Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M08624g33733217760.0
YDR268W (MSW1)37933312001e-166
Kwal_55.2156337232911441e-157
KLLA0E21923g37832911021e-151
Scas_615.1037933010451e-142
Sklu_1979.431426810081e-137
ACR089C38932910131e-137
KLLA0D09328g104658710.77
Kwal_26.765574355682.0
CAGL0I04224g94286653.9
YPR068C (HOS1)47082644.4
YCL014W (BUD3)163678629.1
CAGL0L11880g98075629.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M08624g
         (332 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M08624g complement(859796..860809) highly similar to sp|P04...   688   0.0  
YDR268W (MSW1) [1101] chr4 (1003996..1005135) Tryptophanyl-tRNA ...   466   e-166
Kwal_55.21563                                                         445   e-157
KLLA0E21923g 1947496..1948632 similar to sp|P04803 Saccharomyces...   429   e-151
Scas_615.10                                                           407   e-142
Sklu_1979.4 YDR268W, Contig c1979 7588-8532 reverse complement        392   e-137
ACR089C [1136] [Homologous to ScYDR268W (MSW1) - SH] (518154..51...   394   e-137
KLLA0D09328g complement(788565..791705) some similarities with s...    32   0.77 
Kwal_26.7655                                                           31   2.0  
CAGL0I04224g complement(369858..372686) highly similar to sp|P32...    30   3.9  
YPR068C (HOS1) [5496] chr16 complement(682936..684348) Member of...    29   4.4  
YCL014W (BUD3) [525] chr3 (96280..101190) Protein localized at t...    28   9.1  
CAGL0L11880g 1272624..1275566 some similarities with sp|P39956 S...    28   9.4  

>CAGL0M08624g complement(859796..860809) highly similar to sp|P04803
           Saccharomyces cerevisiae YDR268w MSW1 tryptophanyl-tRNA
           synthetase, mitochondrial, start by similarity
          Length = 337

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/332 (100%), Positives = 332/332 (100%)

Query: 1   MVQPTGKFHLGNYLGATRVWKDLCDIKQPGQRLIFGVADLHAITIPKPDAAQFKQLRREA 60
           MVQPTGKFHLGNYLGATRVWKDLCDIKQPGQRLIFGVADLHAITIPKPDAAQFKQLRREA
Sbjct: 1   MVQPTGKFHLGNYLGATRVWKDLCDIKQPGQRLIFGVADLHAITIPKPDAAQFKQLRREA 60

Query: 61  IASILAVGVDPARASIMYQSAIPAHSQLYWLLSTVAPMGYLNRMTQWKSKSNLREDKDAT 120
           IASILAVGVDPARASIMYQSAIPAHSQLYWLLSTVAPMGYLNRMTQWKSKSNLREDKDAT
Sbjct: 61  IASILAVGVDPARASIMYQSAIPAHSQLYWLLSTVAPMGYLNRMTQWKSKSNLREDKDAT 120

Query: 121 AKELGEVKLGLFGYPVLQAADILLYKATHVPVGDDQVQHLELTRTLAENFNKLYKKQVFP 180
           AKELGEVKLGLFGYPVLQAADILLYKATHVPVGDDQVQHLELTRTLAENFNKLYKKQVFP
Sbjct: 121 AKELGEVKLGLFGYPVLQAADILLYKATHVPVGDDQVQHLELTRTLAENFNKLYKKQVFP 180

Query: 181 LPRTLLAPTKKILSLTHDTKKMSKSDPNQDGVIYVNDPPETIIRKIKKARTDSITDKFYY 240
           LPRTLLAPTKKILSLTHDTKKMSKSDPNQDGVIYVNDPPETIIRKIKKARTDSITDKFYY
Sbjct: 181 LPRTLLAPTKKILSLTHDTKKMSKSDPNQDGVIYVNDPPETIIRKIKKARTDSITDKFYY 240

Query: 241 DPVHRPGLSNLINIVSGITKQPVHAVEQELQKFDNYRDLKAHVSEVIIEELRVPREKFHQ 300
           DPVHRPGLSNLINIVSGITKQPVHAVEQELQKFDNYRDLKAHVSEVIIEELRVPREKFHQ
Sbjct: 241 DPVHRPGLSNLINIVSGITKQPVHAVEQELQKFDNYRDLKAHVSEVIIEELRVPREKFHQ 300

Query: 301 YMEDPQFLDDTVQQGTQRASEIAASTMKETMQ 332
           YMEDPQFLDDTVQQGTQRASEIAASTMKETMQ
Sbjct: 301 YMEDPQFLDDTVQQGTQRASEIAASTMKETMQ 332

>YDR268W (MSW1) [1101] chr4 (1003996..1005135) Tryptophanyl-tRNA
           synthetase, mitochondrial, member of class I family of
           aminoacyl-tRNA synthetases [1140 bp, 379 aa]
          Length = 379

 Score =  466 bits (1200), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 215/333 (64%), Positives = 269/333 (80%), Gaps = 4/333 (1%)

Query: 1   MVQPTGKFHLGNYLGATRVWKDLCDIKQPGQRLIFGVADLHAITIPKPDAAQFKQLRREA 60
           M+QPTG FHLGNYLGATRVW DLC++KQPGQ LIFGVADLHAIT+PKPD   F++ R EA
Sbjct: 40  MIQPTGCFHLGNYLGATRVWTDLCELKQPGQELIFGVADLHAITVPKPDGEMFRKFRHEA 99

Query: 61  IASILAVGVDPARASIMYQSAIPAHSQLYWLLSTVAPMGYLNRMTQWKSKSNLREDKDA- 119
           +ASILAVGVDP +AS++YQSAIP HS+L+WLLST+A MG LNRMTQWKSKSN+++  +  
Sbjct: 100 VASILAVGVDPEKASVIYQSAIPQHSELHWLLSTLASMGLLNRMTQWKSKSNIKQSTNGD 159

Query: 120 ---TAKELGEVKLGLFGYPVLQAADILLYKATHVPVGDDQVQHLELTRTLAENFNKLYKK 176
                 ++G+V+LGLF YPVLQAADILLYK+THVPVGDDQ QHLELTR LAE FNK+YKK
Sbjct: 160 YLVNDSDVGKVRLGLFSYPVLQAADILLYKSTHVPVGDDQSQHLELTRHLAEKFNKMYKK 219

Query: 177 QVFPLPRTLLAPTKKILSLTHDTKKMSKSDPNQDGVIYVNDPPETIIRKIKKARTDSITD 236
             FP P T+LA TKK+LSL+   KKMSKSDPN D VI++ND P+ I +KI+KA TDSI+D
Sbjct: 220 NFFPKPVTMLAQTKKVLSLSTPEKKMSKSDPNHDSVIFLNDEPKAIQKKIRKALTDSISD 279

Query: 237 KFYYDPVHRPGLSNLINIVSGITKQPVHAVEQELQKFDNYRDLKAHVSEVIIEELRVPRE 296
           +FYYDPV RPG+SNLINIVSGI ++ +  V +++ +F+NYRD K +VSEVIIEEL+ PR 
Sbjct: 280 RFYYDPVERPGVSNLINIVSGIQRKSIEDVVEDVSRFNNYRDFKDYVSEVIIEELKGPRT 339

Query: 297 KFHQYMEDPQFLDDTVQQGTQRASEIAASTMKE 329
           +F +Y+ +P +L   V+ G ++A E AA  + +
Sbjct: 340 EFEKYINEPTYLHSVVESGMRKAREKAAKNLAD 372

>Kwal_55.21563
          Length = 372

 Score =  445 bits (1144), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 207/329 (62%), Positives = 263/329 (79%), Gaps = 2/329 (0%)

Query: 1   MVQPTGKFHLGNYLGATRVWKDLCDIKQPGQRLIFGVADLHAITIPKPDAAQFKQLRREA 60
           MVQPTGKFHLGNYLGA RVWKDLCD K P  +L+FGVADLHAITIP PD  + +Q RREA
Sbjct: 39  MVQPTGKFHLGNYLGAVRVWKDLCDQKAPSTQLMFGVADLHAITIPIPDGMKLRQSRREA 98

Query: 61  IASILAVGVDPARASIMYQSAIPAHSQLYWLLSTVAPMGYLNRMTQWKSKSNLREDKDAT 120
           +ASIL+VGVDP++A +  QS +  H++L+WLLST+APMG LNRMTQWKSKSNL+   D  
Sbjct: 99  MASILSVGVDPSKAVLFNQSRVHQHTELHWLLSTLAPMGLLNRMTQWKSKSNLKNMSDEQ 158

Query: 121 AKELGEVKLGLFGYPVLQAADILLYKATHVPVGDDQVQHLELTRTLAENFNKLYKKQVFP 180
           A  LG VKLGLF YPVLQAADILLY++THVPVGDDQ QHLELTRTLA+ FNKLYK+ + P
Sbjct: 159 A--LGTVKLGLFSYPVLQAADILLYRSTHVPVGDDQAQHLELTRTLAQYFNKLYKRPILP 216

Query: 181 LPRTLLAPTKKILSLTHDTKKMSKSDPNQDGVIYVNDPPETIIRKIKKARTDSITDKFYY 240
           LP T+LAPTK+ILSL     KMSKSD NQ+  IY+ND P++I++KI+KA TDS +  FYY
Sbjct: 217 LPTTILAPTKRILSLADIDSKMSKSDQNQNATIYLNDEPDSIVKKIRKAVTDSNSKAFYY 276

Query: 241 DPVHRPGLSNLINIVSGITKQPVHAVEQELQKFDNYRDLKAHVSEVIIEELRVPREKFHQ 300
           DP  RPG+SNLINIVSG+ +Q +  VE+++ +F+++ + K++VSEV++E L+ PRE+F+ 
Sbjct: 277 DPSSRPGVSNLINIVSGLQRQSIQQVEKDISRFNSHSEFKSYVSEVLVETLQGPRERFNL 336

Query: 301 YMEDPQFLDDTVQQGTQRASEIAASTMKE 329
           YM+DP +LD   + G + AS+ A  ++KE
Sbjct: 337 YMKDPDYLDKVFESGAENASKHAEKSIKE 365

>KLLA0E21923g 1947496..1948632 similar to sp|P04803 Saccharomyces
           cerevisiae YDR268w MSW1 tryptophanyl-tRNA synthetase,
           mitochondrial singleton, start by similarity
          Length = 378

 Score =  429 bits (1102), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 195/329 (59%), Positives = 254/329 (77%), Gaps = 2/329 (0%)

Query: 1   MVQPTGKFHLGNYLGATRVWKDLCDIKQPGQRLIFGVADLHAITIPKPDAAQFKQLRREA 60
           ++QPTGKFHLGNYLGA RVWKD+ D+K  G  L+FG ADLHAIT+PKP+A +F+  R EA
Sbjct: 44  LIQPTGKFHLGNYLGAVRVWKDITDLKDDGTTLLFGTADLHAITVPKPNAKEFRNYRIEA 103

Query: 61  IASILAVGVDPARASIMYQSAIPAHSQLYWLLSTVAPMGYLNRMTQWKSKSNLREDKDAT 120
           IASIL++G+DP +A + +QS +  H++L+WLLS++A MG LNRMTQWKSKSN+ +  D  
Sbjct: 104 IASILSIGIDPEKAIVFHQSRVSQHTELHWLLSSLASMGSLNRMTQWKSKSNINDQSDDA 163

Query: 121 AKELGEVKLGLFGYPVLQAADILLYKATHVPVGDDQVQHLELTRTLAENFNKLYKKQVFP 180
           A  LG +KLGLF YPVLQAADILLYK+THVPVGDDQ QHLELTR L+  FNK YK + FP
Sbjct: 164 A--LGAIKLGLFSYPVLQAADILLYKSTHVPVGDDQSQHLELTRQLSNTFNKFYKTKYFP 221

Query: 181 LPRTLLAPTKKILSLTHDTKKMSKSDPNQDGVIYVNDPPETIIRKIKKARTDSITDKFYY 240
           +P T+LAPTKKILSL +  KKMSKSD NQ+ VIY+ D PE I +KIK+A TDSI+D FY+
Sbjct: 222 MPTTILAPTKKILSLLNPEKKMSKSDTNQNSVIYITDEPEIIAKKIKRAVTDSISDSFYF 281

Query: 241 DPVHRPGLSNLINIVSGITKQPVHAVEQELQKFDNYRDLKAHVSEVIIEELRVPREKFHQ 300
           DPV RPG+SNLIN +SG+ +  +  VE+++    +++D K HV++V++EEL   RE+FH+
Sbjct: 282 DPVKRPGISNLINTLSGVQRVSIEDVEKDIAHIKDHKDFKQHVTDVLVEELAPSREQFHR 341

Query: 301 YMEDPQFLDDTVQQGTQRASEIAASTMKE 329
           YM++P +L    + G  +A EIAA  + E
Sbjct: 342 YMKNPDYLHKVSEDGASKAREIAAKNITE 370

>Scas_615.10
          Length = 379

 Score =  407 bits (1045), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 193/330 (58%), Positives = 248/330 (75%), Gaps = 10/330 (3%)

Query: 1   MVQPTGKFHLGNYLGATRVWKDLCDIKQPGQRLIFGVADLHAITIPKPDAAQFKQLRREA 60
           ++QPTGKFHLGNYLGATR+WK +   KQP Q  IFGVADLHAIT+PKPD  +F Q RREA
Sbjct: 52  LIQPTGKFHLGNYLGATRIWKQISQSKQPTQTAIFGVADLHAITVPKPDPMEFLQCRREA 111

Query: 61  IASILAVGVDPARASIMYQSAIPAHSQLYWLLSTVAPMGYLNRMTQWKSKSNLREDKDAT 120
           +ASIL++G+DP  A +MYQS +P H+QL+W+LST   MG LNRMTQWK+K        A 
Sbjct: 112 LASILSLGIDPQNAIMMYQSEVPQHTQLHWVLSTFTSMGVLNRMTQWKAK--------AK 163

Query: 121 AKELGEVKLGLFGYPVLQAADILLYKATHVPVGDDQVQHLELTRTLAENFNKLY-KKQVF 179
           +  +  VKLGLF YPVLQAADILLYKATHVPVGDDQ Q LEL R++A+ FN+ Y  +  F
Sbjct: 164 SNHM-SVKLGLFSYPVLQAADILLYKATHVPVGDDQCQPLELCRSIAQQFNQFYGDENFF 222

Query: 180 PLPRTLLAPTKKILSLTHDTKKMSKSDPNQDGVIYVNDPPETIIRKIKKARTDSITDKFY 239
           P+PRT+LAPTKKILSL    KKMSKSDPN+D  IYVND  + I++KI+KA TDS+T    
Sbjct: 223 PIPRTILAPTKKILSLGDPLKKMSKSDPNKDSNIYVNDAADVIVKKIRKAVTDSVTGPIT 282

Query: 240 YDPVHRPGLSNLINIVSGITKQPVHAVEQELQKFDNYRDLKAHVSEVIIEELRVPREKFH 299
           +DPV+RPG+SNL+N+VSGIT++ + AVEQE+    +  + K +V+E+++EELR PRE++ 
Sbjct: 283 FDPVNRPGVSNLLNMVSGITQREMSAVEQEVSHLSHLGEFKNYVAEIVVEELRGPRERYE 342

Query: 300 QYMEDPQFLDDTVQQGTQRASEIAASTMKE 329
           Q M +P++L     QG +RA  IA   M++
Sbjct: 343 QLMNEPEYLKQVGDQGAERARAIAEVNMRQ 372

>Sklu_1979.4 YDR268W, Contig c1979 7588-8532 reverse complement
          Length = 314

 Score =  392 bits (1008), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 186/268 (69%), Positives = 224/268 (83%), Gaps = 1/268 (0%)

Query: 1   MVQPTGKFHLGNYLGATRVWKDLCDIKQPGQRLIFGVADLHAITIPKPDAAQFKQLRREA 60
           ++QPTGKFHLGNYLGA RVWKDLCD      +L+FGVADLHAITIPKP++++F+Q R EA
Sbjct: 38  LIQPTGKFHLGNYLGAVRVWKDLCDTDLDESKLLFGVADLHAITIPKPNSSEFRQYRTEA 97

Query: 61  IASILAVGVDPARASIMYQSAIPAHSQLYWLLSTVAPMGYLNRMTQWKSKSNLREDKDAT 120
           IASIL++G+DP +A I +QS +  H++L+W+LST+AP+GYLNRMTQWKSKSNLR+D  + 
Sbjct: 98  IASILSIGIDPKKAIIFHQSQVHQHAELHWILSTIAPVGYLNRMTQWKSKSNLRQDA-SD 156

Query: 121 AKELGEVKLGLFGYPVLQAADILLYKATHVPVGDDQVQHLELTRTLAENFNKLYKKQVFP 180
           A+ LG VKLGLF YPVLQAADILLY +THVPVGDDQ QHLELTR LA+ FNKLYKK  FP
Sbjct: 157 AEALGNVKLGLFAYPVLQAADILLYHSTHVPVGDDQSQHLELTRFLAQQFNKLYKKSYFP 216

Query: 181 LPRTLLAPTKKILSLTHDTKKMSKSDPNQDGVIYVNDPPETIIRKIKKARTDSITDKFYY 240
           LP T+LAPTKKILSL    KKMSKSD NQ+ VIY+ND PETI +KIKKA TDSI+ +F Y
Sbjct: 217 LPTTILAPTKKILSLASPGKKMSKSDANQNSVIYLNDDPETISKKIKKAVTDSISHEFKY 276

Query: 241 DPVHRPGLSNLINIVSGITKQPVHAVEQ 268
           DP +RPG+SNLINIVSGI ++ +  VE+
Sbjct: 277 DPENRPGVSNLINIVSGIQRRSIAEVEK 304

>ACR089C [1136] [Homologous to ScYDR268W (MSW1) - SH]
           (518154..519323) [1170 bp, 389 aa]
          Length = 389

 Score =  394 bits (1013), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 184/329 (55%), Positives = 244/329 (74%), Gaps = 3/329 (0%)

Query: 1   MVQPTGKFHLGNYLGATRVWKDLCDIKQPGQRLIFGVADLHAITIPKPDAAQFKQLRREA 60
           ++QPTGKFHLGNYLGA RVW +L +    G + IFG ADLHAITIPKPD   F+Q+R EA
Sbjct: 57  LIQPTGKFHLGNYLGAVRVWTELSEDAPAGGKCIFGTADLHAITIPKPDGNAFRQMRHEA 116

Query: 61  IASILAVGVDPARASIMYQSAIPAHSQLYWLLSTVAPMGYLNRMTQWKSKSNLREDKDAT 120
           IAS+LAVG+DP ++ + +QS +P H++L W LST+  MG LNRMTQWK+K+N+   KD +
Sbjct: 117 IASLLAVGIDPTKSILFHQSQVPEHAELCWYLSTLTSMGALNRMTQWKTKANI---KDTS 173

Query: 121 AKELGEVKLGLFGYPVLQAADILLYKATHVPVGDDQVQHLELTRTLAENFNKLYKKQVFP 180
           ++++G VKLGLF YPVLQAAD+LLYK+TH+PVG+DQVQ LELTR LA+ FN  YK + F 
Sbjct: 174 SEKVGAVKLGLFTYPVLQAADVLLYKSTHIPVGEDQVQQLELTRQLAQAFNSTYKTRYFR 233

Query: 181 LPRTLLAPTKKILSLTHDTKKMSKSDPNQDGVIYVNDPPETIIRKIKKARTDSITDKFYY 240
            P TLL PT+K+LSL +  KKMSKSD NQ+  I V D P+ I RKI+ A TDSI  +F Y
Sbjct: 234 EPTTLLTPTRKVLSLQNPLKKMSKSDANQNSCICVTDEPDAIRRKIRSAVTDSIGHEFKY 293

Query: 241 DPVHRPGLSNLINIVSGITKQPVHAVEQELQKFDNYRDLKAHVSEVIIEELRVPREKFHQ 300
           DP  RPG+SNLINIV+GI K+ + AVE ++  F ++   K +V+++++ ELR PRE+F +
Sbjct: 294 DPEGRPGVSNLINIVAGIQKKTIAAVEADIAGFKDHATFKNYVTDILVAELRGPREEFAR 353

Query: 301 YMEDPQFLDDTVQQGTQRASEIAASTMKE 329
           YM D  ++ +  + G +RA  IAA T+ E
Sbjct: 354 YMNDKSYIYEVERNGAERAGAIAAKTLAE 382

>KLLA0D09328g complement(788565..791705) some similarities with
           sp|P38990 Saccharomyces cerevisiae YER129w PAK1 DNA
           polymerase alpha suppressing protein kinase,
           hypothetical start
          Length = 1046

 Score = 32.0 bits (71), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 7/58 (12%)

Query: 234 ITDKFYYDPVHRPGLSNL-INIVSGITKQPVHAV------EQELQKFDNYRDLKAHVS 284
           ++++ Y  P    G  N   N+V   +  PVH V      +QELQ+FDN RD  + VS
Sbjct: 534 LSEETYISPKDSTGYGNEGTNLVEDSSSVPVHDVSAREIFQQELQRFDNRRDPDSIVS 591

>Kwal_26.7655
          Length = 743

 Score = 30.8 bits (68), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 255 VSGITKQPVHAVEQELQKFDNYRDLKAHVSEVIIEEL-RVPREKFHQYMEDPQFL 308
           V   +++P +A + + ++   +  L  H+   +     R+ RE+FHQY+++P++L
Sbjct: 77  VQDFSEKPRNAKQGKKEREQAHSRLNDHIDLTLNNVFGRINREQFHQYLKEPKYL 131

>CAGL0I04224g complement(369858..372686) highly similar to sp|P32863
           Saccharomyces cerevisiae YGL163c RAD54, start by
           similarity
          Length = 942

 Score = 29.6 bits (65), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 38/86 (44%), Gaps = 15/86 (17%)

Query: 137 LQAADILLYKATHVPVGDDQVQHLELTRTLAENFNKLYKKQVFPLPRTLLAPTKKILSLT 196
           L   ++ L K+ HVP+    VQ   L  TL        K +V P PR L  PT +   + 
Sbjct: 119 LDTIEVTLKKSFHVPI-KGYVQRHSLPLTLGT------KVKVIPEPRPLHDPTDEFAIVL 171

Query: 197 HDTKKMSKSDPNQDGVIYVNDPPETI 222
           +D        P+ DG + + D  ET+
Sbjct: 172 YD--------PSVDGEMIIQDDTETV 189

>YPR068C (HOS1) [5496] chr16 complement(682936..684348) Member of
           the histone deacetylase family, which catalyze removal
           of acetyl groups from histones, required for full
           repression of many genes [1413 bp, 470 aa]
          Length = 470

 Score = 29.3 bits (64), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 37/82 (45%), Gaps = 2/82 (2%)

Query: 186 LAPTKKILSLTHDTKKMSKSDPNQDGVIYVNDPPETIIRKIKKARTDSITDKFYYDPVHR 245
           L+PT++++ +  D  +         G  Y+ND    +I++++KA+ + IT    +D  H 
Sbjct: 194 LSPTERLIGINWDGGRHHAFKQRASGFCYINDVV-LLIQRLRKAKLNKIT-YVDFDLHHG 251

Query: 246 PGLSNLINIVSGITKQPVHAVE 267
            G+         I    VH  E
Sbjct: 252 DGVEKAFQYSKQIQTISVHLYE 273

>YCL014W (BUD3) [525] chr3 (96280..101190) Protein localized at the
            neck filament ring required for axial budding, may
            provide a memory of the previous bud site [4911 bp, 1636
            aa]
          Length = 1636

 Score = 28.5 bits (62), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 33/78 (42%), Gaps = 5/78 (6%)

Query: 172  KLYKKQVFPLPRTLLAPTKKILSLTHDTKKMSKSDPNQDGVIY---VNDPPETIIRKIKK 228
            K+ K   F + RT  +P + I     DT+K     P+     Y    ND P+  + ++K 
Sbjct: 1353 KIEKPPAFKVIRT--SPVRIIGRTFEDTRKYENGSPSDISFTYDTHNNDEPDKRLMELKF 1410

Query: 229  ARTDSITDKFYYDPVHRP 246
               D I D  +Y P   P
Sbjct: 1411 PSQDEIPDDRFYTPAEEP 1428

>CAGL0L11880g 1272624..1275566 some similarities with sp|P39956
           Saccharomyces cerevisiae YER169w, hypothetical start
          Length = 980

 Score = 28.5 bits (62), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 4/75 (5%)

Query: 166 LAENFNKLYKKQVFPLPRTLLAPTKKILSLTHDTKK----MSKSDPNQDGVIYVNDPPET 221
           LAEN++   KK+    P T  +P KK  S T D+ +    +S +  + +     ND    
Sbjct: 370 LAENWSNFKKKREIEDPETEDSPQKKRKSSTVDSNETISNVSATKEDDEVKNEDNDDNSK 429

Query: 222 IIRKIKKARTDSITD 236
           +I+ +KK  TDS  D
Sbjct: 430 LIKDVKKEVTDSNED 444

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,874,723
Number of extensions: 469126
Number of successful extensions: 1436
Number of sequences better than 10.0: 27
Number of HSP's gapped: 1451
Number of HSP's successfully gapped: 27
Length of query: 332
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 230
Effective length of database: 13,065,073
Effective search space: 3004966790
Effective search space used: 3004966790
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)