4   QLAKSLKLHNDKVWSIDFEPVRGLL-ATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAV 62
           QL K+LK H+D + S+      G+L +T + D  IK+  +   +   L VL  + H+  V
Sbjct: 271 QLGKTLKCHDDYINSLAINAQLGVLSSTANLDNEIKLWDISTTQ--CLGVL--SGHRATV 326

Query: 63  RSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQD 122
            +  +   + LLA+   D+++ +W   ++  ++G   +   LA  +GH++ V  ++ +  
Sbjct: 327 NTTRFIDDTRLLASAGKDASVKVWDVDNIVDKDGNANDNLCLATFDGHKDSVTALATT-- 384

Query: 123 GCLLATCSRDKSVWIWE--TDEAGEEYECISVLQEHSQDVKHV----VWHTK-------- 168
           G  + + S DK++  W+  + +  +  +    L+   Q V  +     ++T         
Sbjct: 385 GNAIVSGSNDKTLRHWDLGSGKCIQSIDLTIALKMVPQSVSKLDITPSFNTPLIGGADCI 444

Query: 169 HNLLASSSYDDTVRIWKDYDDDWECAAV---LTGHEGTIWCSDFSKEEDPIRLCSGSDDS 225
            N L + + D  V +W     D     V   L GH G I    +   E    L +GS D 
Sbjct: 445 DNALVTGTKDGIVYLW-----DLRIGRVVGSLEGHRGPITSLKYMGSE----LITGSMDK 495

Query: 226 TVRVW 230
           + R+W
Sbjct: 496 STRIW 500

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 77/184 (41%), Gaps = 17/184 (9%)

Query: 13  NDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDV--LDDTVHKKAVRSVAWRPH 70
           +DKV  +  EP    +      R  + ++LK  K +  D+   ++ +  K       + H
Sbjct: 222 DDKVSLLTLEPDNAQIGN-KLQRYFEAMKLKK-KSSGFDIEDFENIIGTKGQLGKTLKCH 279

Query: 71  SDLLAAGSFDSTISIWTQSDLDLEEGAKL----EMELLAIIEGHENEVKGISWSQDGCLL 126
            D + + + ++ + + + S  +L+   KL      + L ++ GH   V    +  D  LL
Sbjct: 280 DDYINSLAINAQLGVLS-STANLDNEIKLWDISTTQCLGVLSGHRATVNTTRFIDDTRLL 338

Query: 127 ATCSRDKSVWIWETDEA------GEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDT 180
           A+  +D SV +W+ D          +  C++    H   V  +   T  N + S S D T
Sbjct: 339 ASAGKDASVKVWDVDNIVDKDGNANDNLCLATFDGHKDSVTALA--TTGNAIVSGSNDKT 396

Query: 181 VRIW 184
           +R W
Sbjct: 397 LRHW 400

>KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomyces
           cerevisiae YPL183c, start by similarity
          Length = 990

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 81/185 (43%), Gaps = 17/185 (9%)

Query: 64  SVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDG 123
           S+    H  L+ AG+  + I +W     +L+   K+       + GHE  +  ++ S +G
Sbjct: 144 SIKVLRHKVLVNAGTIMNGIIVW-----ELDSKKKIHT-----LRGHEGSIFYVTTSNNG 193

Query: 124 CLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRI 183
            LLA+CS D+S+ IW+        + +S    H+  + ++ +      L S S D T R+
Sbjct: 194 KLLASCSDDRSIIIWDMVSG----KLLSRAWGHTARIWNLKFFNDDTQLISVSEDCTCRV 249

Query: 184 WKDYDDDWECAAVLTGH-EGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQE 242
           W   +D+     +   H    +W  D   EE  +   SG +D  ++V + +  +     E
Sbjct: 250 WNYKNDELTIKDIFESHLTKNVWGVDV--EETNLIAISGGNDGRLKVTELVPHNRSCNIE 307

Query: 243 WVCES 247
              ES
Sbjct: 308 LSLES 312

 Score = 29.3 bits (64), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 88/211 (41%), Gaps = 19/211 (9%)

Query: 8   SLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDT-VHKKAVRSVA 66
           +L+ H   ++ +       LLA+ S DR+I +  + +GK     +L     H   + ++ 
Sbjct: 176 TLRGHEGSIFYVTTSNNGKLLASCSDDRSIIIWDMVSGK-----LLSRAWGHTARIWNLK 230

Query: 67  WRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEG---HENEVKGISWSQDG 123
           +      L + S D T  +W   + +L      E  L   + G    E  +  IS   DG
Sbjct: 231 FFNDDTQLISVSEDCTCRVWNYKNDELTIKDIFESHLTKNVWGVDVEETNLIAISGGNDG 290

Query: 124 CLLAT--CSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASS-----S 176
            L  T     ++S  I  + E+  E +C   + + ++ VK   W     +L +S      
Sbjct: 291 RLKVTELVPHNRSCNIELSLESISE-QCDGFIHKANEIVKGFHWFDFGLVLITSEGNILE 349

Query: 177 YDDTVRIWK--DYDDDWECAAVLTGHEGTIW 205
           Y   +  WK  DYDD +   ++  G+E TI+
Sbjct: 350 YLQNIEEWKFLDYDDRFFSFSITQGNENTIF 380

>Kwal_33.15475
          Length = 783

 Score = 47.8 bits (112), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 77/354 (21%), Positives = 134/354 (37%), Gaps = 105/354 (29%)

Query: 7   KSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLL---DVLDDTVHKKAVR 63
           ++LK HN +V  + F P   L+ + S D  +++   +   ++ L    V+D   H     
Sbjct: 50  RTLKGHNAEVTCVKFVPGTNLMVSSSEDSQVRLWAFEEKDQDALKCVQVIDHHKHTITSL 109

Query: 64  SVAWRPHSDLLAAGSFDSTISIWTQSD--------------------------------- 90
           SV     S++L+ G  D ++S+W   +                                 
Sbjct: 110 SVI----SNILSVGCADGSVSLWLTENNQAILLHSFNLQTNVYPLCMALKLVEGDKYLLA 165

Query: 91  ------------LDLEEGAKLEMELLAIIEGHENEVKGISW---SQDGCLLATCSRDKSV 135
                         L++G     +L A +EGHE+ VK + +   S    LLAT S+D+ +
Sbjct: 166 IGGTNPRVFIYSFTLQDGTLNNFQLAAELEGHEDWVKAMDFYEESPGNMLLATGSQDRYI 225

Query: 136 WIWE------TDEAGEEYECISVLQEH------SQDVKHVV-----------------WH 166
            +W        D + E+   +++L         + D+K  +                 WH
Sbjct: 226 RLWRIRTNELIDNSDEDEFKLNLLGNKQSKFFITPDLKVAINFDALIVGHDDWISCLKWH 285

Query: 167 TKHNLLASSSYDDTVRIWKDYDDD--WECAAVL-----------TGHEGTIW-CSDFSKE 212
            +   L +S+ D  V +W+   D   W CA+ L           TG  G  W CS F+ +
Sbjct: 286 KERPQLLASTADTAVMVWEPDADSGVWICASRLGELSSKGASTATGSSGGFWSCSWFTHK 345

Query: 213 EDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSG 266
                L +G   S  R+W       D+ + W  +  +    ++ +  VAWSP+G
Sbjct: 346 NRDHILTNGKTGSW-RMWV-----SDELEGWKQQLAITGPTKA-VTDVAWSPNG 392

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 68/304 (22%), Positives = 121/304 (39%), Gaps = 44/304 (14%)

Query: 3   LQLAKSLKLHNDKVWSIDF---EPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHK 59
            QLA  L+ H D V ++DF    P   LLATGS DR I++ +++  +  L+D  D+   K
Sbjct: 188 FQLAAELEGHEDWVKAMDFYEESPGNMLLATGSQDRYIRLWRIRTNE--LIDNSDEDEFK 245

Query: 60  KAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISW 119
                       +LL             QS   +    K+ +   A+I GH++ +  + W
Sbjct: 246 L-----------NLLGN----------KQSKFFITPDLKVAINFDALIVGHDDWISCLKW 284

Query: 120 SQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVV-----------WHTK 168
            ++   L   + D +V +WE D     + C S L E S                  W T 
Sbjct: 285 HKERPQLLASTADTAVMVWEPDADSGVWICASRLGELSSKGASTATGSSGGFWSCSWFTH 344

Query: 169 HNL--LASSSYDDTVRIW-KDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDS 225
            N   + ++    + R+W  D  + W+    +TG    +  +D +   + + + + S D 
Sbjct: 345 KNRDHILTNGKTGSWRMWVSDELEGWKQQLAITGPTKAV--TDVAWSPNGLYMLATSLDQ 402

Query: 226 TVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYKEKQN 285
           T R+      D  +   W  E   P  H   +  V    + R  S G + ++  + E + 
Sbjct: 403 TTRLISRCNYDA-NAGSWF-EFARPQIHGYDMICVEPLSNTRFISGGDEKIMRSFDEPKG 460

Query: 286 DSEV 289
            +++
Sbjct: 461 VAQL 464

 Score = 32.0 bits (71), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 55/121 (45%), Gaps = 13/121 (10%)

Query: 120 SQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHN---LLASSS 176
           ++ G +  T SRDK +  W+  E G++YE    L+         V+   HN   L+A+  
Sbjct: 656 TEFGHVFVTASRDKHIKAWKLSEDGQQYEQQHALKLAVPVTAISVFPGLHNGKLLVAAGL 715

Query: 177 YDDTVRIWKDYDDDWECAAVLTGHEGTI-------WCSDFSKEEDPIRLCSGSDDSTVRV 229
            +  ++++  YD+ + C + +              W S+  +E+  I L   S D ++RV
Sbjct: 716 ENGNIQVFT-YDNQFRCYSEIDTRFTPADRVSRLRWSSN--QEKGRILLAVTSADHSIRV 772

Query: 230 W 230
           +
Sbjct: 773 F 773

 Score = 32.0 bits (71), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 49/104 (47%), Gaps = 7/104 (6%)

Query: 105 AIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVV 164
           A+  G   + +   ++ D  +LA     K++ +W+  +    +     L+ H+ +V  V 
Sbjct: 6   AVFIGANRQTQAGDYNCDREILAFAG-GKTIALWKPLDPAH-HGVYRTLKGHNAEVTCVK 63

Query: 165 WHTKHNLLASSSYDDTVRIW----KDYDDDWECAAVLTGHEGTI 204
           +    NL+ SSS D  VR+W    KD  D  +C  V+  H+ TI
Sbjct: 64  FVPGTNLMVSSSEDSQVRLWAFEEKD-QDALKCVQVIDHHKHTI 106

 Score = 30.8 bits (68), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 36/189 (19%), Positives = 67/189 (35%), Gaps = 13/189 (6%)

Query: 107 IEGHENEVKGISWSQDGCLLATCSRDKSVW--IWETDEAGEEYECISVLQEHSQDVKHVV 164
           + GH  E+  +  + D  ++A+  R  ++   + +  +A    +     Q H+  +  + 
Sbjct: 546 LYGHGYEISCLDVNADSSIIASACRSNNLQHAVIKFFDAKTWLQLKPTKQFHNLTITRLR 605

Query: 165 WHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLT---GHEGTIWCSDFSKEEDPIRLCSG 221
           + +    L S S D    +WK      E          H   IW  D++  E      + 
Sbjct: 606 FSSDSESLLSVSRDRQWAVWKKNSATNEFELTFKNEKAHTRIIWDCDWAPTEFGHVFVTA 665

Query: 222 SDDSTVRVWKYIGDDEDDQQEWVCE--------STLPNAHRSQIYGVAWSPSGRIASVGA 273
           S D  ++ WK   D +  +Q+   +        S  P  H  ++   A   +G I     
Sbjct: 666 SRDKHIKAWKLSEDGQQYEQQHALKLAVPVTAISVFPGLHNGKLLVAAGLENGNIQVFTY 725

Query: 274 DGVLAVYKE 282
           D     Y E
Sbjct: 726 DNQFRCYSE 734

>Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement
          Length = 263

 Score = 46.6 bits (109), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 52/186 (27%), Positives = 86/186 (46%), Gaps = 24/186 (12%)

Query: 6   AKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSV 65
           AKS KL       + + P   LLA G  D  IK+  L + K  L++      HK A+  +
Sbjct: 70  AKSTKLAESTY--LQYHPETNLLAVGYADGVIKIWDLIS-KTVLINF---NGHKSAITVL 123

Query: 66  AWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCL 125
            + P    L +GS DS I IW   DL  E G       L  +  H++ + GI W ++   
Sbjct: 124 RFDPTGTRLISGSKDSDIIIW---DLVGEVG-------LYKLRSHKDSITGI-WCENEDW 172

Query: 126 LATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWK 185
           L + S+D  + IW+     +  +C+     H+ +   +  H  ++L+ ++S +  ++IW 
Sbjct: 173 LISTSKDGLIKIWDL----KTQQCVETHMAHTSECWGLAIH--NDLVITTSTESQIKIWN 226

Query: 186 -DYDDD 190
            D D D
Sbjct: 227 LDLDKD 232

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 37/79 (46%), Gaps = 14/79 (17%)

Query: 162 HVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVL---TGHEGTIWCSDFSKEEDPI-- 216
           ++ +H + NLLA    D  ++IW     D     VL    GH+  I    F    DP   
Sbjct: 80  YLQYHPETNLLAVGYADGVIKIW-----DLISKTVLINFNGHKSAITVLRF----DPTGT 130

Query: 217 RLCSGSDDSTVRVWKYIGD 235
           RL SGS DS + +W  +G+
Sbjct: 131 RLISGSKDSDIIIWDLVGE 149

>KLLA0C07425g complement(647673..649007) highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein singleton, start by
           similarity
          Length = 444

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 81/179 (45%), Gaps = 20/179 (11%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEME---LLAIIEGHENEV 114
           H   +R+V +   + L++AG+ D T+ +W   + DL+   + E+E    LAI+EGH+  V
Sbjct: 141 HSGPIRAVHYISSTRLVSAGN-DRTLRLWKTKNDDLKSIDEEEIEDGKTLAILEGHKAPV 199

Query: 115 KGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLAS 174
             I  S+D  L A+C  D +V +W T+   +E   I  +++   +V       +   L  
Sbjct: 200 VSIDVSKDRILSASC--DNTVSLWSTNY--KEMTVIDPMEDLGGNVSTAAKKRRKLTLK- 254

Query: 175 SSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYI 233
              D ++R            A+   H   +    F K +D +   S S D T++ W  I
Sbjct: 255 ---DGSIR-------RRAPLALFESHSAPVEAVIFDKSDDTVGY-SVSQDHTIKTWDLI 302

 Score = 35.4 bits (80), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 42/201 (20%), Positives = 79/201 (39%), Gaps = 24/201 (11%)

Query: 91  LDLEEGAKLEMELLAIIEGHENEVKGISWSQ-DGCLLATCSRDKSVWIWE------TDEA 143
           L L++G+      LA+ E H   V+ + + + D  +  + S+D ++  W+       D  
Sbjct: 251 LTLKDGSIRRRAPLALFESHSAPVEAVIFDKSDDTVGYSVSQDHTIKTWDLITAKCVDTK 310

Query: 144 GEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGT 203
              Y  +SV Q    ++       +H  L     + + +I +           L GH+  
Sbjct: 311 TTSYSLLSVAQLPKLNLLACGSSARHITLHDPRVNSSSKITQQQ---------LVGHKNF 361

Query: 204 IWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRS---QIYGV 260
           +   D   E + + +CS S D TV+VW    D   +   +       N  +    +++ V
Sbjct: 362 VVALDTCPENEYM-ICSASHDGTVKVW----DVRSNTAMYTITREDKNVVKGVNDKVFAV 416

Query: 261 AWSPSGRIASVGADGVLAVYK 281
            W+    I S G D  + + K
Sbjct: 417 KWAKGVGIISGGQDKKIQINK 437

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 52/121 (42%), Gaps = 15/121 (12%)

Query: 170 NLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRV 229
           N + S SYD  VR    Y+   +     +GH G I    +       RL S  +D T+R+
Sbjct: 114 NYIYSGSYDGIVRT---YNLSGKVEKQYSGHSGPIRAVHYISS---TRLVSAGNDRTLRL 167

Query: 230 WKYIGDD--EDDQQEWVCESTLP--NAHRSQIYGVAWSPSGRIASVGADGVLAV----YK 281
           WK   DD    D++E     TL     H++ +  +  S   RI S   D  +++    YK
Sbjct: 168 WKTKNDDLKSIDEEEIEDGKTLAILEGHKAPVVSIDVS-KDRILSASCDNTVSLWSTNYK 226

Query: 282 E 282
           E
Sbjct: 227 E 227

>AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -
           NSH] complement(667539..669809) [2271 bp, 756 aa]
          Length = 756

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 83/193 (43%), Gaps = 23/193 (11%)

Query: 4   QLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVR 63
           Q    L  H   VW++ +     +L +GSTDR +++  +K GK     V     H   VR
Sbjct: 398 QFKLELVGHEGGVWALKYAGDE-ILVSGSTDRTVRIWNVKAGK--CTHVFRG--HTSTVR 452

Query: 64  SVAWRPHSDL--LAAGSFDSTISIWTQSD---LDLEEGAKLEME-------LLAIIEGHE 111
            +    H  +  +  GS D+T+ +W   D    D    A  +          + ++ GH 
Sbjct: 453 CLDVVEHGGIKYVVTGSRDNTLHVWKLPDPNSPDYNPNAMRQFNSIEDNPFFVGVLRGHM 512

Query: 112 NEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNL 171
             V+ +  S  G ++ + S D ++ +W+      + + + VL  H+  +   ++  K   
Sbjct: 513 ASVRTV--SGHGNIVVSGSYDHNLMVWDI----AKMKLLYVLTGHTDRIYSTLYDHKRKR 566

Query: 172 LASSSYDDTVRIW 184
             S+S D TV++W
Sbjct: 567 CISASMDTTVKVW 579

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 66/151 (43%), Gaps = 22/151 (14%)

Query: 107 IEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWH 166
           ++GH  +V    +  +G  + T + DK + +++ D   E+++   V  E        VW 
Sbjct: 362 LDGHRTKVV-TCFQFEGNYIITGADDKRINVYDADR--EQFKLELVGHEGG------VWA 412

Query: 167 TKH---NLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSD 223
            K+    +L S S D TVRIW       +C  V  GH  T+ C D  +      + +GS 
Sbjct: 413 LKYAGDEILVSGSTDRTVRIWNV--KAGKCTHVFRGHTSTVRCLDVVEHGGIKYVVTGSR 470

Query: 224 DSTVRVWKYIGDDEDDQQEWVCESTLPNAHR 254
           D+T+ VWK    +  D          PNA R
Sbjct: 471 DNTLHVWKLPDPNSPDYN--------PNAMR 493

 Score = 33.1 bits (74), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 18/82 (21%), Positives = 40/82 (48%), Gaps = 12/82 (14%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGI 117
           H  +VR+V+   H +++ +GS+D  + +W  +          +M+LL ++ GH + +   
Sbjct: 511 HMASVRTVSG--HGNIVVSGSYDHNLMVWDIA----------KMKLLYVLTGHTDRIYST 558

Query: 118 SWSQDGCLLATCSRDKSVWIWE 139
            +        + S D +V +W+
Sbjct: 559 LYDHKRKRCISASMDTTVKVWD 580

>CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces
           cerevisiae YGR200c subunit of elongating RNA polymerase
           II holoenzyme, start by similarity
          Length = 793

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 70/159 (44%), Gaps = 27/159 (16%)

Query: 3   LQLAKSLKLHNDKVWSIDFE----PVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVH 58
             LA  L+ H D V SI F     P   LL +GS DR I++ +++       D++DD+  
Sbjct: 194 FNLAAELEGHEDWVKSIQFRHQETPGDYLLCSGSQDRYIRIWRIRTN-----DLIDDSED 248

Query: 59  KKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGIS 118
            +   +        LL++           Q    + E  ++ +   A+I GH++ V  + 
Sbjct: 249 DETKLT--------LLSS----------KQHKFHISEDLRIGINFEALIIGHDDWVSSLQ 290

Query: 119 WSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHS 157
           W +    L   + D +V IWE DE+   + C S L E S
Sbjct: 291 WHESKLQLLASTADTAVMIWEPDESSGVWVCSSRLGEMS 329

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/203 (23%), Positives = 85/203 (41%), Gaps = 25/203 (12%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGI 117
           H+  V  V + P +D+L + S D  + +W     + EE     +E +  I  + + +  I
Sbjct: 57  HEAEVTCVKFMPGTDILVSASEDHHVKLWKYKAPESEE-----LECIQTITHYSHTIVSI 111

Query: 118 SWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKH-----NLL 172
                  ++ +     S+W+ ET+  G +   IS      ++V  + +   +      LL
Sbjct: 112 ETLAGLIVIGSAGGLVSIWVPETE--GSDTYIISHEYSLPRNVFPLCFSLSNVVGNKYLL 169

Query: 173 ASSSYDDTVRIWK------DYDDDWECAAVLTGHEGTIWCSDFSKEEDP--IRLCSGSDD 224
           A       + I+          +++  AA L GHE  +    F  +E P    LCSGS D
Sbjct: 170 AIGGTTVKIFIYSFVLSEGKVIENFNLAAELEGHEDWVKSIQFRHQETPGDYLLCSGSQD 229

Query: 225 STVRVWK-----YIGDDEDDQQE 242
             +R+W+      I D EDD+ +
Sbjct: 230 RYIRIWRIRTNDLIDDSEDDETK 252

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 81/182 (44%), Gaps = 29/182 (15%)

Query: 73  LLAAGSFDSTISIWTQSDLDLEEGAKLE-MELLAIIEGHENEVKGISWSQDGC----LLA 127
           LLA G   +T+ I+  S + L EG  +E   L A +EGHE+ VK I +         LL 
Sbjct: 168 LLAIGG--TTVKIFIYSFV-LSEGKVIENFNLAAELEGHEDWVKSIQFRHQETPGDYLLC 224

Query: 128 TCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDY 187
           + S+D+ + IW              L + S+D +     TK  LL+S  +     I +D 
Sbjct: 225 SGSQDRYIRIWRIRTND--------LIDDSEDDE-----TKLTLLSSKQHK--FHISEDL 269

Query: 188 DDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCES 247
                  A++ GH+   W S     E  ++L + + D+ V +W    + ++    WVC S
Sbjct: 270 RIGINFEALIIGHDD--WVSSLQWHESKLQLLASTADTAVMIW----EPDESSGVWVCSS 323

Query: 248 TL 249
            L
Sbjct: 324 RL 325

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 68/162 (41%), Gaps = 12/162 (7%)

Query: 165 WHTKHNLLASSSYDDTVRIWKDYDDDWE-CAAVLTGHEGTIWCSDFSKEEDPIRLCSGSD 223
           ++   N+LA  +    + +W   D D     A L GHE  + C  F    D   L S S+
Sbjct: 22  YNKARNVLAFGA-GKNIALWNPLDADCRGIYATLKGHEAEVTCVKFMPGTDI--LVSASE 78

Query: 224 DSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYKEK 283
           D  V++WKY      + +E  C  T+   H S       + +G I    A G+++++  +
Sbjct: 79  DHHVKLWKY---KAPESEELECIQTI--THYSHTIVSIETLAGLIVIGSAGGLVSIWVPE 133

Query: 284 QNDSEVSEWEISATYKAAHTVYEINTVKWVNIDGKEMLITAG 325
              S+   + IS  Y     V+ +      N+ G + L+  G
Sbjct: 134 TEGSDT--YIISHEYSLPRNVFPL-CFSLSNVVGNKYLLAIG 172

 Score = 36.6 bits (83), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 53/126 (42%), Gaps = 11/126 (8%)

Query: 60  KAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISW 119
           K  +  ++    ++LA G+    I++W   D D          + A ++GHE EV  + +
Sbjct: 15  KQTQVCSYNKARNVLAFGA-GKNIALWNPLDADCRG-------IYATLKGHEAEVTCVKF 66

Query: 120 SQDGCLLATCSRDKSVWIWETDEA-GEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYD 178
                +L + S D  V +W+      EE ECI  +  +S  +  +   T   L+   S  
Sbjct: 67  MPGTDILVSASEDHHVKLWKYKAPESEELECIQTITHYSHTIVSI--ETLAGLIVIGSAG 124

Query: 179 DTVRIW 184
             V IW
Sbjct: 125 GLVSIW 130

>CAGL0A00605g complement(67281..69203) similar to sp|P53197
           Saccharomyces cerevisiae YGL003c CDH1 substrate-specific
           activator of APC-dependent proteolysis, hypothetical
           start
          Length = 640

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/239 (23%), Positives = 90/239 (37%), Gaps = 64/239 (26%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGI 117
           H   V  ++W  H  +L++GS D TI         L    ++       IE HE E+ G+
Sbjct: 417 HLDRVACLSWNNH--ILSSGSRDRTI---------LHRDVRMADPFFEKIETHEQEICGL 465

Query: 118 SWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHT-KHNLLASS- 175
            W+ +   LA+   D  V++++    G        + EH   VK + W   K  +LA+  
Sbjct: 466 KWNTNDNKLASGGNDNMVFVYD----GTSRTPFLSINEHKAAVKAMAWSPHKQGILATGG 521

Query: 176 -SYDDTVRIWK--------DYD---------------------------------DDWEC 193
            + D T+++W         D D                                  + E 
Sbjct: 522 GTADRTLKMWNVNTSVKLNDVDTGSQVCNMVWSTNTDEIVTSHGYSKYNLTIWEASNLEP 581

Query: 194 AAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNA 252
            A+L GH   +     S   D   + SG+ D T+R WK     E  +++   +ST+ NA
Sbjct: 582 LAILKGHSFRVLHLTLS--ADGTTIVSGAGDETLRYWKLF---EKQKRKATADSTILNA 635

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 70/158 (44%), Gaps = 29/158 (18%)

Query: 45  GKENLLDVLDDTV---------HKKAVRSVAWRPHSDLLAA---GSFDSTISIWTQSDLD 92
           G +N++ V D T          HK AV+++AW PH   + A   G+ D T+ +W      
Sbjct: 478 GNDNMVFVYDGTSRTPFLSINEHKAAVKAMAWSPHKQGILATGGGTADRTLKMW------ 531

Query: 93  LEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCS--RDKSVWIWETDEAGEEYECI 150
                   ++L  +  G  ++V  + WS +   + T       ++ IWE        E +
Sbjct: 532 ---NVNTSVKLNDVDTG--SQVCNMVWSTNTDEIVTSHGYSKYNLTIWE----ASNLEPL 582

Query: 151 SVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYD 188
           ++L+ HS  V H+        + S + D+T+R WK ++
Sbjct: 583 AILKGHSFRVLHLTLSADGTTIVSGAGDETLRYWKLFE 620

 Score = 32.0 bits (71), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 78/177 (44%), Gaps = 32/177 (18%)

Query: 112 NEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNL 171
           NE   +SW   G  LA    +  V I++  +     +CI  L  H   V  + W+  +++
Sbjct: 377 NEYTSLSWMGAGSHLAIGQGNGIVEIYDVTKE----KCIRTLSGHLDRVACLSWN--NHI 430

Query: 172 LASSSYDDT-----VRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDST 226
           L+S S D T     VR+   + +  E       HE  I    ++  ++  +L SG +D+ 
Sbjct: 431 LSSGSRDRTILHRDVRMADPFFEKIET------HEQEICGLKWNTNDN--KLASGGNDNM 482

Query: 227 VRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSP--SGRIASVG--ADGVLAV 279
           V V+     D   +  ++      N H++ +  +AWSP   G +A+ G  AD  L +
Sbjct: 483 VFVY-----DGTSRTPFLSI----NEHKAAVKAMAWSPHKQGILATGGGTADRTLKM 530

>CAGL0F07337g complement(714870..716735) similar to sp|P26309
           Saccharomyces cerevisiae YGL116w CDC20 cell division
           control protein, hypothetical start
          Length = 621

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 83/181 (45%), Gaps = 22/181 (12%)

Query: 110 HENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWH-TK 168
           H  EV G+S+  DG  LA+   D ++ IW+T  +  ++    V ++HS  VK + W  T 
Sbjct: 376 HTGEVCGLSYKADGLQLASGGNDNTMMIWDTRTSMPQF----VKKDHSAAVKALAWSPTN 431

Query: 169 HNLLAS--SSYDDTVRIWKDYDDDWECAAVLTGHEGTI--WCSDFSKEED---PIRLCSG 221
             LLAS     D  +  W +     +   + TG + +   W   +  + +    I    G
Sbjct: 432 AGLLASGGGQTDQQIHFW-NSTTGAKLHTINTGSQVSSLHWGQSYDTKGNMNVEIVATGG 490

Query: 222 SDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRI-ASVGADGVLAVY 280
           S D+++ ++ Y      + +  V E  + +AH ++I     SP G + A++G D  L  Y
Sbjct: 491 SPDNSISIYNY------ETRYKVAE--VVHAHDARICCSKLSPDGTVLATIGGDENLKFY 542

Query: 281 K 281
           K
Sbjct: 543 K 543

>Scas_558.3
          Length = 725

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 69/158 (43%), Gaps = 22/158 (13%)

Query: 74  LAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEG-HENEVKGISWSQDGCLLATCSRD 132
               S D T+ +W             E +LL    G H + ++ I     G  +ATCS D
Sbjct: 157 FITASADRTVKLWK------------ENKLLKTFSGIHSDVIRNIEVLSSGKEIATCSND 204

Query: 133 KSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWE 192
            ++ I + D   ++     VL  H   V +V    + + L S   D ++RIW D ++++ 
Sbjct: 205 GTIKISDLDGNIKQ-----VLSGHESFVYNVKLSKQGDKLVSCGEDRSLRIW-DINNNFN 258

Query: 193 CAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
              V+     +IWC D     D +  CS   D+TVR++
Sbjct: 259 IKQVIKLPAVSIWCVDTLPNGDIVVGCS---DNTVRIF 293

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 58/135 (42%), Gaps = 17/135 (12%)

Query: 8   SLKLHNDKVWSIDFEPVR-GLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVA 66
           SL+ H   VW      V      T S DR +K+      KEN L      +H   +R++ 
Sbjct: 136 SLEGHQASVWDAKIISVEENTFITASADRTVKLW-----KENKLLKTFSGIHSDVIRNIE 190

Query: 67  WRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLL 126
                  +A  S D TI I   SDLD          +  ++ GHE+ V  +  S+ G  L
Sbjct: 191 VLSSGKEIATCSNDGTIKI---SDLD--------GNIKQVLSGHESFVYNVKLSKQGDKL 239

Query: 127 ATCSRDKSVWIWETD 141
            +C  D+S+ IW+ +
Sbjct: 240 VSCGEDRSLRIWDIN 254

 Score = 29.3 bits (64), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 147 YECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDD 189
           Y+  + L  H+QDVK +V     + +AS S D T+R+WK  D+
Sbjct: 2   YQLSATLLGHTQDVKDIVV-IDDSQVASVSRDGTLRLWKHNDN 43

>Scas_658.1
          Length = 442

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 66/323 (20%), Positives = 119/323 (36%), Gaps = 63/323 (19%)

Query: 1   MPLQLAKSLKLHNDKVWSIDFEPVRG-LLATGSTDRAIKVLQLKNGKENLLDVLDDTVHK 59
           +P ++  ++  H +   S+ F P  G LL +G  D  +KV    + K NLL   D   H 
Sbjct: 137 LPKKIKYAMDGHTNGTTSLTFLPNSGNLLLSGGNDNIVKVWDFYH-KRNLL--RDYKGHS 193

Query: 60  KAVRSVAWRPHSDLLAAGSFDSTISIW---------------TQSDLDLEEGAKLEMEL- 103
           KA+ S+ +        + SFD TI IW               T +D+        E  + 
Sbjct: 194 KAINSLDFNDDGTNFISSSFDHTIKIWDTEQGKVKTKLHFKSTPNDVKFRPFNSSEFIVG 253

Query: 104 -------------------LAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAG 144
                              + + + H + +  + +  DG    + S DK+V IW+ ++  
Sbjct: 254 FANSKIYHYDTRISENDGRVQVYDHHMSSILALKFFPDGSKFISSSEDKTVRIWD-NQVN 312

Query: 145 EEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIW---KDYDDDWECAAVLTGHE 201
              + IS   ++S  +  +  H       + S D+T+  +     Y  +     +  G  
Sbjct: 313 VPIKQISDTTQYS--MPSIDIHPDKKNFCAQSMDNTIYTYSMKPKYRRN--PNKMFKGQT 368

Query: 202 GTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCE---STLPNAHRSQIY 258
              +    +   D   +CSG   S V +W           +W      +T+       I 
Sbjct: 369 SAGYGIGLTFSADGRYVCSGDSKSKVHIW-----------DWTTTRLLNTISIPGNKPIT 417

Query: 259 GVAWSP--SGRIASVGADGVLAV 279
            VAW+P  + ++A  G  G + +
Sbjct: 418 QVAWNPQETSKVACSGNTGKIYI 440

>KLLA0E03982g 371642..372760 similar to sp|P39108 Saccharomyces
           cerevisiae YDR142c PAS7 peroxisomal import protein -
           peroxin singleton, start by similarity
          Length = 372

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 63/144 (43%), Gaps = 28/144 (19%)

Query: 18  SIDFEPVRG-LLATGSTDRAIKVLQLKNGKENL------LDVLDDTVHKKAVRSVAWRPH 70
           + DF   R  ++ATG  D+ IKV  L+  ++ L      +++ +   H+ AVR V W PH
Sbjct: 232 TCDFNKYRPHIIATGGVDKMIKVWDLRMCRKMLSQGHQPININEIQGHELAVRKVTWSPH 291

Query: 71  -SDLLAAGSFDSTISIWT------------QSDLDLEEGAKLEMELLAIIEGHENEVKGI 117
            S++L + S+D T  +WT             + +D   G +       I   H   V G 
Sbjct: 292 HSNMLLSTSYDMTCRVWTDLSDDGHGLTGKTNSIDPAHGCRF------IFMEHSEFVFGA 345

Query: 118 SWSQDGC--LLATCSRDKSVWIWE 139
            WS  G    +A+   D  V IW 
Sbjct: 346 DWSLWGTPGFVASTGWDGQVCIWN 369

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 79/198 (39%), Gaps = 27/198 (13%)

Query: 58  HKKAVRSVAWRPH-SDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKG 116
           +K+ +    + PH  +L+   S +S IS++   DL +      + + L    G    +  
Sbjct: 179 NKECIYQATFSPHDPNLVLCSSGNSFISLY---DLRVPNNGLPQHQFLG--HGGFEALTC 233

Query: 117 ISWSQDGCLLATCSRDKSVWIWETD------EAGEEYECISVLQEHSQDVKHVVWHTKH- 169
                   ++AT   DK + +W+          G +   I+ +Q H   V+ V W   H 
Sbjct: 234 DFNKYRPHIIATGGVDKMIKVWDLRMCRKMLSQGHQPININEIQGHELAVRKVTWSPHHS 293

Query: 170 NLLASSSYDDTVRIWKDYDDDWE--------------CAAVLTGHEGTIWCSDFSKEEDP 215
           N+L S+SYD T R+W D  DD                C  +   H   ++ +D+S    P
Sbjct: 294 NMLLSTSYDMTCRVWTDLSDDGHGLTGKTNSIDPAHGCRFIFMEHSEFVFGADWSLWGTP 353

Query: 216 IRLCSGSDDSTVRVWKYI 233
             + S   D  V +W  I
Sbjct: 354 GFVASTGWDGQVCIWNGI 371

>AFL056C [3137] [Homologous to ScYPL183C - SH] (329216..332146)
           [2931 bp, 976 aa]
          Length = 976

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 89/206 (43%), Gaps = 18/206 (8%)

Query: 74  LAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDK 133
           + AG+    + +W     +L  GA ++      +EGHE  +     S DG L+A+CS D+
Sbjct: 154 VCAGTVMGGVVVW-----ELHTGAVVQR-----LEGHEGSIFCAVVSDDGRLVASCSDDR 203

Query: 134 SVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWEC 193
           S+ +W   E GE+   + +   H+  +  + +    + L S S D T R+W    +  + 
Sbjct: 204 SIRVWSL-ETGEQ---VGIAWGHTARIWDLRFLRVADKLVSVSEDCTCRVWAVGAERMQE 259

Query: 194 AAVLTGHEG-TIWCSDFSKEEDPIRLCSGSDDSTVRV-WKYIGDDEDDQQEWVCESTLPN 251
            AV   H+  ++W  D  +E+D + + +G+D     V     G  E    +   E  L N
Sbjct: 260 EAVYDVHQTKSVWAVDV-QEDDMVAVTAGNDGRLRLVDLTRPGSRERPAIDLTTEG-LYN 317

Query: 252 AHRSQIYGVAWSPSGRIASVGADGVL 277
              +   G  W   G IA      +L
Sbjct: 318 MDHTTFKGFCWFERGPIAITSCGKIL 343

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 60/140 (42%), Gaps = 26/140 (18%)

Query: 197 LTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQ 256
           L GHEG+I+C+  S +   +  CS  DD ++RVW      E  +Q               
Sbjct: 177 LEGHEGSIFCAVVSDDGRLVASCS--DDRSIRVWSL----ETGEQ--------------- 215

Query: 257 IYGVAWSPSGRIASVGADGVLAVYKEKQNDSEVSEWEISATYKAAHTVYEINTVKWV-NI 315
             G+AW  + RI  +    V         D     W + A       VY+++  K V  +
Sbjct: 216 -VGIAWGHTARIWDLRFLRVADKLVSVSEDCTCRVWAVGAERMQEEAVYDVHQTKSVWAV 274

Query: 316 DGKE---MLITAGDDGRVNL 332
           D +E   + +TAG+DGR+ L
Sbjct: 275 DVQEDDMVAVTAGNDGRLRL 294

>KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces
           cerevisiae YDR364c CDC40 cell division control protein
           singleton, start by similarity
          Length = 429

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 81/182 (44%), Gaps = 31/182 (17%)

Query: 58  HKKAVRSVAWRPHSD-LLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKG 116
           HK    S+ + P +  LL +G  D+ I +W     D       E ELL   EGH   +K 
Sbjct: 134 HKNGTTSLRFIPKTGHLLLSGGNDNIIKLW-----DFYH----ERELLRTYEGHSMTIKD 184

Query: 117 ISWSQDGCLLATCSRDKSVWIWETDEA--------GEEYECISVLQEHSQDVKHVVWHTK 168
           ++++ +G   A+ S DK V IW T++              CI+    H +D   +V    
Sbjct: 185 LNFTDNGHSFASASFDKWVKIWNTEKGIIDKRLRFNSVPNCITF---HPKDKNQLVVGLS 241

Query: 169 HNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVR 228
           ++ +    YD  +R+ +++ +          H+G+I    +    D  +L S S+D TVR
Sbjct: 242 NSEI--RHYD--LRLSENHGE----VQKYDHHQGSILALKYF--PDGKKLISSSEDKTVR 291

Query: 229 VW 230
           +W
Sbjct: 292 IW 293

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 40/87 (45%), Gaps = 4/87 (4%)

Query: 99  LEMELLAIIEGHENEVKGISW-SQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHS 157
           L    +A   GH+N    + +  + G LL +   D  + +W+      E E +   + HS
Sbjct: 123 LPKTKIAEYYGHKNGTTSLRFIPKTGHLLLSGGNDNIIKLWD---FYHERELLRTYEGHS 179

Query: 158 QDVKHVVWHTKHNLLASSSYDDTVRIW 184
             +K + +    +  AS+S+D  V+IW
Sbjct: 180 MTIKDLNFTDNGHSFASASFDKWVKIW 206

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 57/307 (18%), Positives = 109/307 (35%), Gaps = 52/307 (16%)

Query: 12  HNDKVWSIDFEPVRG-LLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPH 70
           H +   S+ F P  G LL +G  D  IK+    + +E LL   +   H   ++ + +  +
Sbjct: 134 HKNGTTSLRFIPKTGHLLLSGGNDNIIKLWDFYHERE-LLRTYEG--HSMTIKDLNFTDN 190

Query: 71  SDLLAAGSFDSTISIWTQSD-----------------------------LDLEEGAKLEM 101
               A+ SFD  + IW                                 L   E    ++
Sbjct: 191 GHSFASASFDKWVKIWNTEKGIIDKRLRFNSVPNCITFHPKDKNQLVVGLSNSEIRHYDL 250

Query: 102 EL------LAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQE 155
            L      +   + H+  +  + +  DG  L + S DK+V IWE +      + IS   +
Sbjct: 251 RLSENHGEVQKYDHHQGSILALKYFPDGKKLISSSEDKTVRIWE-NRINIPIKQISGTAQ 309

Query: 156 HSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDD-DWECAAVLTGHEGTIWCSDFSKEED 214
           HS  +  +  + +     + S D+T+  +               GH  T +   F+   D
Sbjct: 310 HS--MPWIDINPQGQSFCTQSMDNTIYTYSMLPKYKRHPNKTFKGHNTTGYGIHFAFSPD 367

Query: 215 PIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSP--SGRIASVG 272
              + SG       +W       D +   + +   P ++   +  + W+P  + ++   G
Sbjct: 368 GQYIASGDSKGQTFIW-------DWKTTKLLKKFKPFSNNLPVTCIEWNPQETSKLCCAG 420

Query: 273 ADGVLAV 279
             G +A+
Sbjct: 421 NTGKIAI 427

>Scas_469.3
          Length = 624

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 83/182 (45%), Gaps = 24/182 (13%)

Query: 110 HENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTK- 168
           H+ E+ G+S+  DG  LA+   D +V IW+T  +  ++    + + H+  VK + W    
Sbjct: 392 HQGEICGLSYKSDGLQLASGGNDNTVMIWDTRTSMPQW----IKRNHNAAVKALSWCPYI 447

Query: 169 HNLLASSS--YDDTVRIWKDYDDDWECAAVLTG------HEGTIWCSDFSKEEDPIRLCS 220
            NLLA+     D  +  W +     +  ++ +G      H G  + S+     + I    
Sbjct: 448 PNLLATGGGQTDKYIHFW-NSTTGAKMGSINSGSQVSSLHWGQSYNSNGVMNRE-IVATG 505

Query: 221 GSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRI-ASVGADGVLAV 279
           G+ D+ + V+ Y      D +  V E  + +AH ++I     SP G + A+VG D  L  
Sbjct: 506 GNPDNAISVFNY------DTKYKVAE--INHAHEARICCSQLSPDGTVLATVGGDENLKF 557

Query: 280 YK 281
           YK
Sbjct: 558 YK 559

 Score = 32.0 bits (71), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 77/197 (39%), Gaps = 33/197 (16%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIW-TQSDLDLEEGAKLEMELLAIIEGHENEVKG 116
           H+  +  ++++     LA+G  D+T+ IW T++ +              I   H   VK 
Sbjct: 392 HQGEICGLSYKSDGLQLASGGNDNTVMIWDTRTSMP-----------QWIKRNHNAAVKA 440

Query: 117 ISW-SQDGCLLATCS--RDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHN--- 170
           +SW      LLAT     DK +  W +    +    +  +   SQ V  + W   +N   
Sbjct: 441 LSWCPYIPNLLATGGGQTDKYIHFWNSTTGAK----MGSINSGSQ-VSSLHWGQSYNSNG 495

Query: 171 -----LLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDS 225
                ++A+    D      +YD  ++ A +   HE  I CS  S   D   L +   D 
Sbjct: 496 VMNREIVATGGNPDNAISVFNYDTKYKVAEINHAHEARICCSQLS--PDGTVLATVGGDE 553

Query: 226 TVRVWKYIGDDEDDQQE 242
            ++ +K     E  QQE
Sbjct: 554 NLKFYKVF---EPIQQE 567

>Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement
          Length = 314

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 78/195 (40%), Gaps = 32/195 (16%)

Query: 50  LDVLDDTVHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEG 109
           L     T H +++  + W P S  +A  S D TI I             +    L  + G
Sbjct: 47  LSAFIPTSHVESMSDICWSPDSQCIATASDDFTIEI-----------NHITYGRLHRLVG 95

Query: 110 HENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHV-VWHTK 168
           H   V  + ++  G LL + S D+S+ IW+    G   + IS    HS+ V  + +    
Sbjct: 96  HTAPVLSLVYTSKGNLLCSASMDESIKIWDV-LTGTLLKTIS---AHSEPVVSIDMPVCD 151

Query: 169 HNLLASSSYDDTVRIWK----------DYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRL 218
            ++L+S SYD  +RI+            YD DW+         G +  S      +   L
Sbjct: 152 PSILSSGSYDGLIRIFDTTTGHCLKTLTYDKDWK------SENGVVPISQVKFSVNGKYL 205

Query: 219 CSGSDDSTVRVWKYI 233
              S D  +++W +I
Sbjct: 206 LVKSLDGVLKIWDFI 220

>CAGL0K00275g complement(25300..27447) similar to sp|P36037
           Saccharomyces cerevisiae YKL213c DOA1, hypothetical
           start
          Length = 715

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 72/167 (43%), Gaps = 26/167 (15%)

Query: 68  RPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLA 127
           R  + LL + S+D T  IW        +  KL+ +L      HE  V   +   D  +L 
Sbjct: 109 RFQNGLLLSSSWDKTAKIW--------DNNKLKYDL----RNHEASVWDSTMVSDDIIL- 155

Query: 128 TCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDY 187
           T S DKS+ +W       E + I  L     DV   + +  +++ AS S D T+++    
Sbjct: 156 TASADKSIGVW------MEGKLIKKLSNIHDDVIRHLEYISNDIFASCSNDGTIKLL--- 206

Query: 188 DDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIG 234
           + + E   V  GHE  ++C           L S  +DSTVR+W   G
Sbjct: 207 NLEGEIKNVFEGHESFVYCVKHMNN----TLFSCGEDSTVRIWSING 249

 Score = 36.6 bits (83), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 60/245 (24%), Positives = 92/245 (37%), Gaps = 63/245 (25%)

Query: 102 ELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQE------ 155
           +L A + GH  +VK I+   D  + A+ SRD S+ +W    +G+ +E + V Q       
Sbjct: 3   QLSATLRGHSQDVKDITAVNDNKI-ASVSRDGSLRVWTRSSSGD-WEDVLVYQSDKFLNA 60

Query: 156 ----------------------HSQDV--------KHVVWHT--------KHNLLASSSY 177
                                 H +DV          +V HT        ++ LL SSS+
Sbjct: 61  VCYDKTSQTVYYGGQDTLINGSHIEDVIGSSADPMYTLVGHTGNVCGLRFQNGLLLSSSW 120

Query: 178 DDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDE 237
           D T +IW    D+ +    L  HE ++W  D +   D I L + +D S + VW       
Sbjct: 121 DKTAKIW----DNNKLKYDLRNHEASVW--DSTMVSDDIILTASADKS-IGVW------- 166

Query: 238 DDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYKEKQNDSEVSEWEISAT 297
               E      L N H   I  + +  +   AS   DG + +   +     V E   S  
Sbjct: 167 ---MEGKLIKKLSNIHDDVIRHLEYISNDIFASCSNDGTIKLLNLEGEIKNVFEGHESFV 223

Query: 298 YKAAH 302
           Y   H
Sbjct: 224 YCVKH 228

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 2/47 (4%)

Query: 147 YECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIW-KDYDDDWE 192
           Y+  + L+ HSQDVK +      N +AS S D ++R+W +    DWE
Sbjct: 2   YQLSATLRGHSQDVKDIT-AVNDNKIASVSRDGSLRVWTRSSSGDWE 47

>Sklu_2317.3 YDR142C, Contig c2317 5804-6910
          Length = 368

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 66/146 (45%), Gaps = 30/146 (20%)

Query: 18  SIDFEPVRG-LLATGSTDRAIKVLQLK------NGKENLLDVLDDTVHKKAVRSVAWRP- 69
           + DF   R  ++ATG  D+ +K+  L+      N  +  + + +   H+ A+R V+W P 
Sbjct: 227 TCDFNKYRPHIVATGGVDKLVKIWDLRMVRKFSNPLQQPMSINEIPGHELAIRKVSWSPH 286

Query: 70  HSDLLAAGSFDSTISIW------------TQSDLDLEEGAKLEMELLAIIEGHENEVKGI 117
           HS+L+ + S+D T  +W              + +D  +G +       I   H   V G 
Sbjct: 287 HSNLVLSTSYDMTCRVWDDLSDSNGRPTGKTNSIDPTKGCRF------IFPHHTEFVFGA 340

Query: 118 SWS---QDGCLLATCSRDKSVWIWET 140
            WS   Q G  +A+ + D +V IW T
Sbjct: 341 DWSLWGQPG-YVASTAWDGNVCIWHT 365

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 52/127 (40%), Gaps = 21/127 (16%)

Query: 125 LLATCSRDKSVWIWET------DEAGEEYECISVLQEHSQDVKHVVWHTKH-NLLASSSY 177
           ++AT   DK V IW+           ++   I+ +  H   ++ V W   H NL+ S+SY
Sbjct: 237 IVATGGVDKLVKIWDLRMVRKFSNPLQQPMSINEIPGHELAIRKVSWSPHHSNLVLSTSY 296

Query: 178 DDTVRIWKDYDDD--------------WECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSD 223
           D T R+W D  D                 C  +   H   ++ +D+S    P  + S + 
Sbjct: 297 DMTCRVWDDLSDSNGRPTGKTNSIDPTKGCRFIFPHHTEFVFGADWSLWGQPGYVASTAW 356

Query: 224 DSTVRVW 230
           D  V +W
Sbjct: 357 DGNVCIW 363

 Score = 32.3 bits (72), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 55/119 (46%), Gaps = 19/119 (15%)

Query: 79  FDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISW-SQDGCL-----------L 126
           +D+ +++ T S+  L    KL    +  I+ H   V+  S+ +QDG             +
Sbjct: 20  YDNKLAVATGSNFGLVGNGKL---FILDIDPHGRMVESNSFLTQDGLFDVAWNEGHANQV 76

Query: 127 ATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWH-TKHNLLASSSYDDTVRIW 184
                D S+ +++ +    +Y  IS+ QEH ++V    W+        SSS+D TV+IW
Sbjct: 77  LAAQGDGSLRLFDINLP--QYP-ISIFQEHQKEVFSCNWNLVNKQTFVSSSWDGTVKIW 132

>Kwal_56.24163
          Length = 729

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 58/126 (46%), Gaps = 22/126 (17%)

Query: 65  VAWRPH-SDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWS--- 120
           VA+ P      A+   D T+ IW+      +  A   ++         +E +G+++    
Sbjct: 3   VAFNPKDPSTFASACLDHTVKIWSLG----QPTANFTLQ--------AHETRGVNYVDYY 50

Query: 121 --QDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYD 178
             QD   L T S D++V IW+     +   C++ L+ H  +V + V+H    ++ S S D
Sbjct: 51  PLQDKPYLITSSDDRTVKIWDY----QTKSCVATLEGHMANVSYAVFHPSLPIILSGSED 106

Query: 179 DTVRIW 184
            T+++W
Sbjct: 107 GTLKVW 112

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 46/110 (41%), Gaps = 13/110 (11%)

Query: 172 LASSSYDDTVRIWKDYDDDWECAAVLTGHEGT-IWCSDFSKEEDPIRLCSGSDDSTVRVW 230
            AS+  D TV+IW            L  HE   +   D+   +D   L + SDD TV++W
Sbjct: 13  FASACLDHTVKIWSL--GQPTANFTLQAHETRGVNYVDYYPLQDKPYLITSSDDRTVKIW 70

Query: 231 KYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGA-DGVLAV 279
            Y        Q   C +TL   H + +    + PS  I   G+ DG L V
Sbjct: 71  DY--------QTKSCVATL-EGHMANVSYAVFHPSLPIILSGSEDGTLKV 111

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 45/100 (45%), Gaps = 11/100 (11%)

Query: 8   SLKLHNDK-VWSIDFEPV--RGLLATGSTDRAIKV--LQLKNGKENLLDVLDDTVHKKAV 62
           +L+ H  + V  +D+ P+  +  L T S DR +K+   Q K+    L        H   V
Sbjct: 35  TLQAHETRGVNYVDYYPLQDKPYLITSSDDRTVKIWDYQTKSCVATL------EGHMANV 88

Query: 63  RSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEME 102
               + P   ++ +GS D T+ +W  +   LE+   L +E
Sbjct: 89  SYAVFHPSLPIILSGSEDGTLKVWNSNTYKLEKTLNLGLE 128

>CAGL0L06952g complement(780793..781836) highly similar to sp|P40217
           Saccharomyces cerevisiae YMR146c TIF34 translation
           initiation factor eIF3, start by similarity
          Length = 347

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 68/149 (45%), Gaps = 22/149 (14%)

Query: 152 VLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSK 211
           VL  H + +  V ++ + +LL + S D +  +W  Y ++ E    L GH G+IW  D   
Sbjct: 5   VLMGHERPLTQVKYNREGDLLFTCSKDISASVW--YSNNGERLGTLDGHMGSIWSID--S 60

Query: 212 EEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASV 271
           +   +   +GS D T++VW  +  +    Q W C   +          V +SP G+    
Sbjct: 61  DHTSLYCVTGSADYTIKVWTLM--NGQCVQTWNCPVPVKR--------VEFSPCGKYILA 110

Query: 272 GADGVLA------VYKEKQND--SEVSEW 292
             D V+       +Y+ K+N   +E++E+
Sbjct: 111 ILDNVMKKPGSIEIYEVKRNPETNEITEF 139

 Score = 35.4 bits (80), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 69/195 (35%), Gaps = 48/195 (24%)

Query: 8   SLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGK--------------------E 47
           +L  H   +WSID +       TGS D  IKV  L NG+                    +
Sbjct: 47  TLDGHMGSIWSIDSDHTSLYCVTGSADYTIKVWTLMNGQCVQTWNCPVPVKRVEFSPCGK 106

Query: 48  NLLDVLDDTVHKKA---VRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELL 104
            +L +LD+ + K     +  V   P ++ +     +   SI T   LD    A    E  
Sbjct: 107 YILAILDNVMKKPGSIEIYEVKRNPETNEITEFVEEPIHSIVTHEGLDAASVAGWSGEGK 166

Query: 105 AIIEG-----------------------HENEVKGISWSQDGCLLATCSRDKSVWI--WE 139
            II G                       H++ V  + +S D     TCSRD +  I   E
Sbjct: 167 YIIAGHKDGKISKYDTQDGYKLVESQQVHKDSVSDLQFSPDRTYFITCSRDSNAHIIDIE 226

Query: 140 TDEAGEEYECISVLQ 154
           T +  + YE  S L 
Sbjct: 227 TFKVLKTYETDSPLN 241

>YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of
           the WD (WD-40) repeat family that binds to substrates
           (CLB2, CLB3, CDC5, HSL1) of the anaphase promoting
           complex (APC) and targets them for degradation [1701 bp,
           566 aa]
          Length = 566

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 87/193 (45%), Gaps = 24/193 (12%)

Query: 1   MPLQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKK 60
           MP    ++++ H  +V  + +      LA+G  D  + V +    K  +L   D+  HK 
Sbjct: 373 MPDPFFETIESHTQEVCGLKWNVADNKLASGGNDNVVHVYE-GTSKSPIL-TFDE--HKA 428

Query: 61  AVRSVAWRPHSDLLAA---GSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGI 117
           AV+++AW PH   + A   G+ D  + IW              +++  I  G  +++  +
Sbjct: 429 AVKAMAWSPHKRGVLATGGGTADRRLKIW---------NVNTSIKMSDIDSG--SQICNM 477

Query: 118 SWSQDGCLLATCS--RDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASS 175
            WS++   L T       ++ +W+ +      + I++L+ HS  V H+        + S 
Sbjct: 478 VWSKNTNELVTSHGYSKYNLTLWDCNS----MDPIAILKGHSFRVLHLTLSNDGTTVVSG 533

Query: 176 SYDDTVRIWKDYD 188
           + D+T+R WK +D
Sbjct: 534 AGDETLRYWKLFD 546

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 57/247 (23%), Positives = 86/247 (34%), Gaps = 71/247 (28%)

Query: 41  QLKNGKENLLDVLDDTVHKKAVRSVA----------WRPHSDLLAAGSFDSTISIWTQSD 90
            L  G+ N L  + D + +K +R+++          W  H  +L +GS D  I       
Sbjct: 316 HLAVGQANGLVEIYDVMKRKCIRTLSGHIDRVACLSWNNH--VLTSGSRDHRI------- 366

Query: 91  LDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECI 150
             L    ++       IE H  EV G+ W+     LA+   D  V ++E    G     I
Sbjct: 367 --LHRDVRMPDPFFETIESHTQEVCGLKWNVADNKLASGGNDNVVHVYE----GTSKSPI 420

Query: 151 SVLQEHSQDVKHVVWHT-KHNLLASS--SYDDTVRIWK--------DYDDD--------- 190
               EH   VK + W   K  +LA+   + D  ++IW         D D           
Sbjct: 421 LTFDEHKAAVKAMAWSPHKRGVLATGGGTADRRLKIWNVNTSIKMSDIDSGSQICNMVWS 480

Query: 191 -------------------WEC-----AAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDST 226
                              W+C      A+L GH   +     S   D   + SG+ D T
Sbjct: 481 KNTNELVTSHGYSKYNLTLWDCNSMDPIAILKGHSFRVLHLTLS--NDGTTVVSGAGDET 538

Query: 227 VRVWKYI 233
           +R WK  
Sbjct: 539 LRYWKLF 545

>AFL007C [3186] [Homologous to ScYGL003C (CDH1) - SH]
           (424004..425659) [1656 bp, 551 aa]
          Length = 551

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 84/192 (43%), Gaps = 24/192 (12%)

Query: 1   MPLQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKK 60
           MP    ++   H+ +V  + +      LA+G  D  + V    + K     VL  T H  
Sbjct: 358 MPEHYFETANTHSQEVCGLKWNVDENRLASGGNDNVVYVYDGPSKKP----VLKFTEHNA 413

Query: 61  AVRSVAWRPHSDLLAA---GSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGI 117
           AV+++AW PH     A   G+ D  + IW     ++  G +L      +  G  ++V  +
Sbjct: 414 AVKAMAWSPHRRATLATGGGTADRRLKIW-----NVNSGVRLN----DVDTG--SQVCNM 462

Query: 118 SWSQDGCLLATCS--RDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASS 175
            WS++   + T       ++ +W+        E ++VL+ HS  V H+   T    + S 
Sbjct: 463 VWSKNTDEIVTSHGYSKFNLTLWDC----PTLEPLAVLKGHSFRVLHLTLSTDGTTIVSG 518

Query: 176 SYDDTVRIWKDY 187
           + D+T+R WK +
Sbjct: 519 AGDETLRYWKLF 530

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 57/255 (22%), Positives = 91/255 (35%), Gaps = 71/255 (27%)

Query: 41  QLKNGKENLLDVLDDTVHKKAVRSVA----------WRPHSDLLAAGSFDSTISIWTQSD 90
            L  G  N L  L D V +K +R+++          W  H  +L++GS D  I       
Sbjct: 301 HLAVGLGNGLVELHDVVKQKCIRTLSGHLDRVACLSWNQH--ILSSGSKDHKI------- 351

Query: 91  LDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECI 150
             L    ++          H  EV G+ W+ D   LA+   D  V++++    G   + +
Sbjct: 352 --LHRDVRMPEHYFETANTHSQEVCGLKWNVDENRLASGGNDNVVYVYD----GPSKKPV 405

Query: 151 SVLQEHSQDVKHVVW--HTKHNL-LASSSYDDTVRIW----------------------- 184
               EH+  VK + W  H +  L     + D  ++IW                       
Sbjct: 406 LKFTEHNAAVKAMAWSPHRRATLATGGGTADRRLKIWNVNSGVRLNDVDTGSQVCNMVWS 465

Query: 185 KDYDDD-------------WECA-----AVLTGHEGTIWCSDFSKEEDPIRLCSGSDDST 226
           K+ D+              W+C      AVL GH   +     +   D   + SG+ D T
Sbjct: 466 KNTDEIVTSHGYSKFNLTLWDCPTLEPLAVLKGHSFRVL--HLTLSTDGTTIVSGAGDET 523

Query: 227 VRVWKYIGDDEDDQQ 241
           +R WK  G  +   Q
Sbjct: 524 LRYWKLFGKSKFGNQ 538

>KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46, start by
           similarity
          Length = 434

 Score = 44.3 bits (103), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 88/231 (38%), Gaps = 24/231 (10%)

Query: 2   PLQLAKSLKLHNDKVWSIDFEPVRGL-LATGSTDRAIKVLQLKNGKENLLDVLDDTVHKK 60
           P +L+K +  H   V  +  +PV     ATGS D  IK+  L  GK  +  +     H  
Sbjct: 111 PWKLSKVINGHTGWVRCVCVDPVDNEWFATGSNDTTIKIWDLAAGKLKITLI----GHVM 166

Query: 61  AVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWS 120
           +VR +A       + + S D  +  W     DLE    +         GH + V  +   
Sbjct: 167 SVRDIAISKRHPYMFSASEDKLVKCW-----DLERNTAIRD-----FHGHLSGVHTVDVH 216

Query: 121 QDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDT 180
               ++AT  RD  V +W+     E    I VL  H   +  V        + S S D T
Sbjct: 217 PSLDIIATAGRDAVVRLWDIRSRSE----IMVLPGHKSPINKVKCLPVDPQIISCSGDAT 272

Query: 181 VRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWK 231
           VR+W       + + VLT H   I   D +         S S +  VR WK
Sbjct: 273 VRLWDIIAG--KASKVLTHHSRNI--RDLTLHPAEFSFASVSTND-VRSWK 318

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 33/76 (43%), Gaps = 7/76 (9%)

Query: 158 QDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIR 217
           Q V+ V       +     Y+ T      +   W+ + V+ GH G + C       DP+ 
Sbjct: 79  QLVRRVFQQPHQQISLMERYEKTRSYKPQWHAPWKLSKVINGHTGWVRCVCV----DPVD 134

Query: 218 ---LCSGSDDSTVRVW 230
                +GS+D+T+++W
Sbjct: 135 NEWFATGSNDTTIKIW 150

>YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein
           required for the second catalytic step of mRNA splicing,
           member of WD (WD-40) repeat family [1368 bp, 455 aa]
          Length = 455

 Score = 44.3 bits (103), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 51/267 (19%), Positives = 96/267 (35%), Gaps = 43/267 (16%)

Query: 1   MPLQLAKSLKLHNDKVWSIDFEPVRG-LLATGSTDRAIKVLQLKNGKENLLDVLDDTVHK 59
           +P ++ ++   H +   ++ F P  G L+ +G  D  IK+    +  E L D      H 
Sbjct: 150 LPKKVIRNYPGHPEGTTALKFLPKTGHLILSGGNDHTIKIWDFYHDYECLRDFQG---HN 206

Query: 60  KAVRSVAWRPHSDLLAAGSFDSTISIW---------------TQSDLDLEEGAKLEM--- 101
           K ++++ +        + SFD ++ IW               T +D++       E    
Sbjct: 207 KPIKALRFTEDCQSFLSSSFDRSVKIWDTETGKVKTRLHLNSTPADVESRPTNPHEFIVG 266

Query: 102 -----------------ELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAG 144
                             L+   + H + +  + +  DG    + S DK+V IWE ++  
Sbjct: 267 LSNSKILHYDDRVSENQGLVQTYDHHLSSILALKYFPDGSKFISSSEDKTVRIWE-NQIN 325

Query: 145 EEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWK-DYDDDWECAAVLTGHEGT 203
              + IS   +HS    +V  H   N   + S D+ +  +            +  GH   
Sbjct: 326 VPIKQISDTAQHSMPFLNV--HPSQNYFCAQSMDNRIYSFSLKPKYKRHPKKIFKGHSSA 383

Query: 204 IWCSDFSKEEDPIRLCSGSDDSTVRVW 230
            +    +   D   +CSG   S +  W
Sbjct: 384 GYGISLAFSGDGRYICSGDSKSRLFTW 410

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 51/227 (22%), Positives = 97/227 (42%), Gaps = 27/227 (11%)

Query: 90  DLDLEE-----GAKLEMELLAIIEGHENEVKGISW-SQDGCLLATCSRDKSVWIWETDEA 143
           D+DL E        L  +++    GH      + +  + G L+ +   D ++ IW+    
Sbjct: 136 DVDLREERISFRCYLPKKVIRNYPGHPEGTTALKFLPKTGHLILSGGNDHTIKIWD---F 192

Query: 144 GEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTG-HEG 202
             +YEC+   Q H++ +K + +        SSS+D +V+IW     D E   V T  H  
Sbjct: 193 YHDYECLRDFQGHNKPIKALRFTEDCQSFLSSSFDRSVKIW-----DTETGKVKTRLHLN 247

Query: 203 TIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAW 262
           +      S+  +P     G  +S +  +    DD   + + + ++   + H S I  + +
Sbjct: 248 STPADVESRPTNPHEFIVGLSNSKILHY----DDRVSENQGLVQTY--DHHLSSILALKY 301

Query: 263 SPSG-RIASVGADGVLAVYKEKQNDSEVSEWEISATYKAAHTVYEIN 308
            P G +  S   D  + +++ + N   V   +IS T  A H++  +N
Sbjct: 302 FPDGSKFISSSEDKTVRIWENQIN---VPIKQISDT--AQHSMPFLN 343

>Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement
          Length = 711

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 91/222 (40%), Gaps = 64/222 (28%)

Query: 102 ELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEA---------GEEY---EC 149
           +L A ++GHE +VK +    D   +A+CSRD +V +W  ++           E++    C
Sbjct: 3   KLSADLKGHEQDVKSVVAINDS-QVASCSRDGTVRVWSNNDGVWNGVIAHNSEKFINSLC 61

Query: 150 -------------------ISVLQEHSQD-VKHVVWH--------TKHNLLASSSYDDTV 181
                              IS L    +D V  ++ H        +K+N + SSS+D T 
Sbjct: 62  YDKSSQLLFYGGQDTLVGGISPLATTDEDPVYMLIGHKGNVCSLSSKNNFVISSSWDKTA 121

Query: 182 RIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW---KYIGDDED 238
           ++W +    ++    L GH  ++W + F  E+D     + S D T+++W   K I     
Sbjct: 122 KVWHNGSAIYD----LVGHSASVWDAKFLPEKD--FFLTASADCTIKLWHGNKLI----- 170

Query: 239 DQQEWVCESTLPNAHRSQIYGVAWSPSGR-IASVGADGVLAV 279
                    T    H+  I  +  SP G   AS   DG + +
Sbjct: 171 --------KTFSGIHKDVIRHLDISPDGETFASCSNDGTVKI 204

 Score = 32.0 bits (71), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 147 YECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDW 191
           Y+  + L+ H QDVK VV     + +AS S D TVR+W + D  W
Sbjct: 2   YKLSADLKGHEQDVKSVV-AINDSQVASCSRDGTVRVWSNNDGVW 45

>YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa
           subunit of elongator and elongating RNA polymerase II
           holoenzyme, has WD (WD-40) repeats [2367 bp, 788 aa]
          Length = 788

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 63/139 (45%), Gaps = 8/139 (5%)

Query: 103 LLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKH 162
           + A ++GHE EV  + +  D   + + S D  V IW+  +     +CI  +Q +S+ +  
Sbjct: 51  VYATLKGHEAEVTCVRFVPDSDFMVSASEDHHVKIWKFTDYS-HLQCIQTIQHYSKTI-- 107

Query: 163 VVWHTKHNLLASSSYDDTVRIWKD--YDDDWECAAVLTGHEGTIW--CSDFSK-EEDPIR 217
           V      +L++    D T+ IW+    +D++  A   T  +G  +  C   SK EE    
Sbjct: 108 VALSALPSLISVGCADGTISIWRQNIQNDEFGLAHEFTIKKGFFYPLCLSLSKVEEKKYL 167

Query: 218 LCSGSDDSTVRVWKYIGDD 236
           L  G  +  V +  +I  D
Sbjct: 168 LAIGGTNVNVFIASFILSD 186

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 82/203 (40%), Gaps = 32/203 (15%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGI 117
           H+  V  V + P SD + + S D  + IW  +D          ++ +  I+ +   +  +
Sbjct: 58  HEAEVTCVRFVPDSDFMVSASEDHHVKIWKFTDYS-------HLQCIQTIQHYSKTI--V 108

Query: 118 SWSQDGCLLATCSRDKSVWIW----ETDEAGEEYE-----------CISVLQEHSQDVKH 162
           + S    L++    D ++ IW    + DE G  +E           C+S+ +   +    
Sbjct: 109 ALSALPSLISVGCADGTISIWRQNIQNDEFGLAHEFTIKKGFFYPLCLSLSKVEEKKYLL 168

Query: 163 VVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDP--IRLCS 220
            +  T  N+  +S       I K         A L GHE  +    F  +E P    LCS
Sbjct: 169 AIGGTNVNVFIASFILSDSGIEK-----CRVVAELEGHEDWVKSLAFRHQETPGDYLLCS 223

Query: 221 GSDDSTVRVWKY-IGDDEDDQQE 242
           GS D  +R+W+  I D  DD +E
Sbjct: 224 GSQDRYIRLWRIRINDLIDDSEE 246

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 61/276 (22%), Positives = 100/276 (36%), Gaps = 71/276 (25%)

Query: 22  EPVRGLLATGSTDRAIKVLQL---KNGKENLLDVLDDTVHKKAVRSVAWR----PHSDLL 74
           E  + LLA G T+  + +       +G E    V +   H+  V+S+A+R    P   LL
Sbjct: 162 EEKKYLLAIGGTNVNVFIASFILSDSGIEKCRVVAELEGHEDWVKSLAFRHQETPGDYLL 221

Query: 75  AAGSFDSTISIW-----------------------TQSDLDLEEGAKLEMELLAIIEGHE 111
            +GS D  I +W                        Q    +++  ++ +   A+I GH+
Sbjct: 222 CSGSQDRYIRLWRIRINDLIDDSEEDSKKLTLLSNKQYKFQIDDELRVGINFEALIMGHD 281

Query: 112 NEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNL 171
           + +  + W +    L   + D S+ +WE DE    + C   L E S              
Sbjct: 282 DWISSLQWHESRLQLLAATADTSLMVWEPDETSGIWVCSLRLGEMSS------------- 328

Query: 172 LASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIW-CSDFSKEEDPIRLCSGSDDSTVRVW 230
                               + A+  TG  G  W C  F+ E     L +G   S  R+W
Sbjct: 329 --------------------KGASTATGSSGGFWSCLWFTHERMDFFLTNGKTGSW-RMW 367

Query: 231 KYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSG 266
               +   DQ+  +  +T        +  +AWSPSG
Sbjct: 368 ATKDNIICDQRLGISGAT------KDVTDIAWSPSG 397

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 65/283 (22%), Positives = 112/283 (39%), Gaps = 54/283 (19%)

Query: 8   SLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAW 67
           +LK H  +V  + F P    + + S D  +K+ +  +     L  +  T+   +   VA 
Sbjct: 54  TLKGHEAEVTCVRFVPDSDFMVSASEDHHVKIWKFTDYSH--LQCIQ-TIQHYSKTIVAL 110

Query: 68  RPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWS---QDGC 124
                L++ G  D TISIW Q+  + E G   E     I +G    +  +S S   +   
Sbjct: 111 SALPSLISVGCADGTISIWRQNIQNDEFGLAHE---FTIKKGFFYPL-CLSLSKVEEKKY 166

Query: 125 LLATCSRDKSVWIWE---TDEAGEEYECISVLQEHSQDVKHVVWHTKHN----LLASSSY 177
           LLA    + +V+I     +D   E+   ++ L+ H   VK + +  +      LL S S 
Sbjct: 167 LLAIGGTNVNVFIASFILSDSGIEKCRVVAELEGHEDWVKSLAFRHQETPGDYLLCSGSQ 226

Query: 178 DDTVRIWK----DYDDDWE---------------------------CAAVLTGHEGTIWC 206
           D  +R+W+    D  DD E                             A++ GH+   W 
Sbjct: 227 DRYIRLWRIRINDLIDDSEEDSKKLTLLSNKQYKFQIDDELRVGINFEALIMGHDD--WI 284

Query: 207 SDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTL 249
           S     E  ++L + + D+++ VW    + ++    WVC   L
Sbjct: 285 SSLQWHESRLQLLAATADTSLMVW----EPDETSGIWVCSLRL 323

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/88 (21%), Positives = 41/88 (46%), Gaps = 3/88 (3%)

Query: 101 MELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYEC-ISVLQEHSQD 159
           +E+   +  H   +  + +S+DG  L +  RD+   +WE +     +E      + H++ 
Sbjct: 596 LEIKPALPFHSLTITRLKFSKDGKFLLSVCRDRKWALWERNMEDNTFELRFKNEKPHTRI 655

Query: 160 VKHVVWHTKH--NLLASSSYDDTVRIWK 185
           +    W      N+  ++S D TV++W+
Sbjct: 656 IWDADWAPLEFGNVFVTASRDKTVKVWR 683

 Score = 29.3 bits (64), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 61/151 (40%), Gaps = 14/151 (9%)

Query: 107 IEGHENEVKGISWSQDGCLLATCSRDKSVW-----IWETDEAGEEYECISVLQEHSQDVK 161
           + GH  E+  +  S D  L+A+  R  +V      I+ T+      E    L  HS  + 
Sbjct: 554 LYGHGFEITCLDISPDQKLIASACRSNNVQNAVIRIFSTENW---LEIKPALPFHSLTIT 610

Query: 162 HVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTG---HEGTIWCSDFSKEEDPIRL 218
            + +      L S   D    +W+   +D            H   IW +D++  E     
Sbjct: 611 RLKFSKDGKFLLSVCRDRKWALWERNMEDNTFELRFKNEKPHTRIIWDADWAPLEFGNVF 670

Query: 219 CSGSDDSTVRVWKYIGDDEDDQQEWVCESTL 249
            + S D TV+VW++  +  DD   +V E+++
Sbjct: 671 VTASRDKTVKVWRHQKEPADD---YVLEASI 698

>Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement
          Length = 555

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 55/242 (22%), Positives = 91/242 (37%), Gaps = 53/242 (21%)

Query: 45  GKENLLDVLDDTVHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLD-LEEGAKLEMEL 103
           G+ N L  + D V +K +R+++   H D +A  S+++ I      D   L    ++    
Sbjct: 309 GQGNGLVEIYDIVKRKCIRTLSG--HMDRVACLSWNNHILTSGSRDRKILHRDVRMPEPY 366

Query: 104 LAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHV 163
              +E H  EV G+ W+ D   LA+   D  V++++    G   +    L EH+  VK +
Sbjct: 367 FEQVETHTQEVCGLKWNTDENRLASGGNDNVVYVYD----GTSRKPTLKLAEHTAAVKAI 422

Query: 164 VWHT-KHNLLASS--SYDDTVRIW--------KDYD------------------------ 188
            W   K  +LA+   + D  ++IW        +D D                        
Sbjct: 423 AWSPHKRGILATGGGTADKKMKIWNVNTSTKLRDIDTGSQVCNMIWSKNTNELVTSHGYS 482

Query: 189 ---------DDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDD 239
                       E  A+L GH   +     S   D   + SG+ D T+R WK     +  
Sbjct: 483 RYNLTLWDYPSMEPVAILKGHSFRVLHLTLS--ADGTTVVSGAGDETLRYWKLFDRPKPK 540

Query: 240 QQ 241
            Q
Sbjct: 541 AQ 542

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 86/199 (43%), Gaps = 36/199 (18%)

Query: 1   MPLQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKK 60
           MP    + ++ H  +V  + +      LA+G  D  + V    + K      L    H  
Sbjct: 362 MPEPYFEQVETHTQEVCGLKWNTDENRLASGGNDNVVYVYDGTSRKP----TLKLAEHTA 417

Query: 61  AVRSVAWRPHSDLLAA---GSFDSTISIW---TQSDL-DLEEGAKLEMELLAIIEGHENE 113
           AV+++AW PH   + A   G+ D  + IW   T + L D++ G+               +
Sbjct: 418 AVKAIAWSPHKRGILATGGGTADKKMKIWNVNTSTKLRDIDTGS---------------Q 462

Query: 114 VKGISWSQDGCLLATC---SR-DKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKH 169
           V  + WS++   L T    SR + ++W + +       E +++L+ HS  V H+      
Sbjct: 463 VCNMIWSKNTNELVTSHGYSRYNLTLWDYPS------MEPVAILKGHSFRVLHLTLSADG 516

Query: 170 NLLASSSYDDTVRIWKDYD 188
             + S + D+T+R WK +D
Sbjct: 517 TTVVSGAGDETLRYWKLFD 535

>Scas_571.4
          Length = 601

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 88/199 (44%), Gaps = 34/199 (17%)

Query: 9   LKLHNDKVWSIDFEPVRGL-LATGSTDRAIKVLQL---------KNGKENLLDVLDDTV- 57
            + H  +V   DF+P     +A+ S D  I +  +         ++ +   +D+    + 
Sbjct: 85  FRGHKGQVLDTDFDPFNDFKIASASDDGKIGIWNIPMNYSMRTYRDSENKPMDIRPSKIL 144

Query: 58  --HKKAVRSVAWRPH-SDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEV 114
             H + V  V + P   ++LA+ S D T+ IW     ++++G     +++  ++ H + V
Sbjct: 145 SGHTRKVGHVLFHPRIRNVLASSSLDFTVKIW-----NIKKG-----KVIGTLQ-HSDMV 193

Query: 115 KGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHS-QDVKHVVWHTKHNLLA 173
             +++  DG  LAT +R+K + IW+        + +S  + H     + VVW     ++A
Sbjct: 194 TAMAFDPDGAYLATITRNKKLTIWDIASK----QIVSQTKSHQGPKNQRVVWLGYSRIIA 249

Query: 174 ----SSSYDDTVRIWKDYD 188
               S S D  + IW   D
Sbjct: 250 TTGFSKSMDREIGIWDALD 268

>CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces
           cerevisiae YBR175w, start by similarity
          Length = 316

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/190 (21%), Positives = 74/190 (38%), Gaps = 32/190 (16%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGI 117
           H   V  + W P    +A+ S D T+ +              ++ LL  + GH   V  +
Sbjct: 54  HAAGVSQICWSPDGKCIASCSDDFTVVV-----------THRQLGLLHRLVGHTAPVISL 102

Query: 118 SWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHV-VWHTKHNLLASSS 176
            ++  G LL T S D+S+ +W+          +  +  HS+ V  + +     ++L+S S
Sbjct: 103 CYNNKGNLLFTSSMDESIKVWDVLTG----TVMKTMSAHSEPVVSIDLSDNDGSILSSGS 158

Query: 177 YDDTVRIWK----------DYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDST 226
           +D  +RI+            YD DW+         G +  +      +   L   S D  
Sbjct: 159 HDGLIRIFDTATGHCLKTLTYDKDWQ------SETGVVPIAKVKFSANTKYLLVKSYDGV 212

Query: 227 VRVWKYIGDD 236
           V++W  +  D
Sbjct: 213 VKIWDSVSGD 222

>CAGL0C01441g complement(156930..159947) similar to tr|Q08924
           Saccharomyces cerevisiae YPL183c, start by similarity
          Length = 1005

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 61/280 (21%), Positives = 115/280 (41%), Gaps = 43/280 (15%)

Query: 79  FDSTISIWTQSDLDLEEGAKL---------EMELLAIIEGHENEVKGISWSQDGCLLATC 129
           +  +I + ++S++ +  G  +         + EL+  + GHE  +  I  S+   L+A+C
Sbjct: 138 YSGSIKVISESEVQINAGTVMGGAIVWDLYKEELIHNLTGHEGSIFYIQSSEHNKLIASC 197

Query: 130 SRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDD 189
           S D+S+ +W+  E G+E   +S+   H+  + ++ +      L S S D T R+W    +
Sbjct: 198 SDDRSIRLWDR-ETGKE---LSIGWSHTARIWNLKFFNNDENLVSVSEDCTCRVWNIIPN 253

Query: 190 D-----WECAAVLTGH-EGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEW 243
           D      + + +  GH    +W  D + E+  I   +  +D  + V   +  D +   E 
Sbjct: 254 DISGYELQISNIFEGHLLKNVWGVDVNDEKRII--ATSGNDGRINVID-LNTDTNSGDE- 309

Query: 244 VCESTLPNAHRSQ---------IYGVAWSPSGRIASVGADGVLAVYKEKQNDSEVSEWEI 294
           V    + +  ++          I G  W   G +       VLA   E +   +      
Sbjct: 310 VIGYEIADIEKAAGISFEKDEIIKGFYWFKFGLVCITSQGRVLAFQTETKQWRQCLLDSR 369

Query: 295 SATYKAAHTVYEINTVKWVN-----------IDGKEMLIT 323
            A+Y   + +YE N V + N           IDG E+ +T
Sbjct: 370 FASYSITNGIYESNIVFFTNNKCDILAMKFSIDGSEVKVT 409

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 70/281 (24%), Positives = 127/281 (45%), Gaps = 33/281 (11%)

Query: 57  VHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKG 116
            ++  +  +       + A G   S+ISI    D++ +    L  EL+      +  +  
Sbjct: 45  FNRNKIHGICISSEGKICAYGG--SSISILKLEDIN-QRREYLSNELVL-----DENITA 96

Query: 117 ISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQE----HSQDVKHVVWHTKHNLL 172
           I +S+DG  L   +    V I  TD  G+  E   ++ E    +S  +K V+  ++  + 
Sbjct: 97  IEFSKDGSKLYILTNYNKVLI--TDLTGKVVEEKKLVGERSILYSGSIK-VISESEVQIN 153

Query: 173 ASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKY 232
           A +     + +W  Y +  E    LTGHEG+I+    S+    I  CS  DD ++R+W  
Sbjct: 154 AGTVMGGAI-VWDLYKE--ELIHNLTGHEGSIFYIQSSEHNKLIASCS--DDRSIRLW-- 206

Query: 233 IGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSG-RIASVGADGVLAVYKEKQNDSEVSE 291
             D E  +     E ++  +H ++I+ + +  +   + SV  D    V+    ND    E
Sbjct: 207 --DRETGK-----ELSIGWSHTARIWNLKFFNNDENLVSVSEDCTCRVWNIIPNDISGYE 259

Query: 292 WEISATYKAAHTVYEINTVKWVNIDGKEMLITAGDDGRVNL 332
            +IS  ++  H +  +  V  VN D K ++ T+G+DGR+N+
Sbjct: 260 LQISNIFEG-HLLKNVWGVD-VN-DEKRIIATSGNDGRINV 297

>Kwal_27.11126
          Length = 996

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 58/274 (21%), Positives = 117/274 (42%), Gaps = 37/274 (13%)

Query: 79  FDSTISIWTQSDLDLEEGAKLEMELLAIIEG---------HENEVKGISWSQDGCLLATC 129
           +  TI++++Q  + +  G  ++  ++  +E          HE  +  ++ S++G   A+C
Sbjct: 140 YSGTITVYSQDKVHINAGTVMDGVIVWDLESEQNLHHFTDHEGAIFFVTASKNGKYAASC 199

Query: 130 SRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDD 189
           S D+S+ +W+        + +S    H+  + ++++    + + S S D T R+W   +D
Sbjct: 200 SDDRSIKLWDLKSG----QLLSTAWGHTARIWNLLFFDNDSKVISVSEDCTCRVWDISED 255

Query: 190 DWECAAVLTGHEG----TIWCSDFSKEEDPIRLCSGSDD----STVRVWKYIGDDE-DDQ 240
           +    A +  HEG    ++W  D   E   I   SG+D     + ++    +GD+     
Sbjct: 256 NTLSQASV--HEGHLLKSVWGLDVDNER-MIAATSGNDGRIKLTDLKAKSRVGDETMSSS 312

Query: 241 QEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYKEKQ------NDSEVSEWEI 294
            E +  + +    +  I G  W   G IA      VL   +  +      NDS  S + I
Sbjct: 313 LEDIEAAGVAMKPKEIIKGFHWFKFGLIAMTSEGQVLKFEQSSKKWSSILNDSTFSNYSI 372

Query: 295 SATYKAAHTVYEINTVKWVNIDGKEMLITAGDDG 328
           +A  +      E+N + + +     ++I   DDG
Sbjct: 373 TAGLQ------ELNLIVFCSSQCDLLVIKFNDDG 400

>Kwal_55.21450
          Length = 503

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 67/324 (20%), Positives = 117/324 (36%), Gaps = 63/324 (19%)

Query: 1   MPLQLAKSLKLHNDKVWSIDFEPVRG-LLATGSTDRAIKVLQLKNGKENLLDVLDDTVHK 59
           +P +L  +   H +   SI   P  G L  +   D  +K+  L   +E L D      H 
Sbjct: 198 LPKKLIHTYPGHKNGTNSILLLPKSGHLCLSAGNDNQVKIWDLYRDRELLRDYRG---HS 254

Query: 60  KAVRSVAWRPHSDLLAAGSFDSTISIW--------------------------------- 86
           KAVR +++        + SFD  I IW                                 
Sbjct: 255 KAVRGISFNSEGSEFLSVSFDQQIKIWDTETGKVRHQYSYSCIPNCAEFRPSNSNEFIVG 314

Query: 87  -TQSDL---DLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDE 142
            + S++   DL    K    L+ + + H + +  + +  DG    + S DKS+ IWE ++
Sbjct: 315 LSNSEIRHYDLRTSHK--NGLVQVYDHHLSSIIALKYFPDGSKFVSSSEDKSMRIWE-NQ 371

Query: 143 AGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDD-DWECAAVLTGHE 201
                + IS   ++S  + ++  H + N  A+ S D+ +  +              +GH+
Sbjct: 372 INIPIKQISDTSQYS--MPYIGIHPEQNYFAAQSMDNAIYAFSMKPKYKRHPKKHFSGHK 429

Query: 202 GTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPN---AHRSQIY 258
              +   F    D   + SG     V +W           +W     L +     +  I 
Sbjct: 430 CAGFGIGFGFSPDGQYIASGDTRGRVYIW-----------DWKTTHLLKHFDVPDKKTIV 478

Query: 259 GVAWSP--SGRIASVGADGVLAVY 280
            VAWSP  + ++   G  G + +Y
Sbjct: 479 TVAWSPQETSKMLCSGNGGEIFLY 502

>KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1
           Kluyveromyces lactis heterotrimeric G protein beta
           subunit, start by similarity
          Length = 436

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 62/136 (45%), Gaps = 10/136 (7%)

Query: 98  KLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHS 157
           +L ++ +  ++GH N++  + WSQD   + + S+D  + IW+    G +   I +L   S
Sbjct: 73  ELNLQPVRTLKGHNNKISDVKWSQDSASVLSSSQDGFIIIWDP-FTGLKKSAIPLL---S 128

Query: 158 QDVKHVVWHTKHNLLASSSYDD---TVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEED 214
           Q V         NL+AS+  D+     R+ +D        ++  GH   I  ++F  E  
Sbjct: 129 QWVLSSAISPSGNLVASAGLDNHCSVYRVSRDNRIQQNVISIFKGHTCYISATEFLDER- 187

Query: 215 PIRLCSGSDDSTVRVW 230
              + + S D T  +W
Sbjct: 188 --TILTASGDMTCAMW 201

 Score = 30.4 bits (67), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/89 (21%), Positives = 41/89 (46%), Gaps = 10/89 (11%)

Query: 50  LDVLDDTVHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEG 109
           L+  +  +  + V S+ +     L+ A   D   ++W     D+ +G     E++  ++G
Sbjct: 353 LNFKESCIEDQGVISIDFSSSGRLMYACYADYGCAVW-----DIIKG-----EMIGKVDG 402

Query: 110 HENEVKGISWSQDGCLLATCSRDKSVWIW 138
           H N +  +  S DG  + + S D ++ +W
Sbjct: 403 HRNRINAVKTSPDGMAVVSSSWDMTLKVW 431

>ADR176W [1917] [Homologous to ScYOR269W (PAC1) - SH]
           complement(1012413..1013798) [1386 bp, 461 aa]
          Length = 461

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 61/131 (46%), Gaps = 18/131 (13%)

Query: 58  HKKAVRSVAWRPHSD---LLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEV 114
           H K V S+A     +   L++  S D    IW+ +D           +LL  +  HE+ V
Sbjct: 162 HMKGVTSLAVMEAENGSLLISTTSKDLQCKIWSFTD-------NAAFQLLRTLSSHEHIV 214

Query: 115 KGISWSQDG--CLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLL 172
               + + G   LLATCSRD +V +W+T        CI   Q H+Q V+ +  H  +  +
Sbjct: 215 SQSCFLRSGSDLLLATCSRDLTVKVWDTKSGW----CIKSFQPHNQWVRTLELHGDY--V 268

Query: 173 ASSSYDDTVRI 183
            + S D T+R+
Sbjct: 269 ITGSNDATIRL 279

 Score = 29.6 bits (65), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 39/82 (47%), Gaps = 8/82 (9%)

Query: 171 LLASSSYDDTVRIWKDYDDD-WECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRV 229
           L++++S D   +IW   D+  ++    L+ HE  +  S F +    + L + S D TV+V
Sbjct: 180 LISTTSKDLQCKIWSFTDNAAFQLLRTLSSHEHIVSQSCFLRSGSDLLLATCSRDLTVKV 239

Query: 230 WKYIGDDEDDQQEWVCESTLPN 251
           W       D +  W  +S  P+
Sbjct: 240 W-------DTKSGWCIKSFQPH 254

>Scas_442.2*
          Length = 795

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 72/341 (21%), Positives = 122/341 (35%), Gaps = 63/341 (18%)

Query: 1   MPLQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQL-KNGKENLLDVLDDTV-- 57
           +PL LA S K+ +DK           LLA G T+  + V     N     ++ L      
Sbjct: 156 LPLALAFS-KVIDDKY----------LLAVGGTNVNVFVFSFVLNATAETIETLQLAAKL 204

Query: 58  --HKKAVRSVAWR----PHSDLLAAGSFDSTISIW------------------------- 86
             H+  ++S+A+R    P   LL +GS D  I +W                         
Sbjct: 205 EGHEDWIKSLAFRHQETPGDYLLCSGSQDRYIRLWRIRINDLMKKQDEDDEDIATKLALL 264

Query: 87  --TQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAG 144
              Q    + +  ++ +   A+I GH++ +  + W +    L   + D ++ +WE DEA 
Sbjct: 265 NNKQYKFHVTDALRVCINFEALIMGHDDWISSLQWHETRLQLLASTADTALMVWEPDEAS 324

Query: 145 EEYECISVLQEHSQDVKHV-----------VW--HTKHNLLASSSYDDTVRIWKDYDDDW 191
             + C   L E S                 +W  H   + + ++    + R+W   + + 
Sbjct: 325 GIWVCGLRLGELSSKGASTATGSAGGFWSCLWFSHQNKDYILTNGKTGSWRVWTTEEGNT 384

Query: 192 ECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRV---WKYIGDDEDDQQEWVCEST 248
            C   L     T   +D +       L S S D T R+   W Y  D          E +
Sbjct: 385 LCDQELGITGATKQVTDIAWSPKGEYLLSTSLDQTTRLFAPWIYNNDGTKRNTATWHEFS 444

Query: 249 LPNAHRSQIYGVAWSPSGRIASVGADGVLAVYKEKQNDSEV 289
            P  H   +  V      R  S G + +L  + E +  +E+
Sbjct: 445 RPQIHGYDMICVEPMSGARFVSGGDEKILRSFDEPKGVAEL 485

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 58/122 (47%), Gaps = 6/122 (4%)

Query: 166 HTKHNLLASSSYDDTVRIWKDYDDDWE-CAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDD 224
           H K +++A  +   T+ +W   D++ +   A L GHE  + C  F    D   + S S+D
Sbjct: 24  HAKTHIVAFGA-GQTIALWNPLDENSQGVFATLKGHEAEVTCVKFIT--DTPYMVSCSED 80

Query: 225 STVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYKEKQ 284
             V++WK       +   W C  TL + +   +  +A  P G IA   ADG ++++ +K 
Sbjct: 81  HHVKIWKQNPGVAREVDGWTCVQTL-DHYSHTVVALAVLP-GLIAVGCADGKVSLWVQKM 138

Query: 285 ND 286
            +
Sbjct: 139 KE 140

 Score = 36.2 bits (82), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 47/107 (43%), Gaps = 13/107 (12%)

Query: 82  TISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETD 141
           TI++W      L+E ++    + A ++GHE EV  + +  D   + +CS D  V IW+ +
Sbjct: 37  TIALWNP----LDENSQ---GVFATLKGHEAEVTCVKFITDTPYMVSCSEDHHVKIWKQN 89

Query: 142 EAGEE----YECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIW 184
                    + C+  L  +S  V  V       L+A    D  V +W
Sbjct: 90  PGVAREVDGWTCVQTLDHYSHTV--VALAVLPGLIAVGCADGKVSLW 134

 Score = 32.0 bits (71), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 54/134 (40%), Gaps = 11/134 (8%)

Query: 107 IEGHENEVKGISWSQDGCLLATCSRDKS-----VWIWETDEAGEEYECISVLQEHSQDVK 161
           + GH  E+  +  S DG  +A+  R  +     V I+ TD      E    L  H+  V 
Sbjct: 564 LYGHGYEITCLDVSPDGKFIASACRSNTPQHAVVRIFNTDNW---LEVKPPLAFHTLTVT 620

Query: 162 HVVWHTKHNLLASSSYDDTVRIW-KDYDDDWECAAVLTG--HEGTIWCSDFSKEEDPIRL 218
            + +      L S   D    +W +D + D       T   H   IW  D++  E     
Sbjct: 621 KLRFSPDSKYLLSVCRDRQWVVWERDPETDKFTLKYKTAKPHTRIIWDGDWAPLEFGNVF 680

Query: 219 CSGSDDSTVRVWKY 232
            +GS D T+++WK+
Sbjct: 681 VTGSRDRTIKLWKF 694

 Score = 29.3 bits (64), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 2/45 (4%)

Query: 7   KSLKLHNDKVWSIDFEPVR--GLLATGSTDRAIKVLQLKNGKENL 49
           K+ K H   +W  D+ P+    +  TGS DR IK+ +    K N 
Sbjct: 657 KTAKPHTRIIWDGDWAPLEFGNVFVTGSRDRTIKLWKFDENKSNF 701

>Kwal_47.17567
          Length = 590

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 85/192 (44%), Gaps = 24/192 (12%)

Query: 2   PLQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKA 61
           P    + ++ HN +V  + +      LA+G  D A+ V        + L  L    H  A
Sbjct: 398 PQSSFEEIRTHNQEVCGLKWNVEDNKLASGGNDNAVFVYD----GTSRLPFLKLEEHTAA 453

Query: 62  VRSVAWRPHSDLLAA---GSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGIS 118
           V+++AW PH   + A   G+ D  + IW     +++   KL     A      ++V  + 
Sbjct: 454 VKAMAWSPHRRGILATGGGTADKRLKIW-----NVKTSVKLHDVDTA------SQVCNMI 502

Query: 119 WSQDGCLLATCS--RDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSS 176
           WS++   + T       ++ +W+    G   E +++L+ HS  V H+   T    + S +
Sbjct: 503 WSKNTNEIITSHGYSKYNLTLWD----GNTLEPMAILKGHSFRVLHMTLSTDGTTVVSGA 558

Query: 177 YDDTVRIWKDYD 188
            D+T+R WK ++
Sbjct: 559 GDETLRYWKLFE 570

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 49/220 (22%), Positives = 92/220 (41%), Gaps = 27/220 (12%)

Query: 27  LLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHSDLLAAGSFDSTISIW 86
           +L +GS DR I    ++  + +  ++     H + V  + W    + LA+G  D+ + ++
Sbjct: 380 ILTSGSRDRRILHRDVRTPQSSFEEI---RTHNQEVCGLKWNVEDNKLASGGNDNAVFVY 436

Query: 87  TQSDLDLEEGAKLEMELLAIIEGHENEVKGISWS-QDGCLLATC--SRDKSVWIWETDEA 143
             +           +  L + E H   VK ++WS     +LAT   + DK + IW    +
Sbjct: 437 DGTS---------RLPFLKL-EEHTAAVKAMAWSPHRRGILATGGGTADKRLKIWNVKTS 486

Query: 144 GEEYECISVLQEHSQDVKHVVWHTKHN-LLASSSYDD-TVRIWKDYDDDWECAAVLTGHE 201
            + ++  +  Q     V +++W    N ++ S  Y    + +W    +  E  A+L GH 
Sbjct: 487 VKLHDVDTASQ-----VCNMIWSKNTNEIITSHGYSKYNLTLWDG--NTLEPMAILKGHS 539

Query: 202 GTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQ 241
             +     S   D   + SG+ D T+R WK     +   Q
Sbjct: 540 FRVLHMTLS--TDGTTVVSGAGDETLRYWKLFEKSKSQAQ 577

>YMR116C (ASC1) [4073] chr13
           complement(499455..499877,500151..500687) Ribosomal
           protein of the 40S ribosomal subunit that influences
           translational efficiency and cell size, contains two WD
           (WD-40) repeats [960 bp, 319 aa]
          Length = 319

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 102/241 (42%), Gaps = 34/241 (14%)

Query: 101 MELLAIIEGHENEVKGISWSQ-DGCLLATCSRDKSVWIWETDEAGEEYEC-ISVLQEHSQ 158
           + L   +EGH   V  ++ S     LL + SRDK++  W+     +++   +   + HS 
Sbjct: 7   LVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSH 66

Query: 159 DVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRL 218
            V+            S+S+D T+R+W       E      GH+  +   D  K+   I  
Sbjct: 67  IVQDCTLTADGAYALSASWDKTLRLWDVATG--ETYQRFVGHKSDVMSVDIDKKASMI-- 122

Query: 219 CSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGR-------IASV 271
            SGS D T++VW   G          C +TL   H   +  V   P+ +       I S 
Sbjct: 123 ISGSRDKTIKVWTIKGQ---------CLATLL-GHNDWVSQVRVVPNEKADDDSVTIISA 172

Query: 272 GADGVLAVYKEKQNDSEVSEWEISATYKAAHTVYEINTVKWVNIDGKEMLITAGDDGRVN 331
           G D ++  +        +++++I A +   ++   INT+   + DG  ++ +AG DG + 
Sbjct: 173 GNDKMVKAW-------NLNQFQIEADFIGHNS--NINTLT-ASPDG-TLIASAGKDGEIM 221

Query: 332 L 332
           L
Sbjct: 222 L 222

 Score = 37.0 bits (84), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 57/132 (43%), Gaps = 17/132 (12%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHS 71
           H   V S+D +    ++ +GS D+ IKV  +K   + L  +L        VR V      
Sbjct: 106 HKSDVMSVDIDKKASMIISGSRDKTIKVWTIKG--QCLATLLGHNDWVSQVRVVPNEKAD 163

Query: 72  D----LLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLA 127
           D    +++AG+ D  +  W  +   +E          A   GH + +  ++ S DG L+A
Sbjct: 164 DDSVTIISAGN-DKMVKAWNLNQFQIE----------ADFIGHNSNINTLTASPDGTLIA 212

Query: 128 TCSRDKSVWIWE 139
           +  +D  + +W 
Sbjct: 213 SAGKDGEIMLWN 224

 Score = 31.6 bits (70), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 40/208 (19%), Positives = 87/208 (41%), Gaps = 36/208 (17%)

Query: 76  AGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSV 135
           + S+D T+ +W     D+  G     E      GH+++V  +   +   ++ + SRDK++
Sbjct: 82  SASWDKTLRLW-----DVATG-----ETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTI 131

Query: 136 WIWETDEAGEEYECISVLQEHSQDVKH--VVWHTKHN----LLASSSYDDTVRIWKDYDD 189
            +W       + +C++ L  H+  V    VV + K +     + S+  D  V+ W    +
Sbjct: 132 KVWTI-----KGQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWN--LN 184

Query: 190 DWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTL 249
            ++  A   GH   I  +  +   D   + S   D  + +W               ++  
Sbjct: 185 QFQIEADFIGHNSNI--NTLTASPDGTLIASAGKDGEIMLWNLAAK----------KAMY 232

Query: 250 PNAHRSQIYGVAWSPSGR-IASVGADGV 276
             + + +++ +A+SP+   +A+  A G+
Sbjct: 233 TLSAQDEVFSLAFSPNRYWLAAATATGI 260

 Score = 29.3 bits (64), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 37/79 (46%), Gaps = 9/79 (11%)

Query: 14  DKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTV--HKKAVR----SVAW 67
           D+V+S+ F P R  LA  +T   IKV  L    + L+D L      + KA      S+AW
Sbjct: 238 DEVFSLAFSPNRYWLA-AATATGIKVFSLD--PQYLVDDLRPEFAGYSKAAEPHAVSLAW 294

Query: 68  RPHSDLLAAGSFDSTISIW 86
                 L AG  D+ I +W
Sbjct: 295 SADGQTLFAGYTDNVIRVW 313

>AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH]
           complement(1497416..1499560) [2145 bp, 714 aa]
          Length = 714

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 92/215 (42%), Gaps = 42/215 (19%)

Query: 74  LAAGSFDSTISIWTQ--SDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSR 131
           +A+GS D T+ +WT+  SD  L  GA        I+   E  V  + + ++  L+    +
Sbjct: 32  IASGSRDGTVRVWTRDTSDSRLWSGA--------ILHSTERYVNAVCYEENEQLVFFGGQ 83

Query: 132 DK-----SVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKD 186
           +      S  + E  +A        +L  HS +V       +   L SSS+D T R+W++
Sbjct: 84  EAVIGAVSPLVLEVQDASY------LLAGHSGNV--CALEARDGQLVSSSWDQTARVWRE 135

Query: 187 YDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCE 246
             ++      L+GH  T+W +  +   D  R  + S D T+++W    D   D   +   
Sbjct: 136 GTEE----RALSGHNATVWHA-LALGYD--RFLTASADKTIKLW----DGARDLATY--- 181

Query: 247 STLPNAHRSQIYGVAWSPSG-RIASVGADGVLAVY 280
               N H   +  +A +P G   AS   DG + V+
Sbjct: 182 ----NVHTDVVRHLALAPDGHHFASCSNDGSVKVH 212

 Score = 41.2 bits (95), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 52/212 (24%), Positives = 85/212 (40%), Gaps = 45/212 (21%)

Query: 74  LAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEV-KGISWSQDGCLLATCSRD 132
           L + S+D T  +W +     EE A         + GH   V   ++   D  L  T S D
Sbjct: 121 LVSSSWDQTARVWREGT---EERA---------LSGHNATVWHALALGYDRFL--TASAD 166

Query: 133 KSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWE 192
           K++ +W+       Y        H+  V+H+      +  AS S D +V++   +  D +
Sbjct: 167 KTIKLWDGARDLATYNV------HTDVVRHLALAPDGHHFASCSNDGSVKV---HTLDGK 217

Query: 193 CAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNA 252
                 GHE  ++C  +  +     L S  +D TVRVW   G     Q   +C ++L   
Sbjct: 218 TVRTFDGHESFVYCVKYLPDGG---LVSCGEDKTVRVWDMSGHVR--QVIRLCATSL--- 269

Query: 253 HRSQIYGVAWS----PSGRIASVGADGVLAVY 280
                    WS    P+G I   G+DG + ++
Sbjct: 270 ---------WSLDVLPNGDIVVGGSDGKILIF 292

 Score = 32.0 bits (71), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 46/113 (40%), Gaps = 18/113 (15%)

Query: 72  DLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSR 131
           D     S D TI +W        +GA+     LA    H + V+ ++ + DG   A+CS 
Sbjct: 158 DRFLTASADKTIKLW--------DGARD----LATYNVHTDVVRHLALAPDGHHFASCSN 205

Query: 132 DKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIW 184
           D SV +   D      + +     H   V + V +     L S   D TVR+W
Sbjct: 206 DGSVKVHTLDG-----KTVRTFDGHESFV-YCVKYLPDGGLVSCGEDKTVRVW 252

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 147 YECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIW 184
           YE  S L  HS DVK VV       +AS S D TVR+W
Sbjct: 8   YELSSSLLGHSMDVKSVV-AISDTQIASGSRDGTVRVW 44

>CAGL0B01529g 137174..138283 highly similar to sp|P39108
           Saccharomyces cerevisiae YDR142c PAS7 peroxisomal import
           protein - peroxin, start by similarity
          Length = 369

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 68/158 (43%), Gaps = 20/158 (12%)

Query: 2   PLQLAKSLKLHNDK-VWSIDFEPVR-GLLATGSTDRAIKV--LQLKNGKENLLDVLDDTV 57
           P    K+   H  K   S DF   R  ++AT   D +I +  +++     N       T+
Sbjct: 209 PGNNQKNFIAHRGKGALSCDFNKYRPNIIATSGVDNSIGIWDIRMLPNSSNQQGFQTGTL 268

Query: 58  -------HKKAVRSVAWRPH-SDLLAAGSFDSTISIW----TQSDLDL--EEGAKLEMEL 103
                  H  AV+ V W PH SD+L + S+D +  IW     Q+++      G+ L   L
Sbjct: 269 VNEIVNAHDLAVKKVCWSPHHSDILLSTSYDMSCKIWKDVSVQNNVPTGKTNGSLLSNGL 328

Query: 104 LAIIEGHENEVKGISWSQDGC--LLATCSRDKSVWIWE 139
           L+  + H   V G  WS  G    +AT   D +V+IW 
Sbjct: 329 LSNFKHHTEFVFGADWSLWGIPGYVATAGWDSNVFIWN 366

 Score = 35.4 bits (80), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 10/72 (13%)

Query: 125 LLATCSRDKSVWIWE-------TDEAGEEYECI--SVLQEHSQDVKHVVWHTKH-NLLAS 174
           ++AT   D S+ IW+       +++ G +   +   ++  H   VK V W   H ++L S
Sbjct: 236 IIATSGVDNSIGIWDIRMLPNSSNQQGFQTGTLVNEIVNAHDLAVKKVCWSPHHSDILLS 295

Query: 175 SSYDDTVRIWKD 186
           +SYD + +IWKD
Sbjct: 296 TSYDMSCKIWKD 307

>Scas_670.21
          Length = 595

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/195 (22%), Positives = 83/195 (42%), Gaps = 28/195 (14%)

Query: 1   MPLQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKK 60
           MP    + L  H+ +V  + +      LA+G  D  + V      +  ++  ++   HK 
Sbjct: 402 MPDPFFERLNTHSQEVCGLQWNTEENKLASGGNDNVVCVYD-GTSRNPMIKFIE---HKA 457

Query: 61  AVRSVAWRPHSDLLAA---GSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGI 117
           AV+++AW PH   + A   G+ D  + IW              M+L  +  G  ++V  +
Sbjct: 458 AVKALAWSPHKRGILATGGGTVDRRLKIWN---------VNTSMKLSDVDTG--SQVCNM 506

Query: 118 SWSQDGCLLATC----SRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLA 173
            WS++   + T         ++W + T         +++L+ HS  V H+        + 
Sbjct: 507 IWSKNTDEIVTSHGYSKYHLTLWDYPT------MNPVAILKGHSFRVLHLTLSADGTTVV 560

Query: 174 SSSYDDTVRIWKDYD 188
           S + D+T+R WK ++
Sbjct: 561 SGAGDETLRYWKLFE 575

 Score = 37.4 bits (85), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 45/86 (52%), Gaps = 5/86 (5%)

Query: 99  LEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQ 158
           ++ + +  + GH + V  +SW  +G +L + SRD ++   +       +E    L  HSQ
Sbjct: 361 VKRKCVRTLSGHVDRVACLSW--NGHILTSGSRDHNILHRDVRMPDPFFE---RLNTHSQ 415

Query: 159 DVKHVVWHTKHNLLASSSYDDTVRIW 184
           +V  + W+T+ N LAS   D+ V ++
Sbjct: 416 EVCGLQWNTEENKLASGGNDNVVCVY 441

 Score = 33.9 bits (76), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 52/238 (21%), Positives = 88/238 (36%), Gaps = 53/238 (22%)

Query: 41  QLKNGKENLLDVLDDTVHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLD-LEEGAKL 99
            L  G+ N L  + D V +K VR+++   H D +A  S++  I      D + L    ++
Sbjct: 345 HLAVGQGNGLVEIYDVVKRKCVRTLSG--HVDRVACLSWNGHILTSGSRDHNILHRDVRM 402

Query: 100 EMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQD 159
                  +  H  EV G+ W+ +   LA+   D  V +++    G     +    EH   
Sbjct: 403 PDPFFERLNTHSQEVCGLQWNTEENKLASGGNDNVVCVYD----GTSRNPMIKFIEHKAA 458

Query: 160 VKHVVWHT-KHNLLASS--SYDDTVRIW-----------------------KDYDD---- 189
           VK + W   K  +LA+   + D  ++IW                       K+ D+    
Sbjct: 459 VKALAWSPHKRGILATGGGTVDRRLKIWNVNTSMKLSDVDTGSQVCNMIWSKNTDEIVTS 518

Query: 190 -----------DWEC---AAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYI 233
                      D+      A+L GH   +     +   D   + SG+ D T+R WK  
Sbjct: 519 HGYSKYHLTLWDYPTMNPVAILKGHSFRVL--HLTLSADGTTVVSGAGDETLRYWKLF 574

>Scas_693.36
          Length = 375

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 80/194 (41%), Gaps = 29/194 (14%)

Query: 59  KKAVRSVAWRPH-SDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGI 117
           K  +    + PH  +LL   S DS  +I+   D    +   L    + ++    N+ +  
Sbjct: 184 KDCIYQSQFSPHDPNLLICCSGDSYTTIFDLRDPYNTQRNFLSHAGMEVLSADFNKYRP- 242

Query: 118 SWSQDGCLLATCSRDKSVWIWETDE--AGEEYECIS-VLQEHSQDVKHVVWHTKH-NLLA 173
                  +LAT   D S+ IW+     A +   CI+ ++  H   V+ VVW   H ++L 
Sbjct: 243 ------NVLATAGVDNSIRIWDFRMLVARDAAICINEIVNAHDLAVRKVVWSPHHSDILL 296

Query: 174 SSSYDDTVRIWKD--YDDDWE---------------CAAVLTGHEGTIWCSDFSKEEDPI 216
           S+SYD + +IW D  YD   +               C  ++  H   ++ +D+S    P 
Sbjct: 297 STSYDMSCKIWNDLSYDPIQQRKTGKTNSLDFTGNGCRFIMNQHTEFVFGADWSMWGQPG 356

Query: 217 RLCSGSDDSTVRVW 230
            + S   D  V +W
Sbjct: 357 YVASTGWDGNVFIW 370

 Score = 40.8 bits (94), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 65/144 (45%), Gaps = 22/144 (15%)

Query: 15  KVWSIDFEPVR-GLLATGSTDRAIKV-----LQLKNGKENLLDVLDDTVHKKAVRSVAWR 68
           +V S DF   R  +LAT   D +I++     L  ++    + ++++   H  AVR V W 
Sbjct: 231 EVLSADFNKYRPNVLATAGVDNSIRIWDFRMLVARDAAICINEIVN--AHDLAVRKVVWS 288

Query: 69  PH-SDLLAAGSFDSTISIWTQSDLD----LEEGAKLEMELLA-----IIEGHENEVKGIS 118
           PH SD+L + S+D +  IW     D     + G    ++        I+  H   V G  
Sbjct: 289 PHHSDILLSTSYDMSCKIWNDLSYDPIQQRKTGKTNSLDFTGNGCRFIMNQHTEFVFGAD 348

Query: 119 WS---QDGCLLATCSRDKSVWIWE 139
           WS   Q G  +A+   D +V+IW 
Sbjct: 349 WSMWGQPG-YVASTGWDGNVFIWN 371

 Score = 32.0 bits (71), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 63/272 (23%), Positives = 107/272 (39%), Gaps = 53/272 (19%)

Query: 58  HKKAVRSVAWR-PHSDLLAAGSFDSTISIWT----QSDLDLEEGAKLEMEL---LAIIEG 109
           HKK V S  W   +  +  + S+D T+ IW+    +S L L    K +  L     II  
Sbjct: 103 HKKEVMSCNWNLINKTMFTSSSWDGTVKIWSPTRKESLLTLRPTPKWKKHLDSMEPIIPK 162

Query: 110 HENEVK-----------------GISWSQ----DGCLLATCSRDKSVWIWETDEAGEEYE 148
             N ++                  I  SQ    D  LL  CS D    I++  +      
Sbjct: 163 RRNNIQIQPSHKINMPNNNNNKDCIYQSQFSPHDPNLLICCSGDSYTTIFDLRDPYNTQR 222

Query: 149 CISVLQEHSQDVKHVVWHT-KHNLLASSSYDDTVRIWKDY-----DDDWECAA-VLTGHE 201
             + L     +V    ++  + N+LA++  D+++RIW D+      D   C   ++  H+
Sbjct: 223 --NFLSHAGMEVLSADFNKYRPNVLATAGVDNSIRIW-DFRMLVARDAAICINEIVNAHD 279

Query: 202 GTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTL----------PN 251
             +    +S     I L S S D + ++W  +  D   Q++    ++L           N
Sbjct: 280 LAVRKVVWSPHHSDI-LLSTSYDMSCKIWNDLSYDPIQQRKTGKTNSLDFTGNGCRFIMN 338

Query: 252 AHRSQIYGVAWS---PSGRIASVGADGVLAVY 280
            H   ++G  WS     G +AS G DG + ++
Sbjct: 339 QHTEFVFGADWSMWGQPGYVASTGWDGNVFIW 370

 Score = 29.3 bits (64), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 53/117 (45%), Gaps = 15/117 (12%)

Query: 79  FDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKG---------ISWS-QDGCLLAT 128
           FD+ +++ + S+  L    +L +  +A   G   E K          I+W+ Q    +  
Sbjct: 20  FDNKLAVASASNYGLVGNGRLSILDIAP-NGQLIETKSFLTQDCLFDIAWNEQHEKQVVV 78

Query: 129 CSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWH-TKHNLLASSSYDDTVRIW 184
              D S+ +++ D A      I++  EH ++V    W+     +  SSS+D TV+IW
Sbjct: 79  AQGDGSLRLFDIDLAKYP---IAIFNEHKKEVMSCNWNLINKTMFTSSSWDGTVKIW 132

>Scas_465.4
          Length = 1002

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 68/280 (24%), Positives = 114/280 (40%), Gaps = 36/280 (12%)

Query: 67  WRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLL 126
           + P    ++AG+    + IW   DL LE         L  + GHE  +   + S +G  +
Sbjct: 145 FSPEKVYISAGTVMGGVLIW---DLFLETK-------LYNLVGHEGSIFYATISDNGRYI 194

Query: 127 ATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKD 186
            +CS D+S+ +W   + GEE   +     H+  + ++ +      L S S D+T R+W  
Sbjct: 195 TSCSDDRSIKLWNL-QTGEE---LCTGWGHTARIWNLKFFNNDTQLISVSEDNTCRVWDI 250

Query: 187 YDDDWECAAVLTGHE-------GTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDD 239
             D+      LT  +         +W  D  +E+D + + SG +D  +++ K       +
Sbjct: 251 LQDEGNGNTSLTLSQIYEVHLIKNVWGVDI-QEKDMVAVTSG-NDGRLKLTKIQDTKTMN 308

Query: 240 QQE-------WVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYKEKQNDSE---V 289
            QE           S +  +    I G      G IA + + G +  Y E  N  +   V
Sbjct: 309 AQEVSFSLEDISTHSVIKFSKGEIIKGFQKFEFGLIA-ITSLGKIIQYFECDNLWKLLLV 367

Query: 290 SEWEISATYKAAHTVYEINTVKWVNIDGKEMLITAGDDGR 329
           SE  +S  Y   H + E N V + N     +L+    DGR
Sbjct: 368 SENLVS--YSVTHGIMEHNIVTFSNNKSDALLLKLSQDGR 405

>Scas_717.68
          Length = 908

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 51/104 (49%), Gaps = 8/104 (7%)

Query: 149 CISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSD 208
           C  + +EH+ DV  + W +K+N L +SS D TV++W     + + +     H+  + C  
Sbjct: 320 CFKIFKEHTADVLDLDW-SKNNFLITSSMDRTVKLW---HLERQTSLKTFQHQDFVTCVR 375

Query: 209 FSKEEDPIRLCSGSDDSTVRVWKYIGDD---EDDQQEWVCESTL 249
           F   +D     SG  D  VR+W  + ++   E D Q+ +   TL
Sbjct: 376 FHPTDDRF-FISGCLDHKVRLWSILENEITFEFDCQDLITSLTL 418

>YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protein
           containing five WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has a region of
           low similarity to a region of S. pombe Tup11p, which is
           a transcriptional repressor functioning redundantly with
           Tup12p [3042 bp, 1013 aa]
          Length = 1013

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 71/138 (51%), Gaps = 17/138 (12%)

Query: 197 LTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQ 256
           L GHEG+I+  + S     +  CS  DD ++R+W    D E  +Q  V  S     H ++
Sbjct: 175 LLGHEGSIFYVNLSNNGRYVASCS--DDRSIRLW----DLETGKQLSVGWS-----HTAR 223

Query: 257 IYGVAWSPS-GRIASVGADGVLAVYKEKQNDSEVSEWEISATYKAAHTVYEINTVKWVNI 315
           I+ + +  +  ++ SV  D    V+   ++   V+E  IS  Y+    V+ I ++  V++
Sbjct: 224 IWNLMFFDNDSKLISVSEDCTCRVWNIIESRENVAELSISNVYE----VHLIKSIWGVDV 279

Query: 316 DGKEML-ITAGDDGRVNL 332
              EM+ +T+G+DGR+ L
Sbjct: 280 KDDEMIAVTSGNDGRLKL 297

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 85/180 (47%), Gaps = 29/180 (16%)

Query: 19  IDFEPVRGLLATGST----DRAIKVLQLKNGKENLLDVLDDTVHKKAV---RSVAWR--- 68
           +DFE +     TG+T    +  I +L   N K  + D+  + + +K++   RS+ +    
Sbjct: 84  VDFERINSDWITGATFSFDNLQIYLLTCYN-KVLICDLNCEVLFRKSLGGERSILYSGII 142

Query: 69  ----PHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGC 124
               P    + AG+    + IW     DL    K+   L     GHE  +  ++ S +G 
Sbjct: 143 KVFGPDKVYVNAGTVMGGVIIW-----DLFSETKIHNLL-----GHEGSIFYVNLSNNGR 192

Query: 125 LLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIW 184
            +A+CS D+S+ +W+  E G++   +SV   H+  + ++++    + L S S D T R+W
Sbjct: 193 YVASCSDDRSIRLWDL-ETGKQ---LSVGWSHTARIWNLMFFDNDSKLISVSEDCTCRVW 248

 Score = 32.0 bits (71), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 46/113 (40%), Gaps = 15/113 (13%)

Query: 153 LQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLT---GHEGTIWCSDF 209
           L  H   + +V        +AS S D ++R+W     D E    L+    H   IW   F
Sbjct: 175 LLGHEGSIFYVNLSNNGRYVASCSDDRSIRLW-----DLETGKQLSVGWSHTARIWNLMF 229

Query: 210 SKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAW 262
              +   +L S S+D T RVW  I     + +E V E ++ N +   +    W
Sbjct: 230 FDNDS--KLISVSEDCTCRVWNII-----ESRENVAELSISNVYEVHLIKSIW 275

>CAGL0L04950g complement(562491..564908) highly similar to sp|Q04660
           Saccharomyces cerevisiae YMR049c, start by similarity
          Length = 805

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 44/87 (50%), Gaps = 11/87 (12%)

Query: 193 CAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNA 252
           C+ + +GHEG I     S +   I L +GSDD +VR+W+ +   E  + + V +   P  
Sbjct: 428 CSTIYSGHEGKIRT--LSIDPTGIWLATGSDDGSVRIWEILTGREVYRVQLVNKEDNP-- 483

Query: 253 HRSQIYGVAWSPSGRIASVGADGVLAV 279
               I+ V W+P G +      G+LAV
Sbjct: 484 -EDNIHSVEWNPDGSV------GILAV 503

 Score = 33.1 bits (74), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 30/61 (49%), Gaps = 1/61 (1%)

Query: 105 AIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQE-HSQDVKHV 163
            I  GHE +++ +S    G  LAT S D SV IWE     E Y    V +E + +D  H 
Sbjct: 430 TIYSGHEGKIRTLSIDPTGIWLATGSDDGSVRIWEILTGREVYRVQLVNKEDNPEDNIHS 489

Query: 164 V 164
           V
Sbjct: 490 V 490

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 78/197 (39%), Gaps = 26/197 (13%)

Query: 1   MPLQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKE-------NLLDVL 53
            P++ +     H  K+ ++  +P    LATGS D ++++ ++  G+E       N  D  
Sbjct: 424 FPIRCSTIYSGHEGKIRTLSIDPTGIWLATGSDDGSVRIWEILTGREVYRVQLVNKEDNP 483

Query: 54  DDTVHKKAVRSVAWRPHSD--LLAAGSFDSTISIWTQ-SDLDLEEGAKLEME------LL 104
           +D +H     SV W P     +LA    ++   I       D+E   K+ +E        
Sbjct: 484 EDNIH-----SVEWNPDGSVGILAVAVGNNIFLIVPPIFGYDIENAGKVRIEHGFGYDTF 538

Query: 105 AIIEGHENEVKGISW-SQDGCLLATCSRDKSVWIW--ETDEAGEEYECISVLQEHSQDVK 161
              +    EV G    S D    A  +  K V  W   T    E+  CI ++ +  + VK
Sbjct: 539 GSTKKANLEVNGSDLESDDEAANANTAVKKQVAQWHKPTQRQMEQDICIVIVCK--KPVK 596

Query: 162 HVVWHTKHNLLASSSYD 178
            + WH K +   +   D
Sbjct: 597 KLSWHRKGDYFVTVQPD 613

>Scas_605.18
          Length = 424

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 53/249 (21%), Positives = 103/249 (41%), Gaps = 44/249 (17%)

Query: 98  KLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHS 157
           K+ ++    ++GH N++    WS+D   + + S+D  + IW+T  +G +   I +    S
Sbjct: 78  KINLQSTLTLKGHNNKISDFRWSRDSKSILSASQDGFMLIWDT-ASGLKRNAIPL---DS 133

Query: 158 QDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDD---WECAAVLTGHEGTIWCSDFSKEED 214
           Q V         NL AS+  ++   I++   ++       ++  GH  T + SD  +  D
Sbjct: 134 QWVLSCALSPSGNLAASAGLNNNCTIYRVSKENRVQQNVVSIFKGH--TCYISDI-EFLD 190

Query: 215 PIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIY--------GVAWSPSG 266
              + + S D T  +W                  +P A R + Y         +A  P  
Sbjct: 191 NSHIITSSGDMTCALWD-----------------IPKAKRVREYADHLGDVLALALPPPS 233

Query: 267 RIASVGADGVLAVYKEKQNDSEVSEWEI---SATYKAAHTVYEINTVKWVNIDGKEMLIT 323
              + GA+    ++    +D     W+    +A  K   +  ++N +++   DG   ++T
Sbjct: 234 ADENTGAN----IFASCGSDGYTYIWDTRTSAAVQKFFASDTDVNAIQFFK-DGNS-IVT 287

Query: 324 AGDDGRVNL 332
            GDDG +N+
Sbjct: 288 GGDDGVINM 296

 Score = 32.0 bits (71), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 24/43 (55%)

Query: 99  LEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETD 141
           L+ E++  +EGH N V  +  S DG  + T S D ++ IW  +
Sbjct: 380 LKAEIVGKLEGHSNRVSSVRTSPDGLGVCTGSWDSTMRIWSPN 422

>YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein that
           associates with Ccr4p, contains WD (WD-40) repeats [1980
           bp, 659 aa]
          Length = 659

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 59/259 (22%), Positives = 106/259 (40%), Gaps = 62/259 (23%)

Query: 12  HNDKVWSIDFEPVRGLLATGS-TDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAW-RP 69
           H + + ++DF+   G L + S  DR +KV  L +G    + V +   H   V  +   + 
Sbjct: 334 HGNSITALDFDTPWGTLCSSSYQDRIVKVWDLNHG----IQVGELPGHLATVNCMQIDKK 389

Query: 70  HSDLLAAGSFDSTISIWTQSDLDL------------EEGAKLEMELLAIIEGHENEVKGI 117
           + ++L  GS D+T+ +W   DL+L            E+  ++    +   E H++E+  +
Sbjct: 390 NYNMLITGSKDATLKLW---DLNLSREIYLDHSPLKEKTEEIVTPCIHNFELHKDEITAL 446

Query: 118 SWSQDGCLLATCSRDKSVWIWETDEAGEEYECIS----VLQEHSQDVKHVV--------- 164
           S+  +   L + SRDK ++ W+        +CI     +      D+K            
Sbjct: 447 SFDSEA--LVSGSRDKKIFHWDLTTG----KCIQQLDLIFTPTHSDIKMPARSLNNGACL 500

Query: 165 ----------WHTKHNLLASSSYDDTVRIWKDYDDDWECAA---VLTGHEGTIWCSDFSK 211
                         ++ LA+ + D  VR+W     D        +L GH   I    F  
Sbjct: 501 LGTEAPMIGALQCYNSALATGTKDGIVRLW-----DLRVGKPVRLLEGHTDGITSLKFDS 555

Query: 212 EEDPIRLCSGSDDSTVRVW 230
           E    +L +GS D++VR+W
Sbjct: 556 E----KLVTGSMDNSVRIW 570

 Score = 33.1 bits (74), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 39/77 (50%), Gaps = 4/77 (5%)

Query: 155 EHSQDVKHVVWHTKHNLLASSSYDD-TVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEE 213
           EH   +  + + T    L SSSY D  V++W D +   +    L GH  T+ C    K+ 
Sbjct: 333 EHGNSITALDFDTPWGTLCSSSYQDRIVKVW-DLNHGIQVGE-LPGHLATVNCMQIDKKN 390

Query: 214 DPIRLCSGSDDSTVRVW 230
             + L +GS D+T+++W
Sbjct: 391 YNM-LITGSKDATLKLW 406

>AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH]
           (1107932..1109335) [1404 bp, 467 aa]
          Length = 467

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 57/262 (21%), Positives = 101/262 (38%), Gaps = 37/262 (14%)

Query: 28  LATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHS-DLLAAGSFDSTISIW 86
            A+ S D+ +K+   + G     D+++    K     + + P + + L  G  DS I  +
Sbjct: 233 FASSSYDKTVKIWDTETG-----DIINRLSFKATPNCMTFHPQNKEQLLVGFSDSKIRHF 287

Query: 87  TQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEE 146
               +D ++G      ++ I + H   +  + +  DG    + S DKS+ IWE       
Sbjct: 288 DLR-VDKKDG------VIQIYDHHLAAINALRYFPDGSKFISSSDDKSIRIWENQIN--- 337

Query: 147 YECISVLQEHSQDVKHVVW---HTKHNLLASSSYDDTVRIW---KDYDDDWECAAVLTGH 200
              I + Q    D     W   H +HN  A+ S D+++ ++     Y      A    GH
Sbjct: 338 ---IPIKQISDTDQYPAPWIQLHPEHNQFAAQSMDNSIYVYSMKPKYKRHPRKA--FRGH 392

Query: 201 EGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGV 260
           +   + S F    D   + +G     + +W +       Q E     TL          V
Sbjct: 393 KSAGYNSMFDIAPDGRYVAAGDTSGRLFIWDWKTTKILRQLETTKGETLKQ--------V 444

Query: 261 AWSP--SGRIASVGADGVLAVY 280
           AWSP  + +I   G  G + ++
Sbjct: 445 AWSPQETSKIICSGKSGKIFLF 466

 Score = 37.0 bits (84), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 78/196 (39%), Gaps = 39/196 (19%)

Query: 47  ENLLDVLDDTVHKKAVRSVAW-RPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLA 105
           + +L V D   H +   ++ + R    L  +G  D  + IW     D+      E  LL 
Sbjct: 164 KRILHVYDG--HDRGTTALEFLRKTGHLFLSGGNDGVLKIW-----DMYH----ERLLLR 212

Query: 106 IIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISV------LQEHSQD 159
              GH   +   S+S D    A+ S DK+V IW+T E G+    +S       +  H Q+
Sbjct: 213 DYCGHRKAISATSFSHDNVQFASSSYDKTVKIWDT-ETGDIINRLSFKATPNCMTFHPQN 271

Query: 160 VKHVVW-----HTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEED 214
            + ++        +H  L     D  ++I+     D   AA+        +  D SK   
Sbjct: 272 KEQLLVGFSDSKIRHFDLRVDKKDGVIQIY-----DHHLAAI----NALRYFPDGSK--- 319

Query: 215 PIRLCSGSDDSTVRVW 230
                S SDD ++R+W
Sbjct: 320 ---FISSSDDKSIRIW 332

>Scas_693.22
          Length = 1145

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 60/126 (47%), Gaps = 6/126 (4%)

Query: 106 IIEGHENEVKGISWSQDGC-LLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVV 164
           ++ GH   +  I+++ +   +LATCS D  V  W+       +   S  +  +  VK   
Sbjct: 112 VLHGHSRAITDINFNPENPDILATCSVDTYVHAWDMRSPHRPFYTTSAWRSGASQVK--- 168

Query: 165 WHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDD 224
           W+ K + + +S++ + + IW D          L GH+ ++   DF++ +    + S S+D
Sbjct: 169 WNYKDSNILASAHSNDIYIW-DLRMGSTPLHKLVGHDSSVNSIDFNRFKSS-EIMSSSND 226

Query: 225 STVRVW 230
            TV+ W
Sbjct: 227 GTVKFW 232

>ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH]
           (128830..130335) [1506 bp, 501 aa]
          Length = 501

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 65/307 (21%), Positives = 112/307 (36%), Gaps = 80/307 (26%)

Query: 26  GLLATGSTDRAIKVLQ------LKNGKENLLDVLDDTVHKKAVRSVAWRPHSDLLAAGSF 79
           G+ A G  D    V+       L N  E ++    +T  +  V  + W P    L  G  
Sbjct: 155 GVFAYGERDSRAAVVTYSVADGLWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVE 214

Query: 80  DSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWE 139
              + +W+           +E +L  I+  H   +  I W+ D   + TC  D    +W 
Sbjct: 215 SGELRLWS-----------VEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWN 263

Query: 140 T-----------DEAGEE-------------------------------YECISVLQEHS 157
                        EAG E                                + I  L+ HS
Sbjct: 264 VLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHS 323

Query: 158 QDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIR 217
           + +  + ++  + LL S+S D+T+R+W+    +   + V  GH  +I  + +  ++    
Sbjct: 324 KTLTTIAYNEHNKLLLSASDDNTLRVWR--GGNLNPSHVFYGHSQSITSAHWVDDD---T 378

Query: 218 LCSGSDDSTVRVWKYIGDDEDDQQEWVCEST---LPNAHRSQIYGVAWSP-SGRIASVGA 273
           + S S D ++RVW    +        V  +T   +PN      +  A SP  G+ A+   
Sbjct: 379 IISTSMDGSIRVWSLASNST------VASATVDGVPN------FTGALSPDQGKFATGTL 426

Query: 274 DGVLAVY 280
           DG + VY
Sbjct: 427 DGEVMVY 433

>Kwal_26.8975
          Length = 445

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 55/247 (22%), Positives = 96/247 (38%), Gaps = 56/247 (22%)

Query: 28  LATGSTDRAIKVLQLKNG--KENLLDVLDDT----------VHKKAVRSVAWRPHSDLLA 75
           L +G+ DR +++ + KN   K NL    DD            HK  V +V      D + 
Sbjct: 155 LVSGANDRTLRLWKTKNDELKNNLAAEEDDVEEGKTLAILEAHKAPVVTVDV--SGDRII 212

Query: 76  AGSFDSTISIWT-------------------------QSDLDLEEGAKLEMELLAIIEGH 110
           +GS+D++I  W+                         +  L L++G+      LA++E H
Sbjct: 213 SGSYDNSIGFWSTNHKEMTAVDPMDALGSNVSSAAKKRRRLALKDGSVRRRSPLALLESH 272

Query: 111 ENEVKGISWS-QDGCLLATCSRDKSVWIWE------TDEAGEEYECISVLQEHSQDVKHV 163
              V+ + +   D  +  + S+D ++  W+       D     Y  +S+ Q    ++   
Sbjct: 273 TAPVEEVLFDFADKTVGYSVSQDHTIKTWDLVTARCVDTKSTSYSLLSLAQLPQLNLLAC 332

Query: 164 VWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSD 223
               +H  L       + +I +           L GH+  +   D   E + + LCSGS 
Sbjct: 333 GSSARHITLHDPRVGSSTKITQQQ---------LNGHKNFVVALDTCPEMEYM-LCSGSH 382

Query: 224 DSTVRVW 230
           D TV+VW
Sbjct: 383 DGTVKVW 389

 Score = 35.4 bits (80), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 43/97 (44%), Gaps = 15/97 (15%)

Query: 172 LASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWK 231
           + S SYD  VR W   +   +      GH G +    +       RL SG++D T+R+WK
Sbjct: 115 IVSGSYDGIVRTW---NLSGKVEKQYAGHSGAVRAVKYISS---TRLVSGANDRTLRLWK 168

Query: 232 YIGD--------DEDDQQEWVCESTLPNAHRSQIYGV 260
              D        +EDD +E    + L  AH++ +  V
Sbjct: 169 TKNDELKNNLAAEEDDVEEGKTLAIL-EAHKAPVVTV 204

>CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein, start by similarity
          Length = 457

 Score = 41.2 bits (95), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 59/261 (22%), Positives = 104/261 (39%), Gaps = 51/261 (19%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWT----------------------------QS 89
           HK  V S+    +S +L+A S+D+T+++W+                            + 
Sbjct: 204 HKAPVVSLDVASNSRILSA-SYDNTVALWSTIYKEMTAIDHLEEIQNPNNKISTAAKKRR 262

Query: 90  DLDLEEGAKLEMELLAIIEGHENEVKGISWSQ-DGCLLATCSRDKSVWIWETDEAGEEYE 148
            L L++G       L+++E H   V+ + +   D  +  + S+D ++  W+   A     
Sbjct: 263 KLTLKDGTIRRRAPLSLLESHTGPVEQVIFDHGDNTVGYSVSQDHTIKTWDLVTA----R 318

Query: 149 CISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLT-----GHEGT 203
           CI   +  S  +  +      NLLA  S   +VR    +D     +A +T     GH+  
Sbjct: 319 CIDT-KTTSYPLLSIAQMPTLNLLACGS---SVRHITLHDPRVSSSAKITQKQLVGHKNF 374

Query: 204 IWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRS---QIYGV 260
           +   D   E + + LCS S D TV+VW    D       +      P   +    +++ V
Sbjct: 375 VVGLDTCSENEYL-LCSASHDGTVKVW----DVRSTSPMYTITRQDPTVEKGVNDKVFAV 429

Query: 261 AWSPSGRIASVGADGVLAVYK 281
            W+ S  I S G D  + + K
Sbjct: 430 KWAKSIGIISGGQDKKIQINK 450

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 34/86 (39%), Gaps = 10/86 (11%)

Query: 205 WCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSP 264
           W S     +D   + SGS D  VR W   G  E             + H   +  V +  
Sbjct: 105 WVSALDVSDDFRHIYSGSYDGVVRTWNMSGKVEKQY----------SGHTGAVKAVKYIS 154

Query: 265 SGRIASVGADGVLAVYKEKQNDSEVS 290
           + RI S G D  L ++K K +D  VS
Sbjct: 155 NTRIVSAGNDRSLRLWKTKNDDGSVS 180

 Score = 29.6 bits (65), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 41/96 (42%), Gaps = 22/96 (22%)

Query: 156 HSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECA------------------AVL 197
           H+  VK  V +  +  + S+  D ++R+WK  +DD   +                  A+L
Sbjct: 143 HTGAVK-AVKYISNTRIVSAGNDRSLRLWKTKNDDGSVSNNTGDENDEENIEDGKTLAIL 201

Query: 198 TGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYI 233
            GH+  +   D +      R+ S S D+TV +W  I
Sbjct: 202 EGHKAPVVSLDVASNS---RILSASYDNTVALWSTI 234

>AGL190W [4122] [Homologous to ScYDR142C (PEX7) - SH]
           complement(341382..342494) [1113 bp, 370 aa]
          Length = 370

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 58/246 (23%), Positives = 97/246 (39%), Gaps = 40/246 (16%)

Query: 15  KVWSIDFEPVRGLLATGSTDRAIKV------LQLKNGKENLLDVLDDTVHKKAVRSVAWR 68
           KVW+         L     +R++ V      L L N +++  D  D+   K  +    + 
Sbjct: 130 KVWTPARPQSMLTLLPAPANRSVMVEPGARGLPLSNQQQHK-DAADN---KDCIYQAQFS 185

Query: 69  PH-SDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLA 127
           PH  +L+ + S +S +S++     DL + A    +      G E      +  +   ++A
Sbjct: 186 PHDPNLVMSCSGNSYVSLF-----DLRQPAASNQQRFIAHSGLEALSCDFNKYRPH-VIA 239

Query: 128 TCSRDKSVWIWETDEAGEEYEC-------ISVLQEHSQDVKHVVWHTKH-NLLASSSYDD 179
           T   DK V +W+     +           I+ +Q HS  V+ VVW   H N+L S+SYD 
Sbjct: 240 TGGVDKMVKVWDLRMVRQTLTTSRTAPVSINEMQGHSLAVRKVVWSPHHSNILLSTSYDM 299

Query: 180 TVRIWKDY---------------DDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDD 224
           T R W D                D    C+ V + H   ++ +D+S    P  + +   D
Sbjct: 300 TCRAWHDLADGPGGQHSGRTNNSDPQRGCSYVFSKHSEFVFGADWSLWGQPGYVATTGWD 359

Query: 225 STVRVW 230
             V  W
Sbjct: 360 GQVCAW 365

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 47/216 (21%), Positives = 74/216 (34%), Gaps = 41/216 (18%)

Query: 58  HKKAVRSVAWRP-HSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKG 116
           H++ V S  W   H D   + S+D T+ +WT +             +L ++    N    
Sbjct: 103 HQREVFSCNWNLLHKDTFVSSSWDGTVKVWTPAR---------PQSMLTLLPAPANRSVM 153

Query: 117 ISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSS 176
           +     G  L+   + K        +A +  +CI   Q    D          NL+ S S
Sbjct: 154 VEPGARGLPLSNQQQHK--------DAADNKDCIYQAQFSPHDP---------NLVMSCS 196

Query: 177 YDDTVRIWKDYDDDWECAAVLTGHEG--TIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIG 234
            +  V ++               H G   + C DF+K   P  + +G  D  V+VW    
Sbjct: 197 GNSYVSLFDLRQPAASNQQRFIAHSGLEALSC-DFNKYR-PHVIATGGVDKMVKVW---- 250

Query: 235 DDEDDQQEWVCESTLP------NAHRSQIYGVAWSP 264
           D    +Q      T P        H   +  V WSP
Sbjct: 251 DLRMVRQTLTTSRTAPVSINEMQGHSLAVRKVVWSP 286

>Kwal_26.7655
          Length = 743

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 43/82 (52%), Gaps = 5/82 (6%)

Query: 152 VLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSK 211
           + QEH+QD+  + W +K+  + ++S D T R+W  + D  +   V T H   + C+ F  
Sbjct: 267 IYQEHTQDILDLDW-SKNGFILTTSMDKTARLW--HCDRPKALKVFT-HPDFVTCAKFHP 322

Query: 212 EEDPIRLCSGSDDSTVRVWKYI 233
            +D     SG  D T+R+W  +
Sbjct: 323 NDDRF-FISGCLDHTLRLWSIL 343

>CAGL0J06512g complement(620516..622153) similar to sp|Q04199
           Saccharomyces cerevisiae YML102w CAC2, start by
           similarity
          Length = 545

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 4/77 (5%)

Query: 109 GHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTK 168
           G  +E+  +SWS D   L T S D S+ ++  D       C++  ++H+  V+ V W   
Sbjct: 150 GGASEIYDLSWSPDDKYLVTASMDNSLKVFNVDTGN----CVAFAKDHNHYVQGVTWDPL 205

Query: 169 HNLLASSSYDDTVRIWK 185
           +  + S S D ++ I++
Sbjct: 206 NQYIISQSVDRSINIYE 222

 Score = 29.6 bits (65), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 62/167 (37%), Gaps = 40/167 (23%)

Query: 126 LATCSRDKSVWIWETD--EAG------EEYECISVLQEHSQDVKHVVWHTKHNLLASSSY 177
           L T   D  V +W  +  E G      +  + +S L  H Q V  + +  + N+LAS+  
Sbjct: 41  LFTAGGDNKVRLWRLNCEETGKGTCKVDTIDFLSGLSLHEQAVNVIRFDHRGNVLASAGD 100

Query: 178 DDTVRIWKDYDDDWECAAVLTGH---EGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIG 234
           D  V +WK  +++        G    EG  W                       VWK + 
Sbjct: 101 DGQVLLWKLTNEETRKKQQRMGDEPVEGDGWA----------------------VWKRLR 138

Query: 235 DDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGR-IASVGADGVLAVY 280
              +D         +P    S+IY ++WSP  + + +   D  L V+
Sbjct: 139 GTANDLDN------MPGGGASEIYDLSWSPDDKYLVTASMDNSLKVF 179

 Score = 28.9 bits (63), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 16/75 (21%), Positives = 37/75 (49%), Gaps = 10/75 (13%)

Query: 65  VAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGC 124
           ++W P    L   S D+++ ++     +++ G       +A  + H + V+G++W     
Sbjct: 158 LSWSPDDKYLVTASMDNSLKVF-----NVDTG-----NCVAFAKDHNHYVQGVTWDPLNQ 207

Query: 125 LLATCSRDKSVWIWE 139
            + + S D+S+ I+E
Sbjct: 208 YIISQSVDRSINIYE 222

>YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protein
           containing six WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to S. cerevisiae Ykl121p, which binds
           phosphatidylinositol [2505 bp, 834 aa]
          Length = 834

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 83/210 (39%), Gaps = 35/210 (16%)

Query: 60  KAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGH-ENEVKGIS 118
           KA+ S  +      +A GS D  I IW      +E       EL +  E + E   K + 
Sbjct: 174 KAIWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERA-----ELDSSAESNKEARAKSMR 228

Query: 119 WSQDGCLLATCSRDKSVWIWETDEAGEEYE----------------CISVLQEHSQDVKH 162
             Q    L      + +     D A E+YE                 + + +EH QDV  
Sbjct: 229 IKQQVSSLNNPKEKQFL-----DSATEKYEEKEKLLNLYAPVFHPTPLRLYKEHVQDVLD 283

Query: 163 VVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGS 222
           + W +K+N + S+S D TV++W     D + +     H   + C +F   +D     SG 
Sbjct: 284 INW-SKNNFILSASMDKTVKLWH---PDRKNSLKTFIHPDFVTCVEFHPTDDRF-FISGC 338

Query: 223 DDSTVRVWKYIGDD---EDDQQEWVCESTL 249
            D   R+W  + D+   E D Q+ +   TL
Sbjct: 339 LDHKCRLWSILDDEVSFEYDCQDLITSVTL 368

 Score = 33.5 bits (75), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 45/205 (21%), Positives = 81/205 (39%), Gaps = 18/205 (8%)

Query: 6   AKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSV 65
           +KS +  +  +WS  F      +ATGS D  I++ ++        ++       K  R+ 
Sbjct: 166 SKSSEPTSKAIWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAK 225

Query: 66  AWRPHSDLLAAGS------FDSTISIWTQSDLDLEEGAK-LEMELLAIIEGHENEVKGIS 118
           + R    + +  +       DS    + + +  L   A       L + + H  +V  I+
Sbjct: 226 SMRIKQQVSSLNNPKEKQFLDSATEKYEEKEKLLNLYAPVFHPTPLRLYKEHVQDVLDIN 285

Query: 119 WSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWH-TKHNLLASSSY 177
           WS++  +L+  S DK+V +W  D        I     H   V  V +H T      S   
Sbjct: 286 WSKNNFILS-ASMDKTVKLWHPDRKNSLKTFI-----HPDFVTCVEFHPTDDRFFISGCL 339

Query: 178 DDTVRIWKDYDD----DWECAAVLT 198
           D   R+W   DD    +++C  ++T
Sbjct: 340 DHKCRLWSILDDEVSFEYDCQDLIT 364

>AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH]
           complement(1256750..1258087) [1338 bp, 445 aa]
          Length = 445

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/243 (20%), Positives = 95/243 (39%), Gaps = 50/243 (20%)

Query: 28  LATGSTDRAIKVLQLKNGKENLLDVLDDT--VHKKAVRSVAWRP------HSDLLAAGSF 79
           L +G  DR +++ + KN     +D L+ T   H  A+      P        D + + S+
Sbjct: 156 LVSGGNDRTLRLWKTKNDDVKHVDELEGTEEAHTLAILEGHQAPVVSVDVQGDRILSASY 215

Query: 80  DSTISIWT-------------------------QSDLDLEEGAKLEMELLAIIEGHENEV 114
           D++I  W+                         +  L +++G+      L+++E H+  V
Sbjct: 216 DNSIGFWSTNHKDMTAVDPMDSLGDKASSAAKKRRKLTMKDGSVRRRAPLSLLESHKAPV 275

Query: 115 KGISW-SQDGCLLATCSRDKSVWIWE------TDEAGEEYECISVLQEHSQDVKHVVWHT 167
           + + + S D  +  + S+D ++  W+       D     Y  +S+++     +       
Sbjct: 276 EQVIFASNDSTVAYSVSQDHTIKTWDLVTSRCVDTKSTSYSLLSMVELPKLRLLACGSSA 335

Query: 168 KHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTV 227
           +H  L     D + +I +           L GH+  +   D   E + + LCS S D TV
Sbjct: 336 RHITLHDPRADSSAKITQQQ---------LLGHKNFVVALDTCPENEYM-LCSASHDGTV 385

Query: 228 RVW 230
           +VW
Sbjct: 386 KVW 388

 Score = 36.6 bits (83), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 30/65 (46%), Gaps = 6/65 (9%)

Query: 172 LASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWK 231
           + S SYD  VR W   +   +     +GH G +    F       RL SG +D T+R+WK
Sbjct: 116 IVSGSYDGVVRTW---NLSGKIEKQYSGHTGAVRAVKFISS---TRLVSGGNDRTLRLWK 169

Query: 232 YIGDD 236
              DD
Sbjct: 170 TKNDD 174

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 29/70 (41%), Gaps = 10/70 (14%)

Query: 217 RLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGV 276
           R+ SGS D  VR W   G  E             + H   +  V +  S R+ S G D  
Sbjct: 115 RIVSGSYDGVVRTWNLSGKIEKQY----------SGHTGAVRAVKFISSTRLVSGGNDRT 164

Query: 277 LAVYKEKQND 286
           L ++K K +D
Sbjct: 165 LRLWKTKNDD 174

>ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH]
           complement(529784..531187) [1404 bp, 467 aa]
          Length = 467

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 58/258 (22%), Positives = 105/258 (40%), Gaps = 41/258 (15%)

Query: 90  DLDLEEGAK-------LEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDE 142
           D DL+  +K       + ++ +  ++GH N+V    WS D   + + S+D  + +W+   
Sbjct: 99  DADLQSLSKNVAPITSVNLKPVTTLKGHNNKVSSFRWSSDSRTILSASQDGFMLLWDA-A 157

Query: 143 AGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDD---WECAAVLTG 199
            G +   I +   HSQ V         NL+AS+  D+   I++    D       ++  G
Sbjct: 158 TGLKSNAIPL---HSQWVLSCAICPNGNLVASAGLDNNCTIYRVSRKDRIQQNIVSIFKG 214

Query: 200 HEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW-----KYIGDDEDDQQEWVCESTLPNAHR 254
           H  T + S+    +D   + + S D T  +W     K I +  D   + +  S  P    
Sbjct: 215 H--TCYISEIEFLDDN-SILTASGDMTCALWDITKSKRINEFADHLGDVLSLSAAPTETE 271

Query: 255 SQIYGVAWSPSGRIASVGADGVLAVYKEKQNDSEVSEWEISATYKAAHTVYEINTVKWVN 314
                         AS G+DG L ++ +K+  + V  + +S +        +++ VK+  
Sbjct: 272 GN--------GNVFASGGSDGYLYIW-DKRVPTSVQSFFVSDS--------DVSKVKFFR 314

Query: 315 IDGKEMLITAGDDGRVNL 332
                 + T  DDG  NL
Sbjct: 315 --NGNTIATGSDDGCTNL 330

 Score = 29.6 bits (65), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 11/38 (28%), Positives = 23/38 (60%)

Query: 102 ELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWE 139
           E++  ++GH + + G++ S DG  + T S D ++ +W 
Sbjct: 426 EIIGKLDGHSDRISGVATSPDGLAICTGSWDMTMKVWS 463

>Kwal_56.23895
          Length = 367

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 63/154 (40%), Gaps = 29/154 (18%)

Query: 8   SLKLHND-KVWSIDFEPVRG-LLATGSTDRAIKVLQLK------NGKENLLDVLDDTVHK 59
           S   HN  +  + DF   R  ++ATG  D  IKV  L+      +     + V +   H 
Sbjct: 215 SFLAHNGMETLTCDFNKYRSHIVATGGVDNMIKVWDLRMVRKAASNSRQPMSVNEICGHD 274

Query: 60  KAVRSVAWRP-HSDLLAAGSFDSTISIW------------TQSDLDLEEGAKLEMELLAI 106
            A+R V+W P HS++L + S+D T  +W              + +D   G +       +
Sbjct: 275 LAIRKVSWSPHHSNMLLSTSYDMTCRVWQDLSDDGRRPTGKTNSVDPARGCRF------V 328

Query: 107 IEGHENEVKGISWSQDG--CLLATCSRDKSVWIW 138
              H   V G  WS  G    +A+ S D  V +W
Sbjct: 329 FPHHTEFVFGADWSLWGKPGYIASTSWDGDVCVW 362

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 54/127 (42%), Gaps = 21/127 (16%)

Query: 125 LLATCSRDKSVWIWE----TDEAGEEYECISV--LQEHSQDVKHVVWHTKH-NLLASSSY 177
           ++AT   D  + +W+       A    + +SV  +  H   ++ V W   H N+L S+SY
Sbjct: 236 IVATGGVDNMIKVWDLRMVRKAASNSRQPMSVNEICGHDLAIRKVSWSPHHSNMLLSTSY 295

Query: 178 DDTVRIWKDYDDDWE--------------CAAVLTGHEGTIWCSDFSKEEDPIRLCSGSD 223
           D T R+W+D  DD                C  V   H   ++ +D+S    P  + S S 
Sbjct: 296 DMTCRVWQDLSDDGRRPTGKTNSVDPARGCRFVFPHHTEFVFGADWSLWGKPGYIASTSW 355

Query: 224 DSTVRVW 230
           D  V VW
Sbjct: 356 DGDVCVW 362

 Score = 29.3 bits (64), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 53/118 (44%), Gaps = 17/118 (14%)

Query: 79  FDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCL-----------LA 127
           FD+ +++ T S+  L    KL +  +   +G   E K    +QDG             + 
Sbjct: 20  FDNRLAVATGSNFGLVGNGKLFIVDINN-QGIMTEAKSF-LTQDGLFDVAWNELHENQVL 77

Query: 128 TCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWH-TKHNLLASSSYDDTVRIW 184
               D S+ +++T     +Y  I++  EH ++V    W+     L  SSS+D TV++W
Sbjct: 78  VAQGDGSLRLFDTQLT--DYP-IAIFHEHEKEVFSCNWNLINKQLFVSSSWDGTVKVW 132

>YDR128W (YDR128W) [975] chr4 (709543..712989) Protein containing
           five WD domains (WD-40 repeat), which may mediate
           protein-protein interactions, has a region of low
           similarity to a region of S. cerevisiae Sec27p, which a
           coatomer (COPI) complex beta' chain (beta'-COP) of
           secretory pathway vesicles [3447 bp, 1148 aa]
          Length = 1148

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 59/128 (46%), Gaps = 6/128 (4%)

Query: 106 IIEGHENEVKGISWS-QDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVV 164
           ++ GH   +  I+++ Q   +LATCS D  V  W+       +   S  +  +  VK   
Sbjct: 109 VLHGHSRAITDINFNPQHPDVLATCSVDTYVHAWDMRSPHRPFYSTSSWRSAASQVK--- 165

Query: 165 WHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDD 224
           W+ K   + +SS+ + + +W D          L GH  ++   DF++ +    + S S+D
Sbjct: 166 WNYKDPNVLASSHGNDIFVW-DLRKGSTPLCSLKGHVSSVNSIDFNRFKYS-EIMSSSND 223

Query: 225 STVRVWKY 232
            TV+ W Y
Sbjct: 224 GTVKFWDY 231

>AGR242C [4553] [Homologous to ScYIR012W (SQT1) - SH]
           (1203152..1204411) [1260 bp, 419 aa]
          Length = 419

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/236 (22%), Positives = 92/236 (38%), Gaps = 33/236 (13%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGI 117
           H  +V +VA  P   L+ +G  D+   +WT       E   +E         H   V G 
Sbjct: 59  HTDSVFTVAAHPKLPLVVSGGGDNKAHLWTTHREPPREAGSVE---------HSESVIGA 109

Query: 118 SWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKH----NLLA 173
           +++ DG  L T   +  V +      G+E+   + LQE    V  V W   H     + A
Sbjct: 110 AFTADGRYLVTADMNGQVRVQVAARQGQEWRPAAELQE----VDEVTWLKVHPHRAGIFA 165

Query: 174 SSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCS-----DFSKEEDPIRLCSGSDDSTVR 228
             + D +V  ++    +     ++TG      C+     + + +++ + L + S D T+ 
Sbjct: 166 IGAVDGSVWCYEMDTQNNTPVLLMTGVAHAQDCTMGVFLETAADDENVILVTCSLDGTII 225

Query: 229 VWK-YIGDD---------EDDQQEWVCESTLP-NAHRSQIYGVAWSPSGRIASVGA 273
            W  Y G           +  + +W+  STLP   +R        S SG +A + A
Sbjct: 226 GWNCYSGQQVFKVTPSELKGQEAQWITLSTLPLGINRGSPIVACGSNSGLLAVINA 281

>YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein
           required in ubiquitin proteolysis and found complexed
           with Cdc48p, has WD (WD-40) repeats [2148 bp, 715 aa]
          Length = 715

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/218 (22%), Positives = 102/218 (46%), Gaps = 35/218 (16%)

Query: 18  SIDFEPVRGLLATGSTDRAIKVLQL--KNGKENLLDVLDDTVHKKAVRSVAWRPHSDLLA 75
           S+ ++  + LL  G  D  I  + L   +G++ L  ++    H+  V S++++    ++ 
Sbjct: 59  SVCYDSEKELLLFGGKDTMINGVPLFATSGEDPLYTLIG---HQGNVCSLSFQ--DGVVI 113

Query: 76  AGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEV---KGISWSQDGCLLATCSRD 132
           +GS+D T  +W       +EG+     L+  ++ H   V   K +S+S++  L  T S D
Sbjct: 114 SGSWDKTAKVW-------KEGS-----LVYNLQAHNASVWDAKVVSFSENKFL--TASAD 159

Query: 133 KSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWE 192
           K++ +W+ D+  + +  I     H+  V+H+      + ++ S+ D  +++   +  D  
Sbjct: 160 KTIKLWQNDKVIKTFSGI-----HNDVVRHLAVVDDGHFISCSN-DGLIKLVDMHTGD-- 211

Query: 193 CAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
                 GHE  ++C       D   + S  +D TVR+W
Sbjct: 212 VLRTYEGHESFVYCIKLLPNGD---IVSCGEDRTVRIW 246

 Score = 29.6 bits (65), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 82/197 (41%), Gaps = 49/197 (24%)

Query: 104 LAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDV--K 161
           L  + GH+  V  +S+ QDG +++  S DK+  +W+      E   +  LQ H+  V   
Sbjct: 92  LYTLIGHQGNVCSLSF-QDGVVIS-GSWDKTAKVWK------EGSLVYNLQAHNASVWDA 143

Query: 162 HVVWHTKHNLLASSSYDDTVRIWKD-----------YDDDWECAAVLTGHEGTIWCSDFS 210
            VV  +++  L +S+ D T+++W++            D     A V  GH   I CS+  
Sbjct: 144 KVVSFSENKFLTASA-DKTIKLWQNDKVIKTFSGIHNDVVRHLAVVDDGH--FISCSN-- 198

Query: 211 KEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIAS 270
             +  I+L        +R ++                     H S +Y +   P+G I S
Sbjct: 199 --DGLIKLVDMHTGDVLRTYE--------------------GHESFVYCIKLLPNGDIVS 236

Query: 271 VGADGVLAVYKEKQNDS 287
            G D  + ++  K+N S
Sbjct: 237 CGEDRTVRIW-SKENGS 252

>KLLA0E11297g complement(994770..996308) similar to sp|P38262
           Saccharomyces cerevisiae YBR103w SIF2 SIR4P interacting
           protein, start by similarity
          Length = 512

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/240 (21%), Positives = 92/240 (38%), Gaps = 48/240 (20%)

Query: 59  KKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGIS 118
           ++ + SV+W P  +L+  G+    + +W +           + +L  I++ H + +  + 
Sbjct: 209 EEPIISVSWSPDGELVLTGTTSGELRLWNK-----------QGKLKNILDSHRSPIVAMK 257

Query: 119 WSQDGCLLATCSRDKSVWIWETDEAGEEYECIS-----VLQEHSQDV--------KHVVW 165
           W+QD   L T      V +W T   G + +  S     +  E S  +        K V+ 
Sbjct: 258 WNQDCTHLLTTDVSNVVILWST-LTGTQLQHFSFKEGDIENEDSLGIDLEWVETDKFVIP 316

Query: 166 HTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDS 225
               +LL  +  ++            +    L GH  TI   +F+K      L S SDD+
Sbjct: 317 GPGGSLLVYTIGNN------------KPLGRLLGHTSTITTLEFNKSNK--SLLSASDDN 362

Query: 226 TVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYKEKQN 285
           T++VW+  G +     ++         H   I    W     I S   DG + V+   +N
Sbjct: 363 TIKVWR--GGNSSAANDFT-------DHTKTISSAHWINDDLIISTAYDGTVKVWSISKN 413

 Score = 32.3 bits (72), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 38/221 (17%), Positives = 87/221 (39%), Gaps = 48/221 (21%)

Query: 2   PLQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKA 61
           P+ L    +   + + S+ + P   L+ TG+T      L+L N +  L ++LD   H+  
Sbjct: 198 PIDLVYPKRSEEEPIISVSWSPDGELVLTGTTSGE---LRLWNKQGKLKNILDS--HRSP 252

Query: 62  VRSVAWRPHSDLLAAGSFDSTISIWT-------------QSDLDLEEGAKLEME------ 102
           + ++ W      L      + + +W+             + D++ E+   +++E      
Sbjct: 253 IVAMKWNQDCTHLLTTDVSNVVILWSTLTGTQLQHFSFKEGDIENEDSLGIDLEWVETDK 312

Query: 103 -------------------LLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEA 143
                               L  + GH + +  + +++    L + S D ++ +W     
Sbjct: 313 FVIPGPGGSLLVYTIGNNKPLGRLLGHTSTITTLEFNKSNKSLLSASDDNTIKVWR---- 368

Query: 144 GEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIW 184
           G      +   +H++ +    W    +L+ S++YD TV++W
Sbjct: 369 GGNSSAANDFTDHTKTISSAHW-INDDLIISTAYDGTVKVW 408

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 72/186 (38%), Gaps = 29/186 (15%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHS 71
           H   + +++F      L + S D  IKV +  N         D T H K + S  W  + 
Sbjct: 339 HTSTITTLEFNKSNKSLLSASDDNTIKVWRGGNSSA----ANDFTDHTKTISSAHWI-ND 393

Query: 72  DLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSR 131
           DL+ + ++D T+ +W+ S   +   A L+ E   I E         S S D   L   + 
Sbjct: 394 DLIISTAYDGTVKVWSISKNSIVAEASLDSE--PIFEA--------SLSPDRNWLTVGTL 443

Query: 132 DKSVWIWETDEAGEEYECISVLQEH-----------SQD---VKHVVWHTKHNLLASSSY 177
             S  +++     E Y+  SV Q+             QD   V ++ W+ +    A S  
Sbjct: 444 QGSAIVFDVKTFLESYDQNSVQQQSVPISTYGEYQIDQDGLQVTNIAWNNESTAFAVSYI 503

Query: 178 DDTVRI 183
           +   R+
Sbjct: 504 NGNTRL 509

>AAL009C [178] [Homologous to ScYNL006W (LST8) - SH]
           (325785..326696) [912 bp, 303 aa]
          Length = 303

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/210 (20%), Positives = 83/210 (39%), Gaps = 43/210 (20%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENE---- 113
           H+  V S+A++  +  + + S D TI +W      ++   K +  +  ++  H N+    
Sbjct: 74  HRGNVTSIAFQQDNKWMVSSSEDGTIKVWDVRSPSVQRNYKHDAPVNEVVI-HPNQGELI 132

Query: 114 -----------------------------VKGISWSQDGCLLATCSRDKSVWIWE----T 140
                                        ++ +S + DG +L   +   + ++W+    T
Sbjct: 133 SCDQDGNIKIWDLGENQCTNQLALEDNTALQSLSIASDGSMLVAGNNKGNCYVWKMPNHT 192

Query: 141 DEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGH 200
           D A    + ++  + HS+ +  V+       LA+ S D T R+W   +D+++    L  H
Sbjct: 193 DTA--SLKPVTKFRSHSKYITRVLLSVDVKHLATCSADHTARVWS-VEDNFQLETTLDAH 249

Query: 201 EGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
              +W   FS   D   L +   D  VR+W
Sbjct: 250 SRWVWDCAFSA--DSAYLVTACSDHYVRLW 277

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 51/125 (40%), Gaps = 8/125 (6%)

Query: 107 IEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWH 166
            EGH   V  I++ QD   + + S D ++ +W+      +        +H   V  VV H
Sbjct: 71  FEGHRGNVTSIAFQQDNKWMVSSSEDGTIKVWDVRSPSVQRN-----YKHDAPVNEVVIH 125

Query: 167 TKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDST 226
                L S   D  ++IW D  ++ +C   L   + T   S  S   D   L +G++   
Sbjct: 126 PNQGELISCDQDGNIKIW-DLGEN-QCTNQLALEDNTALQS-LSIASDGSMLVAGNNKGN 182

Query: 227 VRVWK 231
             VWK
Sbjct: 183 CYVWK 187

>Kwal_34.15818
          Length = 349

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 58/127 (45%), Gaps = 14/127 (11%)

Query: 152 VLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSK 211
           +L+ H + +  V ++ + +L+ + + D+   +W  Y  + E      GH+GTIW  D  +
Sbjct: 5   LLKGHERSLTQVKFNREGDLIFTCAKDNVASVW--YSINGERLGTFEGHQGTIWSIDVDQ 62

Query: 212 EEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASV 271
                   +GS D ++++WK     +D    +  ++  P      +  V +SPSG     
Sbjct: 63  FTQ--YAVTGSADFSIKLWKV----QDGTNVFTWKTKTP------VRRVQFSPSGDKILA 110

Query: 272 GADGVLA 278
             DGV+ 
Sbjct: 111 VLDGVMG 117

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 62/291 (21%), Positives = 115/291 (39%), Gaps = 36/291 (12%)

Query: 8   SLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAW 67
           + + H   +WSID +       TGS D +IK+ ++++G  N+         K  VR V +
Sbjct: 47  TFEGHQGTIWSIDVDQFTQYAVTGSADFSIKLWKVQDGT-NVFTWKT----KTPVRRVQF 101

Query: 68  RPHSDLLAA-----GSFDSTISIWT-QSDLDLEEGAKL-EMELLAIIEGHENEVKGI-SW 119
            P  D + A       +  +++++T + D + ++   + E     I+     E+  + +W
Sbjct: 102 SPSGDKILAVLDGVMGYPGSVTVYTVRRDPETKDIVDISEEPTFNILTREGFEIAAVAAW 161

Query: 120 SQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYD- 178
           S +   +    +D  V  +E    G   E I     H+Q+V  + +        +SS D 
Sbjct: 162 SFNDTYIVAGHKDGRVSKYE----GHSGEYIDSAALHTQNVSDIQFSPDGTYFITSSRDS 217

Query: 179 -------DTVRIWKDYDDDWEC-AAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
                  +T+ + K Y+ D    +A +T  +  +        +D     S       R +
Sbjct: 218 AAKLVDTETLEVLKTYETDCPLNSACITPLKQFVILGGGQDAKDVTTTSSREGKFEARFY 277

Query: 231 KYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSG-RIASVGADGVLAVY 280
             I  DE  + +          H   +  VA SP G   AS G DG + ++
Sbjct: 278 HKIFQDEIGRVK---------GHFGPLNYVAVSPQGTSYASGGEDGFVRLH 319

>KLLA0C07513g complement(656060..657379) similar to sp|P39946
           Saccharomyces cerevisiae YOR269w PAC1 singleton, start
           by similarity
          Length = 439

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 71/178 (39%), Gaps = 42/178 (23%)

Query: 74  LAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGC--LLATCSR 131
           LA  S D    IW   +L+L+      +  +  + GHE+ V    + + G   LLATCSR
Sbjct: 171 LATTSKDLNTKIW---ELELDS----TLSHIKTLAGHEHTVSDCQFFERGADLLLATCSR 223

Query: 132 DKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDW 191
           D  + IW+         CI   Q H+Q ++ +  H     + + S D  +R+       W
Sbjct: 224 DLYLKIWDISNGW----CIKSFQPHTQWIRSL--HVHGEFVLTGSNDSAIRL-----THW 272

Query: 192 ECAAVLTGHEGTIWCSDFSKEE------DPIRL------------CSGSDDSTVRVWK 231
                L+   G     DF  E+      DP  L             S S D T+R+WK
Sbjct: 273 PSGNGLSMGIG----HDFPVEKVLILIPDPQHLQPQYQPLGFQHVASASRDGTIRLWK 326

>KLLA0F19734g 1826828..1830229 similar to sgd|S0002535 Saccharomyces
           cerevisiae YDR128w, start by similarity
          Length = 1133

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 60/128 (46%), Gaps = 6/128 (4%)

Query: 106 IIEGHENEVKGISWSQ-DGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVV 164
           ++ GH   +  I++      +LAT S D     W+     + Y   S  +  +  VK   
Sbjct: 109 VLHGHFRAITDINFHPLQPEILATSSIDTYALAWDMRSPKKPYFRTSNWRSGAAQVK--- 165

Query: 165 WHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDD 224
           W+ K++ + ++S+ + V +W D        +VL GH G++   DF+   +   + SG +D
Sbjct: 166 WNHKNSNVLATSHSNIVYVW-DVRKGTSPLSVLEGHSGSVNSIDFNPFNETEIMSSG-ND 223

Query: 225 STVRVWKY 232
            TV+ W Y
Sbjct: 224 GTVKFWDY 231

>Scas_718.6*
          Length = 546

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 58/281 (20%), Positives = 100/281 (35%), Gaps = 67/281 (23%)

Query: 56  TVHKKAVRSVAWRPHSD-LLAAGSFDSTISIWTQSDLDLEEGAKLEME---LLAIIEGHE 111
           T+  K V S +W   ++ LLA G  DS   +   +  D +  + LE+     L+ I G +
Sbjct: 179 TLDNKVVTS-SWNLQNERLLAYGQEDSMAKMIEYNKEDKKIISSLELRHPFALSSITGRK 237

Query: 112 -NEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHN 170
            N++  +SWS DG L+ T   +  + +W  D   +     +V   H   +  + W+    
Sbjct: 238 TNQITALSWSPDGELIITSVENGELRLWNKDGRLQ-----NVFNFHRSPIVSIKWNEDSK 292

Query: 171 LLASSSYDDTVRIWKDYD------------------------------------------ 188
              S   D+   +W   +                                          
Sbjct: 293 HFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSIL 352

Query: 189 ----DDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWV 244
               DD +    L GH+GTI C +F+     + L S   D ++R+W         Q+E  
Sbjct: 353 VYSIDDNKPIGKLLGHQGTISCIEFNV-NSRLLLTSSDSDYSIRIWH-------GQKENC 404

Query: 245 CESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYKEKQN 285
           C       H   I  ++W     + S   DG + ++   +N
Sbjct: 405 CNCFY--GHSQSIISLSWINDDLVISASMDGSVRIWSVVEN 443

>Sklu_1880.3 YDR364C, Contig c1880 4293-5708
          Length = 471

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 53/272 (19%), Positives = 98/272 (36%), Gaps = 53/272 (19%)

Query: 1   MPLQLAKSLKLHNDKVWSIDFEPVRG-LLATGSTDRAIKVLQLKNGKENLLDVLDDTVHK 59
           +P ++  + K H +    + F P  G L  +G  D  I +  + + +  L D      H+
Sbjct: 166 LPKKIIYTFKGHVNGTTKLKFLPETGHLFLSGGNDNVINIWDMYHERTLLRDYRG---HR 222

Query: 60  KAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEG-AKLEME---------------- 102
           KAVR + +        + SFD T+ +W     D E G  K  ++                
Sbjct: 223 KAVRDINFNSDGTEFLSVSFDQTLKVW-----DTETGKVKSRLKWHSVPNCATYHPTNNN 277

Query: 103 -----------------------LLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWE 139
                                  L+     H + +  + +  DG    + S DK+V IWE
Sbjct: 278 EYIVGLSNSEIRHYDSRVSNKEGLIQTYNHHLSSIISLKYFPDGSKFISSSEDKTVRIWE 337

Query: 140 TDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWK-DYDDDWECAAVLT 198
            ++     + IS   ++S  + ++  H + +  ++ S D+ +  +            V  
Sbjct: 338 -NQVNIPIKQISDTSQYS--MPYLEIHPEQHYFSAQSMDNAIYSFSMKPKYKKNLKKVFR 394

Query: 199 GHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
           GH    +  +F    D   + SG    +V VW
Sbjct: 395 GHLCAGFGINFGFSPDGQYIVSGDSRGSVVVW 426

>CAGL0L02761g complement(320826..322085) similar to sp|P18851
           Saccharomyces cerevisiae YOR212w STE4, hypothetical
           start
          Length = 419

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/154 (22%), Positives = 67/154 (43%), Gaps = 11/154 (7%)

Query: 80  DSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWE 139
           D+ +   T S   +  GA + ++ + I++GH N++    WS+D  L+ + S+D  + +W+
Sbjct: 55  DTNLLEMTASVPAITPGA-INLKPVGILKGHTNKIADFRWSRDSKLILSASQDGFMIVWD 113

Query: 140 TDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDD---DWECAAV 196
           +    +     S +   SQ V          L AS+  ++   I++            ++
Sbjct: 114 SLTGLKR----SAIPLDSQWVLTCALSPSGALAASAGLNNNCTIYRMPRGSAVQQNVTSI 169

Query: 197 LTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
             GH G I   +F  E    R+ + S D T  +W
Sbjct: 170 FKGHTGYISGVEFVSES---RVVTSSGDMTCALW 200

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 25/40 (62%)

Query: 99  LEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIW 138
           L+ E++  +EGH N + G+  S DG  + T S D+++ +W
Sbjct: 370 LKGEVVYSLEGHGNRLAGVKCSPDGMAICTGSWDQTLKLW 409

>YGR225W (AMA1) [2174] chr7 (945146..946328,946422..946927) Protein
           required for proper meiosis and sporulation, associates
           with and regulates the activity of anaphase promoting
           complex/cyclosome (APC/C), member of Cdc20 family of
           proteins [1689 bp, 562 aa]
          Length = 562

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 69/145 (47%), Gaps = 28/145 (19%)

Query: 47  ENLLDV-LDDTVHKKA--VRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMEL 103
           ENL+ + L  T   +A  V  ++   H++LLA G  D++ S+W  SDLD          +
Sbjct: 375 ENLIGLKLHSTYQAQAQQVCGISLNEHANLLAVGGNDNSCSLWDISDLD--------KPI 426

Query: 104 LAIIEGHENEVKGIS---WSQDGCLLAT--CSRDKSVWIWETDEAGEEYECISVLQE--H 156
              +  H+  VK I+   WS+   LLAT   S+D+ +  W T          ++L E   
Sbjct: 427 KKFVLPHKAAVKAIAFCPWSKS--LLATGGGSKDRCIKFWHTSTG-------TLLDEICT 477

Query: 157 SQDVKHVVWHTKH-NLLASSSYDDT 180
           S  V  ++W  +H  ++A+  + DT
Sbjct: 478 SGQVTSLIWSLRHKQIVATFGFGDT 502

>ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH]
           (1158218..1159258) [1041 bp, 346 aa]
          Length = 346

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 68/145 (46%), Gaps = 27/145 (18%)

Query: 152 VLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSK 211
           +L  H + +  V ++ + +L+ +S  D+   +W  Y  + E    L GH G+IW  D  +
Sbjct: 5   MLMGHERSLTQVKYNREGDLIFTSGKDNVASVW--YAMNGERLGTLEGHNGSIWSIDVDQ 62

Query: 212 EEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNA--HRSQIYGVAWSPSG-RI 268
             +     +GS D +V+VW+            V + ++ ++   R+ +  V +SP+G R+
Sbjct: 63  HTE--YAVTGSADFSVKVWR------------VRDGSIAHSWDTRTPVRRVEFSPTGDRV 108

Query: 269 ASV--------GADGVLAVYKEKQN 285
            +V        GA  V +V ++  N
Sbjct: 109 LAVLDNVMNYAGAIVVFSVTRDANN 133

 Score = 35.0 bits (79), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 44/202 (21%), Positives = 77/202 (38%), Gaps = 32/202 (15%)

Query: 8   SLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVH----KKAVR 63
           +L+ HN  +WSID +       TGS D ++KV ++++G            H    +  VR
Sbjct: 47  TLEGHNGSIWSIDVDQHTEYAVTGSADFSVKVWRVRDGS---------IAHSWDTRTPVR 97

Query: 64  SVAWRPHSDLLAA-----GSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHEN--EVKG 116
            V + P  D + A      ++   I +++ +     +       L   I   E    V  
Sbjct: 98  RVEFSPTGDRVLAVLDNVMNYAGAIVVFSVTRDANNQITGFNSGLSCEILTQEGCAPVLV 157

Query: 117 ISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSS 176
            SWS DG  +    +D  +  +     G   EC+ +   H Q V  + +        ++S
Sbjct: 158 ASWSYDGKYIVAGHQDGKISKYN----GVTGECLEIKDLHKQRVSDIQFSLDRTYFLTTS 213

Query: 177 YD--------DTVRIWKDYDDD 190
            D        +T  + K Y+ D
Sbjct: 214 RDSYANLVDVETFEVLKTYETD 235

 Score = 29.3 bits (64), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 32/82 (39%), Gaps = 10/82 (12%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGI 117
           H++++  V +    DL+     D+  S+W            +  E L  +EGH   +  I
Sbjct: 9   HERSLTQVKYNREGDLIFTSGKDNVASVW----------YAMNGERLGTLEGHNGSIWSI 58

Query: 118 SWSQDGCLLATCSRDKSVWIWE 139
              Q      T S D SV +W 
Sbjct: 59  DVDQHTEYAVTGSADFSVKVWR 80

 Score = 28.9 bits (63), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 17/82 (20%), Positives = 41/82 (50%), Gaps = 8/82 (9%)

Query: 106 IIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDV--KHV 163
           ++ GHE  +  + ++++G L+ T  +D    +W         E +  L+ H+  +    V
Sbjct: 5   MLMGHERSLTQVKYNREGDLIFTSGKDNVASVWYAMNG----ERLGTLEGHNGSIWSIDV 60

Query: 164 VWHTKHNLLASSSYDDTVRIWK 185
             HT++ +  S+ +  +V++W+
Sbjct: 61  DQHTEYAVTGSADF--SVKVWR 80

>KLLA0A08822g 772565..774313 similar to sp|P53197 Saccharomyces
           cerevisiae YGL003c CDH1 substrate-specific activator of
           APC-dependent proteolysis, start by similarity
          Length = 582

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 74/160 (46%), Gaps = 33/160 (20%)

Query: 45  GKENLLDVLDDTV---------HKKAVRSVAWRPHSDLLAA---GSFDSTISIWTQSDLD 92
           G +N++ V D T+         H  AV+++AW PH+  + A   G+ D  + IW     +
Sbjct: 420 GNDNMVYVYDGTLRQPMLSMEEHTAAVKAMAWSPHTRGVLATGGGTADKKLKIW-----N 474

Query: 93  LEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATC----SRDKSVWIWETDEAGEEYE 148
           + +  KL      +  G  +++  + WS++   + T       + ++W + T       E
Sbjct: 475 ISKAVKLN----EVDTG--SQLCNMLWSKNTDEIITSHGYSKYNLTLWNYPT------LE 522

Query: 149 CISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYD 188
            ++VL+ HS  V H+        + S + D+T+R WK +D
Sbjct: 523 PMAVLKGHSFRVLHLTLSADGTTVVSGAGDETLRYWKLFD 562

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 57/237 (24%), Positives = 103/237 (43%), Gaps = 39/237 (16%)

Query: 7   KSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVA 66
           ++L  H D+V  + +     +L++GS DR I    ++   E   + +D   H + V  + 
Sbjct: 354 RTLSGHVDRVACLSWN--NHVLSSGSRDRKILHRDVR-APEPFFEQID--THSQEVCGLK 408

Query: 67  WRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWS-QDGCL 125
           W  + + LA+G  D+ + ++            L   +L++ E H   VK ++WS     +
Sbjct: 409 WNVNENKLASGGNDNMVYVY---------DGTLRQPMLSM-EEHTAAVKAMAWSPHTRGV 458

Query: 126 LATC--SRDKSVWIWETDEAGEEYE-------CISVLQEHSQDVKHVVWHTKHNLLASSS 176
           LAT   + DK + IW   +A +  E       C  +  +++ ++     ++K+NL     
Sbjct: 459 LATGGGTADKKLKIWNISKAVKLNEVDTGSQLCNMLWSKNTDEIITSHGYSKYNLT---- 514

Query: 177 YDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYI 233
                 +W +Y    E  AVL GH   +     S   D   + SG+ D T+R WK  
Sbjct: 515 ------LW-NYPT-LEPMAVLKGHSFRVLHLTLSA--DGTTVVSGAGDETLRYWKLF 561

>Scas_720.45
          Length = 755

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 51/123 (41%), Gaps = 16/123 (13%)

Query: 65  VAWRPH-SDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQ-- 121
           VA+ P   +  A+G  D T+ +W+                  +  G E  V  + +    
Sbjct: 3   VAFNPKDPNTFASGCLDRTVKVWSLGQATPN---------FTLNSGQEKGVNYVDYYPLP 53

Query: 122 DGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTV 181
           D   L T S D +  +W+     +   C++ L+ H  +V   V+H    ++ S S D T+
Sbjct: 54  DKPYLITSSDDLTCKVWDY----QTKSCVATLEGHMANVSFAVFHPTLPIIISGSEDGTL 109

Query: 182 RIW 184
           +IW
Sbjct: 110 KIW 112

 Score = 35.0 bits (79), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 53/136 (38%), Gaps = 24/136 (17%)

Query: 170 NLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRV 229
           N  AS   D TV++W           + +G E  +   D+    D   L + SDD T +V
Sbjct: 11  NTFASGCLDRTVKVWS-LGQATPNFTLNSGQEKGVNYVDYYPLPDKPYLITSSDDLTCKV 69

Query: 230 WKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGA-DGVLAVYKEKQNDSE 288
           W Y        Q   C +TL   H + +    + P+  I   G+ DG L ++        
Sbjct: 70  WDY--------QTKSCVATL-EGHMANVSFAVFHPTLPIIISGSEDGTLKIWN------- 113

Query: 289 VSEWEISATYKAAHTV 304
                 SATYK   T+
Sbjct: 114 ------SATYKVEKTL 123

>Kwal_33.13515
          Length = 398

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 55/126 (43%), Gaps = 15/126 (11%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGI 117
           H  A+  +   P +  L AGS D+  S W  S +  E           +I G +  +  +
Sbjct: 235 HTGAITCMKLDPDNRFLVAGSLDTICSFWDLSSMCCER----------VINGFDTSILDL 284

Query: 118 SWSQDGCLLATCSRDKS-VWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSS 176
             S+DG  +  CS +++ +++ E+     E+E  + +++     K   +  K + LA S 
Sbjct: 285 DLSRDGVAVGLCSDNQTRIYLIESGACLYEFESKNKIEKQ----KFRFYPGKMSFLAVSD 340

Query: 177 YDDTVR 182
            D  V+
Sbjct: 341 NDGVVK 346

>Scas_660.7*
          Length = 603

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 38/71 (53%), Gaps = 3/71 (4%)

Query: 217 RLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLP-NAHRSQIYGVAWSPSGRIASVGADG 275
           +  + S D+T+RVW    +     Q+WV  S+   N  R Q  GV  S  GRI S+  DG
Sbjct: 252 KFVTASADATIRVWDV--NSSKCVQKWVVTSSSDDNVLRDQQVGVVASQEGRIVSLSLDG 309

Query: 276 VLAVYKEKQND 286
            L +++ +Q++
Sbjct: 310 TLNIFQLEQDN 320

>Kwal_56.23035
          Length = 424

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 63/243 (25%), Positives = 97/243 (39%), Gaps = 38/243 (15%)

Query: 110 HENEVKGISW-SQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWH-- 166
           H   +  + W   D  L  T S D  V +W+T+     +E  S +     DV H V    
Sbjct: 141 HAFSITSVQWYGADNGLFFTGSNDHKVKVWDTNA----FEVASTI-----DVGHRVVQLD 191

Query: 167 TKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGT-----IWCSDFSK--EEDPIRL- 218
            + +LLA +S D   R+    D     AA+  G + T     I  + F++  E  P +L 
Sbjct: 192 VQGDLLAVASEDSHPRL---IDLASMSAAITLGVKRTDMRYGINTAKFARSDEGSPQQLL 248

Query: 219 CSGSDDSTVRVWKYIGDDED--DQQEWVCESTLPNAHRSQIYGVAWSPSG--RIASVGAD 274
            +G DD  VR+W     +    D QE     +L   H      + W PSG  RI + G D
Sbjct: 249 ATGDDDGNVRLWDLRMGNRALCDLQE---PDSLAKPHARCCNDLCWDPSGANRIVTTGND 305

Query: 275 GVLAVYKEKQNDSEVSEWEISAT--------YKAAHTVYEINTVKWVNIDGKEMLITAGD 326
           G   +++   + S     +I AT         + +H +       + N D  E+L+    
Sbjct: 306 GKCKLWEISPDGSSQLLRQIGATDLTSNRFRRRTSHYLMWHGQYIFYNSDHGEILVFGSH 365

Query: 327 DGR 329
            GR
Sbjct: 366 HGR 368

>YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the
           trimeric G protein that mediates signal transduction by
           pheromones, member of the WD (WD-40) repeat family [1272
           bp, 423 aa]
          Length = 423

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 55/244 (22%), Positives = 111/244 (45%), Gaps = 35/244 (14%)

Query: 98  KLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHS 157
           K+ ++   +++GH N++    WS+D   + + S+D  + IW++  +G +   I +    S
Sbjct: 79  KINLKPNIVLKGHNNKISDFRWSRDSKRILSASQDGFMLIWDS-ASGLKQNAIPL---DS 134

Query: 158 QDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDD---WECAAVLTGHEGTIWCSDFSKEED 214
           Q V          L+AS+  ++   I++   ++      A++  GH  T + SD  +  D
Sbjct: 135 QWVLSCAISPSSTLVASAGLNNNCTIYRVSKENRVAQNVASIFKGH--TCYISDI-EFTD 191

Query: 215 PIRLCSGSDDSTVRVW-----KYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIA 269
              + + S D T  +W     K + +  D   + V    +P    S+      + S   A
Sbjct: 192 NAHILTASGDMTCALWDIPKAKRVREYSDHLGD-VLALAIPEEPNSE------NSSNTFA 244

Query: 270 SVGADGVLAVYKEKQNDSEVSEWEISATYKAAHTVYEINTVKWVNIDGKEMLITAG-DDG 328
           S G+DG   ++ + ++ S V  + ++ +        +IN +++   DG  M I AG D+G
Sbjct: 245 SCGSDGYTYIW-DSRSPSAVQSFYVNDS--------DINALRFFK-DG--MSIVAGSDNG 292

Query: 329 RVNL 332
            +N+
Sbjct: 293 AINM 296

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%)

Query: 99  LEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIW 138
           L+ E++  +EGH   V G+  S DG  + T S D ++ IW
Sbjct: 379 LKGEIVGKLEGHGGRVTGVRSSPDGLAVCTGSWDSTMKIW 418

>CAGL0M02277g complement(271836..273119) highly similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46 Pre-mRNA splicing
           factor PRP46, hypothetical start
          Length = 427

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 55/261 (21%), Positives = 101/261 (38%), Gaps = 47/261 (18%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHS 71
           H   V ++D  P   ++ T   D  +KV  ++      L V+    HK  +  V   P  
Sbjct: 199 HLSGVHTVDIHPTVDVVVTAGRDSVVKVWDIRT----RLPVMTLPGHKGPITKVRCLPVD 254

Query: 72  DLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGIS-WSQDGCLLATCS 130
             + + S D++I +W     DL  G  ++     ++  H+  V+ IS    +    + C+
Sbjct: 255 PQVISSSVDASIRLW-----DLVAGKSMK-----VLTHHQRTVRDISVHPSEFSFASACT 304

Query: 131 RDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDD 190
            D   W+        + E ++       DV + V   + ++L + S + ++  + DY   
Sbjct: 305 NDIRSWLLP------KGELLTNFVSQDLDVINTVSINQDDVLFAGSDNGSLTFF-DYKSG 357

Query: 191 WECAAVLTGH-------EGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEW 243
            +     T         E  I  S F  +   +RL +G  D T+++WK        Q E 
Sbjct: 358 HKYQTFKTKEAPGSPESERGILSSTF--DGTGLRLLTGETDRTIKIWK--------QDET 407

Query: 244 VCESTLPNAHRSQIYGVAWSP 264
             + T PN        + W+P
Sbjct: 408 ASQDTHPN--------LPWNP 420

 Score = 36.6 bits (83), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 68/177 (38%), Gaps = 20/177 (11%)

Query: 28  LATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHSDLLAAGSFDSTISIWT 87
            ATGS D+ IK+  L +GK  +        H   VR +A       + + S D T+  W 
Sbjct: 131 FATGSNDKTIKIWNLASGKLKVT----LKAHDMTVRDLAISNRHPYMFSVSEDKTVKCW- 185

Query: 88  QSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEY 147
               DLE+   +         GH + V  +       ++ T  RD  V +W+        
Sbjct: 186 ----DLEKNTAIRN-----YHGHLSGVHTVDIHPTVDVVVTAGRDSVVKVWDI----RTR 232

Query: 148 ECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTI 204
             +  L  H   +  V        + SSS D ++R+W       +   VLT H+ T+
Sbjct: 233 LPVMTLPGHKGPITKVRCLPVDPQVISSSVDASIRLWDLVAG--KSMKVLTHHQRTV 287

>YDL195W (SEC31) [678] chr4 (107209..111030) Component (p150) of the
           COPII coat of secretory pathway vesicles involved in
           endoplasmic reticulum to Golgi transport, associated
           with Sec13p, member of WD (WD-40) repeat family [3822
           bp, 1273 aa]
          Length = 1273

 Score = 39.3 bits (90), Expect = 0.004,   Method: Composition-based stats.
 Identities = 61/277 (22%), Positives = 116/277 (41%), Gaps = 51/277 (18%)

Query: 78  SFDSTISIWTQSDLDLEEG-AKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVW 136
           S DS++ +W+    D E+  A L+++         ++   + WS +  ++A    + S+ 
Sbjct: 37  STDSSLELWSLLAADSEKPIASLQVD---------SKFNDLDWSHNNKIIAGALDNGSLE 87

Query: 137 IWETDEAGEEYECISVLQEHSQDVKHVVWHTKH-NLLASSSYDDTVRIWKDYDDDWECAA 195
           ++ T+EA      ++    HS  VK V ++ K  N+LAS   +  + IW    D  +C  
Sbjct: 88  LYSTNEANNAINSMARFSNHSSSVKTVKFNAKQDNVLASGGNNGEIFIW----DMNKCTE 143

Query: 196 VLTGHEGTIWCSDFSKEEDPIRL----------CSGSDDSTVRVWKYIGDDEDDQQEWVC 245
             + +         S  ++ I L           S    +   +W     D   ++E + 
Sbjct: 144 SPSNYTPLTPGQSMSSVDEVISLAWNQSLAHVFASAGSSNFASIW-----DLKAKKEVIH 198

Query: 246 ES-TLPNAH-RSQIYGVAWSP--SGRIAS-VGADGVLAVYKEKQNDSEVSEWEISATYKA 300
            S T PN+  + Q+  V W P  S R+A+  G+D          ND  +  W++      
Sbjct: 199 LSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSD----------NDPSILIWDLRNANTP 248

Query: 301 AHTVYE-----INTVKWVNIDGKEMLITAGDDGRVNL 332
             T+ +     I ++ W + D + +L+++G D  V L
Sbjct: 249 LQTLNQGHQKGILSLDWCHQD-EHLLLSSGRDNTVLL 284

 Score = 32.7 bits (73), Expect = 0.51,   Method: Composition-based stats.
 Identities = 45/192 (23%), Positives = 85/192 (44%), Gaps = 25/192 (13%)

Query: 62  VRSVAWRPH-SDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIE---GHENEVKGI 117
           V S+AW    + + A+    +  SIW     DL+  AK E+  L+      G + ++  +
Sbjct: 163 VISLAWNQSLAHVFASAGSSNFASIW-----DLK--AKKEVIHLSYTSPNSGIKQQLSVV 215

Query: 118 SW-SQDGCLLATCS---RDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVW-HTKHNLL 172
            W  ++   +AT +    D S+ IW+   A    + ++  Q H + +  + W H   +LL
Sbjct: 216 EWHPKNSTRVATATGSDNDPSILIWDLRNANTPLQTLN--QGHQKGILSLDWCHQDEHLL 273

Query: 173 ASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWC--SDFSKEEDPIRLCSGSDDST-VRV 229
            SS  D+TV +W     +        G+    WC  + F+ E   +  C+  D+   V+ 
Sbjct: 274 LSSGRDNTVLLWNPESAEQLSQFPARGN----WCFKTKFAPEAPDLFACASFDNKIEVQT 329

Query: 230 WKYIGDDEDDQQ 241
            + + +  D+Q+
Sbjct: 330 LQNLTNTLDEQE 341

 Score = 28.5 bits (62), Expect = 9.0,   Method: Composition-based stats.
 Identities = 17/37 (45%), Positives = 20/37 (54%), Gaps = 2/37 (5%)

Query: 74  LAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGH 110
           LAAGS D   SIW     DLE+  KL+ +   I E H
Sbjct: 636 LAAGSLDKVASIWLSEFPDLED--KLKKDNKTIYEAH 670

>YGL116W (CDC20) [1869] chr7 (289810..291642) Activator of anaphase
           promoting complex (APC), required for microtubule
           function at mitosis and for exit from anaphase, contains
           WD (WD-40) repeats [1833 bp, 610 aa]
          Length = 610

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 52/221 (23%), Positives = 91/221 (41%), Gaps = 35/221 (15%)

Query: 73  LLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRD 132
           L+A GS    I I            +++  +++    H  EV G+S+  DG  LA+   D
Sbjct: 356 LIATGSRSGEIQI---------NDVRIKQHIVSTWAEHTGEVCGLSYKSDGLQLASGGND 406

Query: 133 KSVWIWETDEAGEEYECISVLQEHSQDVKHVVW-HTKHNLLASSS--YDDTVRIWK---- 185
            +V IW+T  +  ++      + H+  VK + W     N+LAS     D  +  W     
Sbjct: 407 NTVMIWDTRTSLPQFS----KKTHTAAVKALSWCPYSPNILASGGGQTDKHIHFWNSITG 462

Query: 186 ----DYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQ 241
                 +   + +++  G   T        +E  I    G+ ++ + V+ Y      + +
Sbjct: 463 ARVGSINTGSQVSSLHWGQSHTSTNGGMMNKE--IVATGGNPENAISVYNY------ETK 514

Query: 242 EWVCESTLPNAHRSQIYGVAWSPSG-RIASVGADGVLAVYK 281
             V E  + +AH ++I     SP G  +A+VG D  L  YK
Sbjct: 515 FKVAE--VVHAHEARICCSQLSPDGTTLATVGGDENLKFYK 553

>YEL056W (HAT2) [1372] chr5 (47168..48373) Histone acetyltransferase
           subunit 2, contains seven WD (WD-40) repeats [1206 bp,
           401 aa]
          Length = 401

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 63/123 (51%), Gaps = 9/123 (7%)

Query: 166 HTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDS 225
           H   NLLA++  D  V ++ D  +  E    ++GHE  +   +FS   D + + SGSD+ 
Sbjct: 261 HHSSNLLAAAGMDSYVYLY-DLRNMKEPLHHMSGHEDAVNNLEFSTHVDGVVVSSGSDNR 319

Query: 226 TVRVW--KYIGDDE--DDQQEWVCESTLPNA-HRSQIYGVAWSPSGR--IASVGADGVLA 278
            + +W  K IG ++  DD ++ V E  + +A HRS +     +P     +AS   + +L 
Sbjct: 320 -LMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQ 378

Query: 279 VYK 281
           V+K
Sbjct: 379 VWK 381

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 46/102 (45%), Gaps = 15/102 (14%)

Query: 141 DEAGEEYEC----------ISVLQEHSQDVKHVVWHTK-HNLLASSSYDDTVRIWKDYDD 189
           +EAGEEY+           I+   EH +++    +  +  N++A+ +   TV +   Y  
Sbjct: 92  EEAGEEYQSSLPAPRSNIRITAKYEHEEEITRARYMPQDPNIVATINGQGTVFL---YSR 148

Query: 190 DWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWK 231
                + L  H+   +   FS      RL SGSDD TV +W+
Sbjct: 149 SEGLQSTLKFHKDNGYALSFSTLVKG-RLLSGSDDHTVALWE 189

>CAGL0L09647g 1032740..1034029 highly similar to sp|P35184
           Saccharomyces cerevisiae YIR012w SQT1, start by
           similarity
          Length = 429

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/155 (20%), Positives = 59/155 (38%), Gaps = 31/155 (20%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGI 117
           H  +V  VA  P   L+A+G  D+ I +WT              +    + GH   V   
Sbjct: 63  HTDSVFVVAHHPSLPLVASGGADNVIHLWTSH--------SQPPKFAGTLSGHTESVIAA 114

Query: 118 SWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSY 177
            ++ DG  L +      + +  + + G +++ +S LQE    V+ ++W   H  ++    
Sbjct: 115 HFTPDGKFLVSADMTGKLLVHASVKGGAQWKLVSELQE----VEEIIWLKVHPKVSG--- 167

Query: 178 DDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKE 212
                           A  L   +G++WC   + E
Sbjct: 168 ----------------AFALGATDGSVWCYQINGE 186

 Score = 33.9 bits (76), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 35/83 (42%), Gaps = 9/83 (10%)

Query: 139 ETDEAGEEYECISV---------LQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDD 189
           E  E GE  E I V           +H+  V  V  H    L+AS   D+ + +W  +  
Sbjct: 37  EAMEGGEVEETIEVDLSNNSRTYFDKHTDSVFVVAHHPSLPLVASGGADNVIHLWTSHSQ 96

Query: 190 DWECAAVLTGHEGTIWCSDFSKE 212
             + A  L+GH  ++  + F+ +
Sbjct: 97  PPKFAGTLSGHTESVIAAHFTPD 119

>CAGL0G00704g 65805..67127 similar to sp|P39706 Saccharomyces
           cerevisiae YAR003w, hypothetical start
          Length = 440

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 51/104 (49%), Gaps = 9/104 (8%)

Query: 42  LKNGKENLLDVLDDTVHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEM 101
           LK+  E L+  L++ ++ + +    + P  D LA G  +  + I+     D++    + M
Sbjct: 12  LKDYPEKLVHTLENPLNTECLE---FSPGGDYLALGCSNGAVIIY-----DMDTLKPITM 63

Query: 102 ELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGE 145
            L + + GH   V  +SWS  G  L T SRD  + +W+  + GE
Sbjct: 64  -LGSKLGGHVQAVNSVSWSGCGRYLITTSRDWFIKLWDLAKPGE 106

 Score = 33.5 bits (75), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 57/126 (45%), Gaps = 25/126 (19%)

Query: 28  LATGSTDRAIKVLQLKNG----KENL-LDVLDDTVHKKAVRSVAWR------PHSDLLAA 76
           LAT S DR I+   +K G     ENL +++  +  ++  +  + W         ++ L A
Sbjct: 232 LATSSADRTIRQFSMKIGYSEDNENLSIELEQECKYQDVINKLQWNCIFFSNNSAEYLVA 291

Query: 77  GSFDST---ISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWS-QDGCLLATCSRD 132
            +  S+   + IW       E GA     L+ ++EG E E+  ISW+  + C+       
Sbjct: 292 SAHGSSAHELYIW-------ETGAG---TLVRVLEGAEEELMNISWNFNNMCIACNGFET 341

Query: 133 KSVWIW 138
            S++IW
Sbjct: 342 GSIYIW 347

>Kwal_56.22345
          Length = 396

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 103/221 (46%), Gaps = 26/221 (11%)

Query: 74  LAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQ-DGCLLATCSRD 132
           L + S D +I+IW     D++ G  +   + ++   H + V    W + D  +  + S D
Sbjct: 175 LISCSDDGSIAIW-----DIKSGKTVPTSVNSL---HSDIVNECKWHESDPNIYGSVSED 226

Query: 133 KSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKH--NLLASSSYDDTVRIWKDYDDD 190
             + I    +   E     +LQ   ++  + +  +KH  NL A++  D  V ++ D    
Sbjct: 227 SFLMI---HDKRSEKPLQKLLQ---KEPFNTIAFSKHSSNLFAAAGTDAMVYLF-DSRKP 279

Query: 191 WECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKY--IGDD--EDDQQEWVCE 246
            E    ++GH+  +   +F+  +D I LCSG  D  V +W    IG +  E+D  +   E
Sbjct: 280 TEALHSMSGHQEAVTSLEFAHHKDGI-LCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPE 338

Query: 247 STLPNA-HRSQIYGVAWSPSGR--IASVGADGVLAVYKEKQ 284
             + +A H+S I   ++SP+    +ASV  + ++ ++K  +
Sbjct: 339 LLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPSR 379

>Kwal_0.356
          Length = 526

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 54/118 (45%), Gaps = 5/118 (4%)

Query: 69  PHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLAT 128
           P S +    S  +T SI    D+ L     L+  +  +IE H+ E+  +  S+DG LLAT
Sbjct: 215 PISSVPNRNSPKNTNSIMKNGDVILFNLQTLQPTM--VIEAHKGEIAALVLSRDGALLAT 272

Query: 129 CSRDKS-VWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWK 185
            S   + V ++  +   + Y+       +   +  + +   +  LA++S   TV I+K
Sbjct: 273 ASEKGTIVRVFSVETGAKIYQFRR--GTYPTKIYSMCFSDDNQFLAATSSSKTVHIFK 328

>Sklu_675.1 YMR146C, Contig c675 761-1687
          Length = 308

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 59/131 (45%), Gaps = 22/131 (16%)

Query: 152 VLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSK 211
           +L+ H + +  V ++ + +L+ S + D    +W  Y  + E      GH GTIW  D  +
Sbjct: 5   MLKGHERSLTQVKYNREGDLIFSCAKDSVASVW--YAINGERLGTFEGHMGTIWSIDVDQ 62

Query: 212 EEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAH----RSQIYGVAWSPSGR 267
             +     +GS D +V++WK            VC+ +  N +    ++ +  V +SP+G 
Sbjct: 63  FTE--YAVTGSADFSVKLWK------------VCDGS--NVYTWKTKTPVRRVEFSPAGD 106

Query: 268 IASVGADGVLA 278
                 DGV+ 
Sbjct: 107 KILAVLDGVMG 117

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 40/190 (21%), Positives = 77/190 (40%), Gaps = 29/190 (15%)

Query: 8   SLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVH----KKAVR 63
           + + H   +WSID +       TGS D ++K+ ++ +G           V+    K  VR
Sbjct: 47  TFEGHMGTIWSIDVDQFTEYAVTGSADFSVKLWKVCDGS---------NVYTWKTKTPVR 97

Query: 64  SVAWRPHSDLLAA-----GSFDSTISIW-TQSDLDLEEGAKLEMELLAIIEGHENEVKGI 117
            V + P  D + A       +  +++++    + +  E   +  E +  I  H++   GI
Sbjct: 98  RVEFSPAGDKILAVLDGVMGYAGSVTVYDVVRNTETNEIVNINEEPVFEILTHDD--FGI 155

Query: 118 ----SWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLA 173
               SW  +G  +    +D  V  ++    GE  E +  L+ H Q V  + +        
Sbjct: 156 ASVASWGFEGKYIVAGHKDGKVSKYD----GENGEYLDSLELHEQSVSDIQFSPDRTYFI 211

Query: 174 SSSYDDTVRI 183
           +SS D   ++
Sbjct: 212 TSSRDSASKL 221

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 48/124 (38%), Gaps = 9/124 (7%)

Query: 8   SLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAW 67
           SL+LH   V  I F P R    T S D A K++ + +      DVL        + S   
Sbjct: 190 SLELHEQSVSDIQFSPDRTYFITSSRDSASKLVDVTS-----FDVLKTYEADCPLNSACI 244

Query: 68  RPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMEL----LAIIEGHENEVKGISWSQDG 123
            P  + +  G       + T S  + +  A+   ++    +  ++GH   +  ++ S  G
Sbjct: 245 TPLKEFVILGGGQDAKDVTTTSSREGKFEARFYHKIFQDEIGRVKGHFGPLNYVAVSPQG 304

Query: 124 CLLA 127
              A
Sbjct: 305 TSYA 308

 Score = 28.5 bits (62), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 36/90 (40%), Gaps = 10/90 (11%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGI 117
           H++++  V +    DL+ + + DS  S+W            +  E L   EGH   +  I
Sbjct: 9   HERSLTQVKYNREGDLIFSCAKDSVASVW----------YAINGERLGTFEGHMGTIWSI 58

Query: 118 SWSQDGCLLATCSRDKSVWIWETDEAGEEY 147
              Q      T S D SV +W+  +    Y
Sbjct: 59  DVDQFTEYAVTGSADFSVKLWKVCDGSNVY 88

>AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C
           (CAF4) - SH] complement(52978..55125) [2148 bp, 715 aa]
          Length = 715

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 60/252 (23%), Positives = 95/252 (37%), Gaps = 50/252 (19%)

Query: 4   QLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVR 63
           Q   S K H  KV   +F  +R    T        + Q      N+L    D+ H+  V 
Sbjct: 366 QTGYSHKNHEKKVQQHEFRHLRKTYPT--------LQQYYEPGANILSF--DSAHEDNVT 415

Query: 64  SVAWR-PHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQD 122
            + +  P   L +AG  D TI +W  S          + + +A I GH   V  +   Q 
Sbjct: 416 CLDFNLPFGTLCSAGKLDPTIKVWNLS----------KNKHVASITGHLATVSCMQMDQY 465

Query: 123 GCLLATCSRDKSVWIWETDEA------GEEYECISVLQEHSQDVKHVVWHTKHNLLASSS 176
             L+ T  RD  + +W+  +A        +  CI     H  ++  + +    N L S S
Sbjct: 466 NTLI-TGGRDALLKMWDIQKAIDNDSIPSDEVCIYTFDSHIDEITALSFEA--NNLVSGS 522

Query: 177 YDDTVRIWKDYDDDWECAAVLTGHEGT-------IWCSDF--SKEEDPI---------RL 218
            D T+R W    ++ +C   L  +  T       +  S F  +  + PI          L
Sbjct: 523 QDRTIRQWD--LNNGKCVQTLDINFATGGNLSRSMIGSGFLNTNNDHPIIGAIQCYDAAL 580

Query: 219 CSGSDDSTVRVW 230
            +G+ D  VR+W
Sbjct: 581 ATGTKDGIVRLW 592

 Score = 37.7 bits (86), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 56/252 (22%), Positives = 96/252 (38%), Gaps = 62/252 (24%)

Query: 12  HNDKVWSIDFE-PVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPH 70
           H D V  +DF  P   L + G  D  IKV  L   K     V   T H   V  +    +
Sbjct: 410 HEDNVTCLDFNLPFGTLCSAGKLDPTIKVWNLSKNKH----VASITGHLATVSCMQMDQY 465

Query: 71  SDLLAAGSFDSTISIW-TQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATC 129
           + L+  G  D+ + +W  Q  +D +     E+  +   + H +E+  +S+  +   L + 
Sbjct: 466 NTLITGGR-DALLKMWDIQKAIDNDSIPSDEV-CIYTFDSHIDEITALSFEANN--LVSG 521

Query: 130 SRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNL------------------ 171
           S+D+++  W+ +      +C+  L         + + T  NL                  
Sbjct: 522 SQDRTIRQWDLNNG----KCVQTLD--------INFATGGNLSRSMIGSGFLNTNNDHPI 569

Query: 172 ----------LASSSYDDTVRIWKDYDDDWECAAV---LTGHEGTIWCSDFSKEEDPIRL 218
                     LA+ + D  VR+W     D     V   L GH   +    F    D + L
Sbjct: 570 IGAIQCYDAALATGTKDGIVRLW-----DLRSGRVVRTLEGHSDAVTSLQF----DSLNL 620

Query: 219 CSGSDDSTVRVW 230
            +GS D+++R+W
Sbjct: 621 VTGSLDNSIRIW 632

 Score = 35.4 bits (80), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 62/144 (43%), Gaps = 30/144 (20%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGK-ENLLDVLDDT---VHKKAVRSVAW 67
           H D++ ++ FE     L +GS DR I+   L NGK    LD+   T   + +  + S   
Sbjct: 504 HIDEITALSFEANN--LVSGSQDRTIRQWDLNNGKCVQTLDINFATGGNLSRSMIGSGFL 561

Query: 68  RPHSD------------LLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVK 115
             ++D             LA G+ D  + +W     DL  G      ++  +EGH + V 
Sbjct: 562 NTNNDHPIIGAIQCYDAALATGTKDGIVRLW-----DLRSG-----RVVRTLEGHSDAVT 611

Query: 116 GISWSQDGCLLATCSRDKSVWIWE 139
            + +  D   L T S D S+ IW+
Sbjct: 612 SLQF--DSLNLVTGSLDNSIRIWD 633

>YAR003W (SWD1) [68] chr1 (155009..156289) Component of SET1 and
           COMPASS complex, contains a WD (WD-40) repeat [1281 bp,
           426 aa]
          Length = 426

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 48/104 (46%), Gaps = 9/104 (8%)

Query: 42  LKNGKENLLDVLDDTVHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEM 101
           LK   E L   +++ +  + ++   + P  D LA G  +  + I+   D+D      +  
Sbjct: 12  LKEHPEKLTHTIENPLRTECLQ---FSPCGDYLALGCANGALVIY---DMDTFRPICVPG 65

Query: 102 ELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGE 145
            +L     H   +  I+WS DG LL T SRD S+ +W+  +  +
Sbjct: 66  NMLG---AHVRPITSIAWSPDGRLLLTSSRDWSIKLWDLSKPSK 106

 Score = 32.0 bits (71), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 47/224 (20%), Positives = 84/224 (37%), Gaps = 44/224 (19%)

Query: 19  IDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHSDLLAAGS 78
           + F P    LA G  + A+ +  +   +   +       H + + S+AW P   LL   S
Sbjct: 32  LQFSPCGDYLALGCANGALVIYDMDTFRPICVPGNMLGAHVRPITSIAWSPDGRLLLTSS 91

Query: 79  FDSTISIW--TQSDLDLEE-------------GAKLEMELLAIIEGHENEV--------- 114
            D +I +W  ++    L+E              AK  + +  I E  +  V         
Sbjct: 92  RDWSIKLWDLSKPSKPLKEIRFDSPIWGCQWLDAKRRLCVATIFEESDAYVIDFSNDPVA 151

Query: 115 --------KGISWSQDGCLLATC---SRDKSVWIWETDEAGEEY---------ECISVLQ 154
                   K +S + D   +  C   ++  ++ I  T +   ++         ECI  L+
Sbjct: 152 SLLSKSDEKQLSSTPDHGYVLVCTVHTKHPNIIIVGTSKGWLDFYKFHSLYQTECIHSLK 211

Query: 155 EHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLT 198
             S ++KH++       LA +  D T+R ++   DD   A  LT
Sbjct: 212 ITSSNIKHLIVSQNGERLAINCSDRTIRQYEISIDDENSAVELT 255

>Scas_711.11
          Length = 695

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 59/254 (23%), Positives = 105/254 (41%), Gaps = 51/254 (20%)

Query: 10  KLHNDKVWSIDFE-PVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWR 68
           K H+D +  +DF+ P   L   G  D  IK+  L   K+    +   T H   V  +   
Sbjct: 369 KAHDDNITCLDFDLPFGTLCTAGHLDHVIKIWDLSRSKQ----IGRMTGHVATVNCMQIT 424

Query: 69  PHSDLLAAGSFDSTISIWT-----QSDLDLEEGAKLEMELLA-------IIEGHENEVKG 116
             +++L +G  D+ + +W      QS  ++       +E ++         + H +E+  
Sbjct: 425 --NNMLVSGGKDALLKLWNLNVGVQSFRNVLPTNNSNLEPISSSASCIHTFDSHVDEITS 482

Query: 117 ISWSQDGCLLATCSRDKSVWIWETDEAGEEYECI--SVLQEHSQDVK----HVVWHTKHN 170
           ++ +  G  L + S+D+++  W+   +G+  + I  S +   S  ++      +  TK  
Sbjct: 483 VTVA--GENLISGSQDRTIRQWDI-PSGKCLQTIDLSFVAIASPPIQVTDSPFLTTTKAT 539

Query: 171 L-----------LASSSYDDTVRIWKDYDDDWECAAV---LTGHEGTIWCSDFSKEEDPI 216
                       LA+ + D  VR+W     D     V   L GH G+I C  F    D  
Sbjct: 540 AIIGALQCFDAALATGTRDGIVRLW-----DLRAGKVVRALEGHSGSITCLKF----DNK 590

Query: 217 RLCSGSDDSTVRVW 230
            + +GS D TVR+W
Sbjct: 591 NIVTGSIDKTVRIW 604

>AAL119W [68] [Homologous to ScYFR021W (AUT10) - SH]
           complement(137922..139535) [1614 bp, 537 aa]
          Length = 537

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 43/89 (48%), Gaps = 9/89 (10%)

Query: 101 MELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQ----EH 156
           ++   +IE H+ E+  ++ S+DG LLAT S   ++    + E      C  V Q     +
Sbjct: 249 LQPTMVIEAHKGEIAALALSKDGTLLATASEKGTIIRVFSVET-----CTKVYQFRRGTY 303

Query: 157 SQDVKHVVWHTKHNLLASSSYDDTVRIWK 185
              +  + +   +  LA+SS + TV I+K
Sbjct: 304 PTRIYSLNFSDDNEFLAASSSNKTVHIFK 332

>CAGL0K03861g complement(359448..360989) highly similar to sp|Q04225
           Saccharomyces cerevisiae YMR131c Ribosome assembly
           protein, start by similarity
          Length = 513

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 73/151 (48%), Gaps = 23/151 (15%)

Query: 6   AKSLKLHNDKVWSIDF-EPVRGLLATGSTDRAIKVLQLK----NGKENLLDVLDDTVHKK 60
           A S+K  N  V  I + E +  LLA+G  + +  V  L+    +   N+  V     HK 
Sbjct: 361 AISVKASNTDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFTPDNAANIQPVAQYNFHKG 420

Query: 61  AVRSVAWRP-HSDLLAAGSFDSTISIW-----------TQSDLDLEEGAKLEMELLAIIE 108
           A+ S+A+ P    ++A GS D+T+++W            Q   + +E  ++  +LL +  
Sbjct: 421 AITSIAFNPLEESIVAVGSEDNTVTLWDLSVEADDEEIKQQTEETKELKEIPPQLLFV-- 478

Query: 109 GH-ENEVKGISWSQD--GCLLATCSRDKSVW 136
            H + E+K + W +   GCL++T +   ++W
Sbjct: 479 -HWQKEIKDVKWHKQIPGCLVSTGTDGLNIW 508

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 67/144 (46%), Gaps = 13/144 (9%)

Query: 109 GHENEVKGISWSQ-DGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHT 167
           G+   ++ I WS+ +  + AT   D  + +W+T  + +    ISV +  + DV  + W+ 
Sbjct: 321 GNNKSIEDIQWSKTESTVFATAGCDGYIRVWDT-RSKKHKPAISV-KASNTDVNVISWNE 378

Query: 168 KHNLLASSSYD-------DTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCS 220
           K   L +S  D       D  +   D   + +  A    H+G I    F+  E+ I +  
Sbjct: 379 KIGYLLASGDDNGSWGVWDLRQFTPDNAANIQPVAQYNFHKGAITSIAFNPLEESI-VAV 437

Query: 221 GSDDSTVRVWKYI--GDDEDDQQE 242
           GS+D+TV +W      DDE+ +Q+
Sbjct: 438 GSEDNTVTLWDLSVEADDEEIKQQ 461

>YDR142C (PEX7) [987] chr4 complement(740467..741594) Peroxisomal
           biogenesis protein (peroxin) that serves as import
           receptor for proteins containing peroxisomal targeting
           signal 2 (PTS2), member of WD (WD-40) repeat family
           [1128 bp, 375 aa]
          Length = 375

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 47/102 (46%), Gaps = 16/102 (15%)

Query: 149 CIS-VLQEHSQDVKHVVWHTKH-NLLASSSYDDTVRIWKDYDDD-----WECAAV----- 196
           CI+ +   H   ++ V W   H N+L S+SYD T RIW+D  +D     ++  +      
Sbjct: 274 CINEIPNAHGLAIRKVTWSPHHSNILMSASYDMTCRIWRDLSNDGAKETYKTNSTDATKG 333

Query: 197 ----LTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIG 234
                T H   ++ +D+S    P  + S + D  + VW  +G
Sbjct: 334 SIFNFTQHSEFVFGADWSLWGKPGYVASTAWDGNLFVWNGLG 375

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 46/99 (46%), Gaps = 21/99 (21%)

Query: 18  SIDFEPVRG-LLATGSTDRAIKVLQLKNGKENLLDVLDDTV----------------HKK 60
           + DF   R  ++ATG  D AI++  ++   +N    +  TV                H  
Sbjct: 225 TCDFNKYRPYVVATGGVDNAIRIWDIRMLNKNESATIKRTVPGQLHNSSCINEIPNAHGL 284

Query: 61  AVRSVAWRPH-SDLLAAGSFDSTISIWTQSDLDLEEGAK 98
           A+R V W PH S++L + S+D T  IW   DL   +GAK
Sbjct: 285 AIRKVTWSPHHSNILMSASYDMTCRIW--RDLS-NDGAK 320

 Score = 34.7 bits (78), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 25/113 (22%), Positives = 49/113 (43%), Gaps = 14/113 (12%)

Query: 208 DFSKEEDPIRLCSGSDDSTVRVW--KYIGDDEDDQQEWV---------CESTLPNAHRSQ 256
           DF+K   P  + +G  D+ +R+W  + +  +E    +           C + +PNAH   
Sbjct: 227 DFNKYR-PYVVATGGVDNAIRIWDIRMLNKNESATIKRTVPGQLHNSSCINEIPNAHGLA 285

Query: 257 IYGVAWSP--SGRIASVGADGVLAVYKEKQNDSEVSEWEISATYKAAHTVYEI 307
           I  V WSP  S  + S   D    ++++  ND     ++ ++T     +++  
Sbjct: 286 IRKVTWSPHHSNILMSASYDMTCRIWRDLSNDGAKETYKTNSTDATKGSIFNF 338

>Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement
          Length = 509

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 47/230 (20%), Positives = 97/230 (42%), Gaps = 20/230 (8%)

Query: 1   MPLQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKK 60
             L +A       ++V  + + P    L TG  +  +++   +   +N+ +      H+ 
Sbjct: 195 FALSIASENSKTTNEVTCLSWSPSGESLITGVENGELRMWSFRGILQNVFNF-----HRS 249

Query: 61  AVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWS 120
            V S+ W   S  +     D+   +W     +   G  L+   L    G+E+    + W 
Sbjct: 250 PVVSIEWNADSTHVLTSDVDNITIVW-----NALTGTALQHFDLKDTTGNESLGIDVEWI 304

Query: 121 QDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDT 180
           +    +       S+ ++   E+    + I  L  H++ +  + +++ + LL S+S D T
Sbjct: 305 ETDKFVIP-GLQGSILVFSIGES----KPIGKLVGHTKTLTVLCYNSDNKLLLSASDDKT 359

Query: 181 VRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
           +R W+  + +   +    GH  +I  +D+  ++   RL S S D +VRVW
Sbjct: 360 LRTWRGGNAN--SSNCFYGHTQSITYADWLDDD---RLISTSMDGSVRVW 404

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 61/285 (21%), Positives = 100/285 (35%), Gaps = 62/285 (21%)

Query: 27  LLATGSTDRAIKVLQLK--NGKENLLDVL------------DDTVHKKAVRSVAWRPHSD 72
             A G  D   KV++ +  +GK  +LD +            +++     V  ++W P  +
Sbjct: 161 FFAWGGRDSTAKVVKFECNSGKLAVLDTITLQHPFALSIASENSKTTNEVTCLSWSPSGE 220

Query: 73  LLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRD 132
            L  G  +  + +W+   +           L  +   H + V  I W+ D   + T   D
Sbjct: 221 SLITGVENGELRMWSFRGI-----------LQNVFNFHRSPVVSIEWNADSTHVLTSDVD 269

Query: 133 KSVWIWET------------DEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDT 180
               +W              D  G E   I V  E  +  K V+   + ++L  S   ++
Sbjct: 270 NITIVWNALTGTALQHFDLKDTTGNESLGIDV--EWIETDKFVIPGLQGSILVFS-IGES 326

Query: 181 VRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQ 240
             I K           L GH  T+  +      D   L S SDD T+R W+  G + +  
Sbjct: 327 KPIGK-----------LVGHTKTL--TVLCYNSDNKLLLSASDDKTLRTWR--GGNANSS 371

Query: 241 QEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYKEKQN 285
             +         H   I    W    R+ S   DG + V+  KQN
Sbjct: 372 NCFY-------GHTQSITYADWLDDDRLISTSMDGSVRVWSVKQN 409

>Scas_512.3
          Length = 534

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 40/71 (56%), Gaps = 4/71 (5%)

Query: 16  VWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHSDLLA 75
           ++ +D+ P    + +GS D +I+V  +++GK  LL    D  H   V+ V W P ++ + 
Sbjct: 149 IYDLDWSPCDRYVVSGSMDNSIRVFDIESGK--LLGTYAD--HNHYVQGVTWDPLNEFIL 204

Query: 76  AGSFDSTISIW 86
           + S D +++I+
Sbjct: 205 SQSADRSVNIY 215

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 82/191 (42%), Gaps = 40/191 (20%)

Query: 148 ECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYD---DDWECAAVLTGHEGTI 204
           + +S L +H Q +  V +++   +LAS+  D  + +WK  D    + E AA +       
Sbjct: 58  DFLSSLTQHEQAINVVKFNSPGTILASAGDDGQILLWKQQDVNEQNGETAAPVDSSVPKP 117

Query: 205 WCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTL--PNAHRSQIYGVAW 262
           + S F   ED                    D+E++++ W     L  P ++ S+IY + W
Sbjct: 118 FGSTF---ED--------------------DEENNKESWFVWKRLRAPGSNSSEIYDLDW 154

Query: 263 SPSGR-IASVGADGVLAVYKEKQNDSEVSEWEISATYKAAHTVYEINTVKWVNIDGKEML 321
           SP  R + S   D  + V+       ++   ++  TY A H  Y +  V W  ++  E +
Sbjct: 155 SPCDRYVVSGSMDNSIRVF-------DIESGKLLGTY-ADHNHY-VQGVTWDPLN--EFI 203

Query: 322 ITAGDDGRVNL 332
           ++   D  VN+
Sbjct: 204 LSQSADRSVNI 214

 Score = 35.8 bits (81), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 44/205 (21%), Positives = 85/205 (41%), Gaps = 39/205 (19%)

Query: 16  VWSIDFEPV---RGLLATGSTDRAIKVLQLKNGKE-NLLDVLDD----TVHKKAVRSVAW 67
           V+S+ F+P    +  L T   D  I+   L   K+ N +D +D     T H++A+  V +
Sbjct: 16  VYSLCFQPNSPNKKKLLTAGGDNKIRSWNLNLVKDTNKIDTIDFLSSLTQHEQAINVVKF 75

Query: 68  RPHSDLLAAGSFDSTISIWTQSDLDLEEG-------AKLEMELLAIIEGHE--------- 111
                +LA+   D  I +W Q D++ + G       + +     +  E  E         
Sbjct: 76  NSPGTILASAGDDGQILLWKQQDVNEQNGETAAPVDSSVPKPFGSTFEDDEENNKESWFV 135

Query: 112 -----------NEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDV 160
                      +E+  + WS     + + S D S+ +++  E+G   + +    +H+  V
Sbjct: 136 WKRLRAPGSNSSEIYDLDWSPCDRYVVSGSMDNSIRVFDI-ESG---KLLGTYADHNHYV 191

Query: 161 KHVVWHTKHNLLASSSYDDTVRIWK 185
           + V W   +  + S S D +V I++
Sbjct: 192 QGVTWDPLNEFILSQSADRSVNIYQ 216

>Kwal_27.12667
          Length = 721

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 86/205 (41%), Gaps = 42/205 (20%)

Query: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAV--------- 62
           H D++ ++ FE     L +GS DR I+   L  GK   L  +D     +           
Sbjct: 501 HVDEITALHFE--GNSLVSGSQDRTIRQWDLTTGK--CLQTIDINFANRGTSGGFSKISS 556

Query: 63  ---RSVAWRPHSDLLAAGS---FDSTISIWTQSDL----DLEEGAKLEMELLAIIEGHEN 112
              RS     H+D    G+   +D+ ++  T+  L    DL  G     +++  +EGH +
Sbjct: 557 NNPRSSILLTHNDPPVIGALQCYDAAMATGTKDGLVRLWDLRSG-----QVIRTLEGHTD 611

Query: 113 EVKGISWSQDGCLLATCSRDKSVWIWE--TDEAGEEYECISVLQEHSQDVKHVVWHTKHN 170
            V G+ +  D   L T S D+S+ IW+  T    + +   S +     D++H++      
Sbjct: 612 AVTGLQF--DSVNLVTGSLDRSIRIWDLRTGLLADAFAYNSPISSLQFDLEHILV----- 664

Query: 171 LLASSSYDDTVRIW-KDYDDDWECA 194
               S+ +  V+++ +  D  W C 
Sbjct: 665 ----SNNESVVQVYNRKEDQHWTCG 685

 Score = 37.4 bits (85), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 49/126 (38%), Gaps = 23/126 (18%)

Query: 69  PHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLAT 128
           P   +  AG  D ++ IW  S          +   +  + GH   V  +   +D   L T
Sbjct: 415 PFGTMCTAGKLDHSVKIWNLS----------KKTQIGALPGHLASVSCMQM-EDSHSLIT 463

Query: 129 CSRDKSVWIWETDEA----------GEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYD 178
             RD  + +W+ ++A          GEE  C+     H  ++     H + N L S S D
Sbjct: 464 GGRDALLKLWDIEKAEELYNDGATEGEEELCVHTFDAHVDEI--TALHFEGNSLVSGSQD 521

Query: 179 DTVRIW 184
            T+R W
Sbjct: 522 RTIRQW 527

 Score = 32.7 bits (73), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 55/263 (20%), Positives = 103/263 (39%), Gaps = 58/263 (22%)

Query: 4   QLAKSLKLHNDKVWSIDFE-PVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAV 62
           Q++   K H+D +  +DF+ P   +   G  D ++K+  L   K+  +  L    H  +V
Sbjct: 395 QISSFPKAHDDSITCLDFDLPFGTMCTAGKLDHSVKIWNLS--KKTQIGALPG--HLASV 450

Query: 63  RSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKL--------EMEL-LAIIEGHENE 113
             +       L+  G  D+ + +W     D+E+  +L        E EL +   + H +E
Sbjct: 451 SCMQMEDSHSLITGGR-DALLKLW-----DIEKAEELYNDGATEGEEELCVHTFDAHVDE 504

Query: 114 VKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECI----------------------- 150
           +  + +  +G  L + S+D+++  W+    G+  + I                       
Sbjct: 505 ITALHF--EGNSLVSGSQDRTIRQWDL-TTGKCLQTIDINFANRGTSGGFSKISSNNPRS 561

Query: 151 SVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAV---LTGHEGTIWCS 207
           S+L  H+              +A+ + D  VR+W     D     V   L GH   +   
Sbjct: 562 SILLTHNDPPVIGALQCYDAAMATGTKDGLVRLW-----DLRSGQVIRTLEGHTDAVTGL 616

Query: 208 DFSKEEDPIRLCSGSDDSTVRVW 230
            F    D + L +GS D ++R+W
Sbjct: 617 QF----DSVNLVTGSLDRSIRIW 635

>Scas_700.27*
          Length = 433

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 35/163 (21%), Positives = 75/163 (46%), Gaps = 23/163 (14%)

Query: 72  DLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSR 131
           +L+A    DS + +W           +  + ++ +I GH+N +  +        + +CS 
Sbjct: 219 NLIATAGRDSVVRLW---------DIRARVAVMTLI-GHKNPINKVHCLPVDPQIVSCST 268

Query: 132 DKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDW 191
           D ++ +W+   AG+    + V+  H + V+++ +H     ++S S +D +R WK  +   
Sbjct: 269 DATIRLWDI-VAGKS---MKVITHHKKSVRNIAFHPTEFSMSSCSAND-IRSWKLPE--- 320

Query: 192 ECAAVLTGH--EGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKY 232
               +LT    +G    +  S  +D + L +GSD+  +  + Y
Sbjct: 321 --GGLLTNFNSDGLGIINTLSINQDDV-LFAGSDNGMLSFYDY 360

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 47/224 (20%), Positives = 92/224 (41%), Gaps = 43/224 (19%)

Query: 21  FEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHSDLLAAGSFD 80
           F  +  L+AT   D  +++  ++      + V+    HK  +  V   P    + + S D
Sbjct: 214 FILLLNLIATAGRDSVVRLWDIRAR----VAVMTLIGHKNPINKVHCLPVDPQIVSCSTD 269

Query: 81  STISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWET 140
           +TI +W     D+  G  ++     +I  H+  V+ I++      +++CS +  +  W+ 
Sbjct: 270 ATIRLW-----DIVAGKSMK-----VITHHKKSVRNIAFHPTEFSMSSCSAN-DIRSWKL 318

Query: 141 DEAG-------EEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWEC 193
            E G       +    I+ L  +  DV          L A S  D+ +  + DY    + 
Sbjct: 319 PEGGLLTNFNSDGLGIINTLSINQDDV----------LFAGS--DNGMLSFYDYKSGHKY 366

Query: 194 AAVLTGH-------EGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
            +++T         E  I CS F +    +RL +G  D ++++W
Sbjct: 367 QSMMTKEIPGSLESERGILCSTFDRTG--LRLLTGETDKSIKIW 408

>YBR195C (MSI1) [378] chr2 complement(610571..611839) Chromatin
           assembly complex, subunit 3, involved in both nucleosome
           assembly linked with DNA replication and negative
           regulation of the RAS pathway, has WD (WD-40) repeats
           [1269 bp, 422 aa]
          Length = 422

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 84/181 (46%), Gaps = 22/181 (12%)

Query: 61  AVRSVAWRP-HSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISW 119
           AV  V W P H  L AA +  + +S+     LDL    +   +L +  E H+  V    +
Sbjct: 253 AVNDVTWMPTHDSLFAACTEGNAVSL-----LDLRTKKE---KLQSNREKHDGGVNSCRF 304

Query: 120 S-QDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHN-LLASSSY 177
           + ++  +LA+   +  + +W+     +    I+ + EH   V  + W    + +LA++  
Sbjct: 305 NYKNSLILASADSNGRLNLWDIRNMNKS--PIATM-EHGTSVSTLEWSPNFDTVLATAGQ 361

Query: 178 DD-TVRIWKDYDDDWECAAVLTGHEG-TIWCSDFS-KEEDPIRLCSGSDDSTVRVWKYIG 234
           +D  V++W     D  C   +  H G  +  +D S    DP  +CS ++D++V +WK  G
Sbjct: 362 EDGLVKLW-----DTSCEETIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHIWKPAG 416

Query: 235 D 235
           +
Sbjct: 417 N 417

>Scas_712.34
          Length = 399

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 56/128 (43%), Gaps = 16/128 (12%)

Query: 70  HSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATC 129
           H+ L+A G  + TI +   S L        E   +  IE + N V+ + +S  G LLA  
Sbjct: 196 HNGLIATGFANGTIVVSQLSTL--RPLYNFEGFGIQGIEQNSNTVRAVKFSPAGSLLAVA 253

Query: 130 SRDKS---VWIWETDEAGEEYECISVLQEHSQD----------VKHVVWHTKHNLLASSS 176
           +   S   V ++ET + GE    ++V     Q           V  + +++    LA+S 
Sbjct: 254 NDSGSFGCVALYET-QFGERIGNLTVPTHSGQSSVESFAHSGWVFALSFNSTGEFLATSG 312

Query: 177 YDDTVRIW 184
           YD  VR+W
Sbjct: 313 YDSKVRVW 320

>YMR146C (TIF34) [4102] chr13 complement(557480..558523) Translation
           initiation factor eIF3, p39 subunit, contains two WD
           (WD-40) repeats [1044 bp, 347 aa]
          Length = 347

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 63/145 (43%), Gaps = 26/145 (17%)

Query: 153 LQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSD---F 209
           L  H + +  V ++ + +LL S S D +  +W  Y  + E    L GH GTIW  D   F
Sbjct: 6   LTGHERPLTQVKYNKEGDLLFSCSKDSSASVW--YSLNGERLGTLDGHTGTIWSIDVDCF 63

Query: 210 SKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIA 269
           +K        +GS D ++++W    D  + Q     +S +P      +  V +SP G   
Sbjct: 64  TK-----YCVTGSADYSIKLW----DVSNGQCVATWKSPVP------VKRVEFSPCGNYF 108

Query: 270 SVGADGVLAVYKEKQNDSEVSEWEI 294
               D V+      +N   ++ +EI
Sbjct: 109 LAILDNVM------KNPGSINIYEI 127

 Score = 33.1 bits (74), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 61/291 (20%), Positives = 109/291 (37%), Gaps = 35/291 (12%)

Query: 8   SLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAW 67
           +L  H   +WSID +       TGS D +IK+  + NG+   +      V    V+ V +
Sbjct: 47  TLDGHTGTIWSIDVDCFTKYCVTGSADYSIKLWDVSNGQ--CVATWKSPV---PVKRVEF 101

Query: 68  RPHSDLLAA-----GSFDSTISIW-TQSDLDLEEGAKLEMELLAIIEGHE--NEVKGISW 119
            P  +   A          +I+I+  + D    E  K+  E +  I  HE  +      W
Sbjct: 102 SPCGNYFLAILDNVMKNPGSINIYEIERDSATHELTKVSEEPIHKIITHEGLDAATVAGW 161

Query: 120 SQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYD- 178
           S  G  +    +D  +  +   +    YE +  +  H + +  + +        +SS D 
Sbjct: 162 STKGKYIIAGHKDGKISKY---DVSNNYEYVDSIDLHEKSISDMQFSPDLTYFITSSRDT 218

Query: 179 -------DTVRIWKDYDDDWEC-AAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
                   T+++ K Y+ D     AV+T  +  I      + +D     +       R +
Sbjct: 219 NSFLVDVSTLQVLKKYETDCPLNTAVITPLKEFIILGGGQEAKDVTTTSANEGKFEARFY 278

Query: 231 KYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSG-RIASVGADGVLAVY 280
             I ++E  + +          H   +  VA SP G   AS G DG + ++
Sbjct: 279 HKIFEEEIGRVQ---------GHFGPLNTVAISPQGTSYASGGEDGFIRLH 320

 Score = 32.0 bits (71), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 21/32 (65%)

Query: 107 IEGHENEVKGISWSQDGCLLATCSRDKSVWIW 138
           + GHE  +  + ++++G LL +CS+D S  +W
Sbjct: 6   LTGHERPLTQVKYNKEGDLLFSCSKDSSASVW 37

 Score = 31.6 bits (70), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 38/88 (43%), Gaps = 18/88 (20%)

Query: 56  TVHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVK 115
           T H++ +  V +    DLL + S DS+ S+W            L  E L  ++GH     
Sbjct: 7   TGHERPLTQVKYNKEGDLLFSCSKDSSASVWYS----------LNGERLGTLDGH----T 52

Query: 116 GISWSQD-GCLLATC---SRDKSVWIWE 139
           G  WS D  C    C   S D S+ +W+
Sbjct: 53  GTIWSIDVDCFTKYCVTGSADYSIKLWD 80

>YMR131C (RRB1) [4088] chr13 complement(533162..534697) Protein
           involved in ribosome assembly, member of WD (WD-40)
           repeat family [1536 bp, 511 aa]
          Length = 511

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 49/92 (53%), Gaps = 12/92 (13%)

Query: 57  VHKKAVRSVAWRPHSD-LLAAGSFDSTISIWTQS----DLDLEEGAKLEMELLAIIEGH- 110
            HK A+ S+A+ P  + ++A GS D+T+++W  S    D ++++ A    EL  I     
Sbjct: 415 FHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQAAETKELQEIPPQLL 474

Query: 111 ----ENEVKGISWSQD--GCLLATCSRDKSVW 136
               + EVK + W +   GCL++T +   +VW
Sbjct: 475 FVHWQKEVKDVKWHKQIPGCLVSTGTDGLNVW 506

 Score = 31.6 bits (70), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 63/139 (45%), Gaps = 13/139 (9%)

Query: 114 VKGISWSQ-DGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLL 172
           ++ I WS+ +  + AT   D  + IW+T  + +    ISV +  + DV  + W  K   L
Sbjct: 324 IEDIQWSRTESTVFATAGCDGYIRIWDT-RSKKHKPAISV-KASNTDVNVISWSDKIGYL 381

Query: 173 ASSSYD-------DTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDS 225
            +S  D       D  +      D  +  A    H+G I    F+  ++ I +  GS+D+
Sbjct: 382 LASGDDNGTWGVWDLRQFTPSNADAVQPVAQYDFHKGAITSIAFNPLDESI-VAVGSEDN 440

Query: 226 TVRVWKYI--GDDEDDQQE 242
           TV +W      DDE+ +Q+
Sbjct: 441 TVTLWDLSVEADDEEIKQQ 459

>YOR272W (YTM1) [5058] chr15 (832810..834192) Microtubule-associated
           protein essential for the G1/S transition, member of WD
           (WD-40) repeat family [1383 bp, 460 aa]
          Length = 460

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 57/258 (22%), Positives = 102/258 (39%), Gaps = 45/258 (17%)

Query: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWT----------------------------QS 89
           HK  V S+    +S +L+A S+D++I  W+                            + 
Sbjct: 207 HKAPVVSIDVSDNSRILSA-SYDNSIGFWSTIYKEMTVVDPLEDINNPNNKISTAARKRR 265

Query: 90  DLDLEEGAKLEMELLAIIEGHENEVKGISW-SQDGCLLATCSRDKSVWIWETDEAGEEYE 148
            L +++G       L+++E H   V+ + + S D  +  + S+D ++  W+   A     
Sbjct: 266 KLTMKDGTIRRRAPLSLLESHTAPVEQVIFDSTDNTVGYSVSQDHTIKTWDLVTA----R 321

Query: 149 CISVLQEHSQDVKHVVWHTKHNLLA--SSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWC 206
           CI   +  S  +  +   +  NLLA  SS+   T+   +           L GH+  +  
Sbjct: 322 CIDT-RTTSYSLLSIAQLSTLNLLACGSSARHITLHDPRVGASSKVTQQQLIGHKNFVSS 380

Query: 207 SDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVC---ESTLPNAHRSQIYGVAWS 263
            D   E + I LCSGS D TV+VW    D       +     + ++      +++ V W+
Sbjct: 381 LDTCPENEYI-LCSGSHDGTVKVW----DVRSTSPMYTITREDKSVQKGVNDKVFAVKWA 435

Query: 264 PSGRIASVGADGVLAVYK 281
               I S G D  + + K
Sbjct: 436 EKVGIISAGQDKKIQINK 453

 Score = 34.7 bits (78), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 52/139 (37%), Gaps = 36/139 (25%)

Query: 167 TKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDST 226
           +KH  + S SYD  VR W   D         +GH G I    +       RL S  +D T
Sbjct: 115 SKH--IISGSYDGIVRTW---DLSGNVQKQYSGHSGPIRAVKYISNT---RLVSAGNDRT 166

Query: 227 VRVWKYIGDD-------------------EDDQQEWVCESTLPNAHRSQIYGVAWSPSGR 267
           +R+WK   DD                   ED +   + E      H++ +  +  S + R
Sbjct: 167 LRLWKTKNDDLKLTSQQQAQEDDDDEVNIEDGKTLAILE-----GHKAPVVSIDVSDNSR 221

Query: 268 IASVGADGVLA----VYKE 282
           I S   D  +     +YKE
Sbjct: 222 ILSASYDNSIGFWSTIYKE 240

 Score = 30.4 bits (67), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 38/86 (44%), Gaps = 10/86 (11%)

Query: 205 WCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSP 264
           W S     +    + SGS D  VR W   G   + Q+++       + H   I  V +  
Sbjct: 105 WVSSLDVGDGSKHIISGSYDGIVRTWDLSG---NVQKQY-------SGHSGPIRAVKYIS 154

Query: 265 SGRIASVGADGVLAVYKEKQNDSEVS 290
           + R+ S G D  L ++K K +D +++
Sbjct: 155 NTRLVSAGNDRTLRLWKTKNDDLKLT 180

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 41/99 (41%), Gaps = 25/99 (25%)

Query: 156 HSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECA--------------------- 194
           HS  ++  V +  +  L S+  D T+R+WK  +DD +                       
Sbjct: 143 HSGPIR-AVKYISNTRLVSAGNDRTLRLWKTKNDDLKLTSQQQAQEDDDDEVNIEDGKTL 201

Query: 195 AVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYI 233
           A+L GH+  +   D S   D  R+ S S D+++  W  I
Sbjct: 202 AILEGHKAPVVSIDVS---DNSRILSASYDNSIGFWSTI 237

>Kwal_26.8628
          Length = 422

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 51/234 (21%), Positives = 98/234 (41%), Gaps = 42/234 (17%)

Query: 107 IEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWH 166
           + GH N++   +WS D   + + S+D  + +W+     ++    + +   SQ V     +
Sbjct: 82  LNGHNNKISDFAWSSDSRSILSASQDGFMIVWDASLGFKK----NAIPLDSQWVLTCAIN 137

Query: 167 TKHNLLASSSYDDTVRIWKDYDDD---WECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSD 223
           +  NL+AS+   ++  I++   ++    +  ++  GH   +   +F +    I   + S 
Sbjct: 138 SSGNLVASAGLTNSCTIYRISQENRVQQQIVSMFKGHTCYVSQVEFFENNSII---TASG 194

Query: 224 DSTVRVW-----KYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLA 278
           D T  +W     K I +  D   + V    LP  H       A + S   AS G+DG + 
Sbjct: 195 DMTCALWDIPKAKRIAEFSDHLGD-VLALALPPPH-------AQTSSPIFASGGSDGYVY 246

Query: 279 VYKEKQNDSEVSEWEISATYKAAHTVY----EINTVKWVNIDGKEMLITAGDDG 328
           +            W+  A   AA + +    +I+T+K+ N      ++T  DDG
Sbjct: 247 I------------WDTRAR-AAAQSFFVSESDISTLKFFN--NGYAIVTGADDG 285

 Score = 31.6 bits (70), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 24/43 (55%)

Query: 99  LEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETD 141
           L  E++  +EGH + + G+  S DG  + T S D ++ +W  +
Sbjct: 378 LRAEIVGKLEGHSSRISGVKTSPDGMAVCTGSWDATLKLWSPN 420

>Kwal_47.17827
          Length = 523

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 53/105 (50%), Gaps = 12/105 (11%)

Query: 44  NGKENLLDVLDDTVHKKAVRSVAWRPHSD-LLAAGSFDSTISIWTQS----DLDLEEGAK 98
           N   ++  V   + HK A+ S+A+ P  D ++A  S D+T+++W  S    D ++++ A 
Sbjct: 414 NNAASVSPVAQYSFHKGAITSIAFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQQAA 473

Query: 99  LEMELLAIIEGH-----ENEVKGISWSQD--GCLLATCSRDKSVW 136
              EL  I         + EVK + W +   GCL++T +   ++W
Sbjct: 474 ETKELQQIPPQLLFVHWQKEVKDVKWHKQIPGCLVSTGTDGLNIW 518

>Kwal_27.9840
          Length = 471

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 50/100 (50%), Gaps = 4/100 (4%)

Query: 92  DLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKS-VWIWETDEAGEEYECI 150
           +LEE +  ++   +II+ H++ ++ I  S +G ++ATCS   + V I+ T       E  
Sbjct: 258 ELEEASAAQLPT-SIIKAHKSPLRLIKLSPNGAMIATCSTQGTIVRIFGTQSGSLVAEFR 316

Query: 151 SVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDD 190
             L     D+  + W  + N LA  S   T+ I++  ++D
Sbjct: 317 RGLDR--ADIYEMAWSPRSNRLALVSDKQTLHIFQITNED 354

>CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces
           cerevisiae YOR269w PAC1, hypothetical start
          Length = 467

 Score = 37.4 bits (85), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 48/210 (22%), Positives = 91/210 (43%), Gaps = 50/210 (23%)

Query: 56  TVHKKAVRSVA---------WRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAI 106
           T H KA+ S+          +   + L++  S D+ I+++  S          E++L+  
Sbjct: 163 TAHSKAITSIEVIEAHNFEEFIDSTTLVSTTSKDAQINVYDHS------SNTGELKLIRS 216

Query: 107 IEGHENEVKG-ISWSQDG-CLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVV 164
              H++ V    +W +D   LLA+ SRD +V +W  +++     C+     HS+ VK + 
Sbjct: 217 FNAHDSTVSSQKTWQKDNDVLLASSSRDATVKVWRVNDS----RCLQSFSPHSEWVKSI- 271

Query: 165 WHTKHNLLASSSYDDTVRI--WKDYDDDWECAAVLTGHEGTI------------WCSDFS 210
                  + S S D T+R+  W   +      +V TGHE  I             C+   
Sbjct: 272 -DVLDEYILSGSLDSTLRLTHWPSGNG----LSVGTGHEFPIERVLIIPFSDSKICTSPY 326

Query: 211 KEED------PIRL---CSGSDDSTVRVWK 231
           ++++      P+R     S + D+T+++W+
Sbjct: 327 RDQNEHSAFAPLRFKYCASAARDNTIKIWE 356

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 53/240 (22%), Positives = 85/240 (35%), Gaps = 52/240 (21%)

Query: 27  LLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSV-AWRPHSD-LLAAGSFDSTIS 84
           L++T S D  I V    +    L  +     H   V S   W+  +D LLA+ S D+T+ 
Sbjct: 189 LVSTTSKDAQINVYDHSSNTGELKLIRSFNAHDSTVSSQKTWQKDNDVLLASSSRDATVK 248

Query: 85  IWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDE-- 142
           +W  +D             L     H   VK I    +  L  +      +  W +    
Sbjct: 249 VWRVND----------SRCLQSFSPHSEWVKSIDVLDEYILSGSLDSTLRLTHWPSGNGL 298

Query: 143 ---AGEEYE--------------CISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWK 185
               G E+               C S  ++ ++         K+   AS++ D+T++IW+
Sbjct: 299 SVGTGHEFPIERVLIIPFSDSKICTSPYRDQNEHSAFAPLRFKY--CASAARDNTIKIWE 356

Query: 186 ---------------DYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230
                            +  ++C   L GH  T W  D     D   L S SDD T++ W
Sbjct: 357 VPLPQLKPNSAPVPSTTNTTFKCVMTLRGH--TSWVKDLKLRGD--HLFSCSDDETIKCW 412

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.131    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,324,144
Number of extensions: 553483
Number of successful extensions: 4075
Number of sequences better than 10.0: 422
Number of HSP's gapped: 2646
Number of HSP's successfully gapped: 1094
Length of query: 332
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 230
Effective length of database: 13,065,073
Effective search space: 3004966790
Effective search space used: 3004966790
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 62 (28.5 bits)