Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M08602g101299750560.0
YDR270W (CCC2)100496823370.0
Scas_615.994294321330.0
KLLA0F07447g97598921290.0
Kwal_55.2157598996920020.0
ACR086C81078212831e-162
AGL041C12339917418e-82
YBR295W (PCA1)12168967391e-81
KLLA0D04092g11529417325e-81
YGL008C (PMA1)9185182361e-19
AGL085C9095182342e-19
YPL036W (PMA2)9475182332e-19
Scas_710.419045322296e-19
KLLA0A09031g8995182252e-18
Scas_688.19135412224e-18
Kwal_47.175228995182119e-17
CAGL0A00495g9025181912e-14
Scas_707.48*7412311671e-11
CAGL0J01870g9462011671e-11
YGL167C (PMR1)9501371634e-11
AEL301W9571431591e-10
CAGL0I04312g9511371545e-10
KLLA0A03157g9381431537e-10
Kwal_14.14989391441529e-10
Kwal_47.1754712402891483e-09
KLLA0F20658g10825351421e-08
Kwal_23.316011002601412e-08
KLLA0E14630g10822601384e-08
KLLA0A08910g12801031341e-07
YGL006W (PMC1)11731081313e-07
Scas_297.1800871286e-07
CAGL0A00517g11222741286e-07
AGL097C10962391278e-07
AFL011W12421751232e-06
CAGL0K12034g10872361197e-06
YDR039C (ENA2)10912491161e-05
YDR038C (ENA5)10911881162e-05
YDR040C (ENA1)10912491162e-05
AFR567W1449841117e-05
Scas_569.0d4681361062e-04
Scas_665.30143957960.004
CAGL0M11308g145257960.004
KLLA0B08217g143950940.007
Kwal_26.9207146976930.009
Scas_583.14*87556910.014
YEL031W (SPF1)121558890.022
YOR291W147259870.040
AFR354C121051850.071
CAGL0L00715g114497850.081
CAGL0L01419g121451820.18
KLLA0E22352g120651810.19
Scas_704.38116183810.25
Scas_89.127168760.54
YIL048W (NEO1)115183770.71
KLLA0B13926g539106741.2
YAL026C (DRS2)135569722.7
ADL079C116688713.1
Sklu_2193.1114368713.2
KLLA0A04015g134369704.0
KLLA0C08393g114883704.3
YMR038C (LYS7)24961684.5
CAGL0G06270g1328278695.5
Kwal_23.57891133165695.9
Kwal_26.70701315275688.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M08602g
         (997 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M08602g complement(856349..859387) similar to sp|P38995 Sac...  1952   0.0  
YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transportin...   904   0.0  
Scas_615.9                                                            826   0.0  
KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces c...   824   0.0  
Kwal_55.21575                                                         775   0.0  
ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH] (511968..51...   498   e-162
AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) ...   290   8e-82
YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transpo...   289   1e-81
KLLA0D04092g complement(344666..348124) some similarities with s...   286   5e-81
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...    96   1e-19
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...    95   2e-19
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...    94   2e-19
Scas_710.41                                                            93   6e-19
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...    91   2e-18
Scas_688.1                                                             90   4e-18
Kwal_47.17522                                                          86   9e-17
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...    78   2e-14
Scas_707.48*                                                           69   1e-11
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...    69   1e-11
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...    67   4e-11
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...    66   1e-10
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...    64   5e-10
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....    64   7e-10
Kwal_14.1498                                                           63   9e-10
Kwal_47.17547                                                          62   3e-09
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...    59   1e-08
Kwal_23.3160                                                           59   2e-08
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...    58   4e-08
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...    56   1e-07
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...    55   3e-07
Scas_297.1                                                             54   6e-07
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...    54   6e-07
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....    54   8e-07
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...    52   2e-06
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...    50   7e-06
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...    49   1e-05
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...    49   2e-05
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...    49   2e-05
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...    47   7e-05
Scas_569.0d                                                            45   2e-04
Scas_665.30                                                            42   0.004
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...    42   0.004
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...    41   0.007
Kwal_26.9207                                                           40   0.009
Scas_583.14*                                                           40   0.014
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...    39   0.022
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...    38   0.040
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...    37   0.071
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...    37   0.081
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...    36   0.18 
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...    36   0.19 
Scas_704.38                                                            36   0.25 
Scas_89.1                                                              34   0.54 
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...    34   0.71 
KLLA0B13926g 1220237..1221856 weakly similar to sgd|S0006179 Sac...    33   1.2  
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...    32   2.7  
ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...    32   3.1  
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement          32   3.2  
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...    32   4.0  
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...    32   4.3  
YMR038C (LYS7) [4002] chr13 complement(347510..348259) Copper ch...    31   4.5  
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...    31   5.5  
Kwal_23.5789                                                           31   5.9  
Kwal_26.7070                                                           31   8.1  

>CAGL0M08602g complement(856349..859387) similar to sp|P38995
           Saccharomyces cerevisiae YDR270w CCC2, start by
           similarity
          Length = 1012

 Score = 1952 bits (5056), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 971/997 (97%), Positives = 971/997 (97%)

Query: 1   MKEVVLIVRGMTCASCVNAVVGQVEALEGVSSCDVSLVTSECKVVSEDSVATDGIIEAVE 60
           MKEVVLIVRGMTCASCVNAVVGQVEALEGVSSCDVSLVTSECKVVSEDSVATDGIIEAVE
Sbjct: 1   MKEVVLIVRGMTCASCVNAVVGQVEALEGVSSCDVSLVTSECKVVSEDSVATDGIIEAVE 60

Query: 61  DCGFDCELIREKSMAPALCRGFIGIKGMTCSSCVATVTKQLEAIEGVSDVDVSLMTEECT 120
           DCGFDCELIREKSMAPALCRGFIGIKGMTCSSCVATVTKQLEAIEGVSDVDVSLMTEECT
Sbjct: 61  DCGFDCELIREKSMAPALCRGFIGIKGMTCSSCVATVTKQLEAIEGVSDVDVSLMTEECT 120

Query: 121 VVFDPQLVAIEDIKETIDDCGFDGTVSSSEPVGGADSRAKYVDLRLLGFNSKDDNELDQL 180
           VVFDPQLVAIEDIKETIDDCGFDGTVSSSEPVGGADSRAKYVDLRLLGFNSKDDNELDQL
Sbjct: 121 VVFDPQLVAIEDIKETIDDCGFDGTVSSSEPVGGADSRAKYVDLRLLGFNSKDDNELDQL 180

Query: 181 TDKLRGFKQDNAGILDMALNTEDYCLSVHFDTQIIGIRKIIDILESLGINAVVDVSFDKH 240
           TDKLRGFKQDNAGILDMALNTEDYCLSVHFDTQIIGIRKIIDILESLGINAVVDVSFDKH
Sbjct: 181 TDKLRGFKQDNAGILDMALNTEDYCLSVHFDTQIIGIRKIIDILESLGINAVVDVSFDKH 240

Query: 241 TQLNLLTKASEIRYWKSACVKSCIVAFVTMVLYMGLPALFPSLMKDKIFPYSSVGAVNGL 300
           TQLNLLTKASEIRYWKSACVKSCIVAFVTMVLYMGLPALFPSLMKDKIFPYSSVGAVNGL
Sbjct: 241 TQLNLLTKASEIRYWKSACVKSCIVAFVTMVLYMGLPALFPSLMKDKIFPYSSVGAVNGL 300

Query: 301 YYRDIIGFFLASYVQFVIGATFYKSAWASLKHYAGTMDTLVCFSTTCAYLFSLYSMTECI 360
           YYRDIIGFFLASYVQFVIGATFYKSAWASLKHYAGTMDTLVCFSTTCAYLFSLYSMTECI
Sbjct: 301 YYRDIIGFFLASYVQFVIGATFYKSAWASLKHYAGTMDTLVCFSTTCAYLFSLYSMTECI 360

Query: 361 VSPPASGKLPKVIFDTSVMIVAYISIGKYLENXXXXXXXXXXXXXXXXXPSSCIIVDKDD 420
           VSPPASGKLPKVIFDTSVMIVAYISIGKYLEN                 PSSCIIVDKDD
Sbjct: 361 VSPPASGKLPKVIFDTSVMIVAYISIGKYLENKAKSKTSTALSKLISLTPSSCIIVDKDD 420

Query: 421 DSITQEIGIELLEVGDIAMVKPGAKIPSDGIVTKGISEVDESLMTGETNLVVKEIGSVVT 480
           DSITQEIGIELLEVGDIAMVKPGAKIPSDGIVTKGISEVDESLMTGETNLVVKEIGSVVT
Sbjct: 421 DSITQEIGIELLEVGDIAMVKPGAKIPSDGIVTKGISEVDESLMTGETNLVVKEIGSVVT 480

Query: 481 GGTINGSGLIYFEVTSVGDDTKLANIIKVMKNAQLKKASIQRYTDYVASIFVPTVLILSL 540
           GGTINGSGLIYFEVTSVGDDTKLANIIKVMKNAQLKKASIQRYTDYVASIFVPTVLILSL
Sbjct: 481 GGTINGSGLIYFEVTSVGDDTKLANIIKVMKNAQLKKASIQRYTDYVASIFVPTVLILSL 540

Query: 541 LTFIVWTSLTRSEKIISKLSIFGETSESRFYMCLQIATSVVIVACPCALGLATPTAIMVG 600
           LTFIVWTSLTRSEKIISKLSIFGETSESRFYMCLQIATSVVIVACPCALGLATPTAIMVG
Sbjct: 541 LTFIVWTSLTRSEKIISKLSIFGETSESRFYMCLQIATSVVIVACPCALGLATPTAIMVG 600

Query: 601 TGVASENGVLIKGGDVLEKFNEVNTFVFDKTGTLTTGHMTVQQFVGNAEMIKNLFYLECI 660
           TGVASENGVLIKGGDVLEKFNEVNTFVFDKTGTLTTGHMTVQQFVGNAEMIKNLFYLECI
Sbjct: 601 TGVASENGVLIKGGDVLEKFNEVNTFVFDKTGTLTTGHMTVQQFVGNAEMIKNLFYLECI 660

Query: 661 ERAEALSDHPVSKAVVKYCRDLLGESFEGTSMIIEDEQLITGKGIKCTVKAADKTLRITV 720
           ERAEALSDHPVSKAVVKYCRDLLGESFEGTSMIIEDEQLITGKGIKCTVKAADKTLRITV
Sbjct: 661 ERAEALSDHPVSKAVVKYCRDLLGESFEGTSMIIEDEQLITGKGIKCTVKAADKTLRITV 720

Query: 721 GNKSLMDEDSLGEFWQMYGRAGPCTVTYLAIDDKVCGRFELLDEVKSDAKDVIRYLRNNN 780
           GNKSLMDEDSLGEFWQMYGRAGPCTVTYLAIDDKVCGRFELLDEVKSDAKDVIRYLRNNN
Sbjct: 721 GNKSLMDEDSLGEFWQMYGRAGPCTVTYLAIDDKVCGRFELLDEVKSDAKDVIRYLRNNN 780

Query: 781 YEVFMVTGDTHKSAMKVAEMVDIPPNNVYSEVTPDGKSQTVEYLREEGRVIAFIGDGIND 840
           YEVFMVTGDTHKSAMKVAEMVDIPPNNVYSEVTPDGKSQTVEYLREEGRVIAFIGDGIND
Sbjct: 781 YEVFMVTGDTHKSAMKVAEMVDIPPNNVYSEVTPDGKSQTVEYLREEGRVIAFIGDGIND 840

Query: 841 SLALVTSDLGIAISSGTEVAIEAAGIVILNDPDTDEPTLKGVVNALDLSIRTFRRVKLNL 900
           SLALVTSDLGIAISSGTEVAIEAAGIVILNDPDTDEPTLKGVVNALDLSIRTFRRVKLNL
Sbjct: 841 SLALVTSDLGIAISSGTEVAIEAAGIVILNDPDTDEPTLKGVVNALDLSIRTFRRVKLNL 900

Query: 901 FWALCYNVFMLPIAMGILVPWGITLHPMVAGLAMAFXXXXXXXXXLMLKWWKAPELTSKN 960
           FWALCYNVFMLPIAMGILVPWGITLHPMVAGLAMAF         LMLKWWKAPELTSKN
Sbjct: 901 FWALCYNVFMLPIAMGILVPWGITLHPMVAGLAMAFSSVSVVVNSLMLKWWKAPELTSKN 960

Query: 961 SHSSKGYGYYTKGTEQLNRLLGSASTGMSDDTEIEIQ 997
           SHSSKGYGYYTKGTEQLNRLLGSASTGMSDDTEIEIQ
Sbjct: 961 SHSSKGYGYYTKGTEQLNRLLGSASTGMSDDTEIEIQ 997

>YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transporting
           P-type ATPase, member of the heavy-metal transporting
           P-type ATPases in the superfamily of P-type ATPases
           [3015 bp, 1004 aa]
          Length = 1004

 Score =  904 bits (2337), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/968 (48%), Positives = 660/968 (68%), Gaps = 16/968 (1%)

Query: 1   MKEVVLIVRGMTCASCVNAVVGQVEALEGVSSCDVSLVTSECKVVSEDSVATDGIIEAVE 60
           M+EV+L V GMTC++C N +  Q+ AL+GV+ CD+SLVT+EC+V  ++ V  D I E +E
Sbjct: 1   MREVILAVHGMTCSACTNTINTQLRALKGVTKCDISLVTNECQVTYDNEVTADSIKEIIE 60

Query: 61  DCGFDCELIREKSM-APALCRGFIGIKGMTCSSCVATVTKQLEAIEGVSDVDVSLMTEEC 119
           DCGFDCE++R+  + A +   G + ++GMTC SCV+TVTKQ+E IEGV  V VSL+TEEC
Sbjct: 61  DCGFDCEILRDSEITAISTKEGLLSVQGMTCGSCVSTVTKQVEGIEGVESVVVSLVTEEC 120

Query: 120 TVVFDPQLVAIEDIKETIDDCGFDGTVSSSEPVGGADSRAKYVDLRLL-GFNSKDDNELD 178
            V+++P    +E  +E I+DCGFD  +   +  G AD   K V L++   F  +    L 
Sbjct: 121 HVIYEPSKTTLETAREMIEDCGFDSNIIM-DGNGNADMTEKTVILKVTKAFEDESPLILS 179

Query: 179 QLTDKLRGFKQDNAGILDMALNTEDYCLSVHFDTQIIGIRKIIDILESLGINAVVDVSFD 238
            ++++ + F  D  G+  + ++ + + L++ +    +GIR ++  LE  G    V  + D
Sbjct: 180 SVSERFQ-FLLD-LGVKSIEISDDMHTLTIKYCCNELGIRDLLRHLERTGYKFTVFSNLD 237

Query: 239 KHTQLNLLTKASEIRYWKSACVKSCIVAFVTMVLYMGLPALFPSLMKDKIFPYSSVGAVN 298
             TQL LL+K  EIR+WK   +KS ++A + M+LYM +P ++P++++D+IFPY     V 
Sbjct: 238 NTTQLRLLSKEDEIRFWKKNSIKSTLLAIICMLLYMIVPMMWPTIVQDRIFPYKETSFVR 297

Query: 299 GLYYRDIIGFFLASYVQFVIGATFYKSAWASLKHYAGTMDTLVCFSTTCAYLFSLYSMTE 358
           GL+YRDI+G  LASY+QF +G  FYK+AWASLKH +GTMDTLVC STTCAY FS++S+  
Sbjct: 298 GLFYRDILGVILASYIQFSVGFYFYKAAWASLKHGSGTMDTLVCVSTTCAYTFSVFSLVH 357

Query: 359 CIVSPPASGKLPKVIFDTSVMIVAYISIGKYLENXXXXXXXXXXXXXXXXXPSSCIIVDK 418
            +  P ++GKLP+++FDTS+MI++YISIGKYLE                  PS C I+  
Sbjct: 358 NMFHPSSTGKLPRIVFDTSIMIISYISIGKYLETLAKSQTSTALSKLIQLTPSVCSIISD 417

Query: 419 DDDSITQEIGIELLEVGDIAMVKPGAKIPSDGIVTKGISEVDESLMTGETNLVVKEIGSV 478
            + + T+EI IELL+V DI  +KPG KIP+DGI+T+G SE+DESLMTGE+ LV K+ G  
Sbjct: 418 VERNETKEIPIELLQVNDIVEIKPGMKIPADGIITRGESEIDESLMTGESILVPKKTGFP 477

Query: 479 VTGGTINGSGLIYFEVTSVGDDTKLANIIKVMKNAQLKKASIQRYTDYVASIFVPTVLIL 538
           V  G++NG G  YF  T+VG++TKLANIIKVMK AQL KA IQ Y DY+ASIFVP +LIL
Sbjct: 478 VIAGSVNGPGHFYFRTTTVGEETKLANIIKVMKEAQLSKAPIQGYADYLASIFVPGILIL 537

Query: 539 SLLTFIVWTSLTRSEKIISKLSIFGETSESRFYMCLQIATSVVIVACPCALGLATPTAIM 598
           ++LTF +W  +         ++    T    F++CLQ ATSVVIVACPCALGLATPTAIM
Sbjct: 538 AVLTFFIWCFILNISA-NPPVAFTANTKADNFFICLQTATSVVIVACPCALGLATPTAIM 596

Query: 599 VGTGVASENGVLIKGGDVLEKFNEVNTFVFDKTGTLTTGHMTVQQFVGNAEMIKNL---F 655
           VGTGV ++NGVLIKGG+VLEKFN + TFVFDKTGTLTTG M V++F+ ++  + N+    
Sbjct: 597 VGTGVGAQNGVLIKGGEVLEKFNSITTFVFDKTGTLTTGFMVVKKFLKDSNWVGNVDEDE 656

Query: 656 YLECIERAEALSDHPVSKAVVKYCRDLLGESFEGTSMIIEDEQLITGKGIKCTVKAADKT 715
            L CI+  E++SDHPVSKA+++YC  L     +  + ++ + + + GKGI    +    T
Sbjct: 657 VLACIKATESISDHPVSKAIIRYCDGL--NCNKALNAVVLESEYVLGKGIVSKCQVNGNT 714

Query: 716 LRITVGNKSLMDEDSLGE--FWQMYGRAGPCTVTYLAIDDKVCGRFELLDEVKSDAKDVI 773
             I +GN++L+ ED+L +  F       G  TV+Y++++  V G FE+ DEVK D+   +
Sbjct: 715 YDICIGNEALILEDALKKSGFINSNVDQGN-TVSYVSVNGHVFGLFEINDEVKHDSYATV 773

Query: 774 RYLRNNNYEVFMVTGDTHKSAMKVAEMVDIPPNNVYSEVTPDGKSQTVEYL--REEGRVI 831
           +YL+ N YE +M+TGD + +A +VA  V I   NVYS+V+P GK   V+ +  +E    +
Sbjct: 774 QYLQRNGYETYMITGDNNSAAKRVAREVGISFENVYSDVSPTGKCDLVKKIQDKEGNNKV 833

Query: 832 AFIGDGINDSLALVTSDLGIAISSGTEVAIEAAGIVILNDPDTDEPTLKGVVNALDLSIR 891
           A +GDGIND+ AL  SDLGIAIS+GTE+AIEAA IVIL   D +  +L+G+ NA+D+S++
Sbjct: 834 AVVGDGINDAPALALSDLGIAISTGTEIAIEAADIVILCGNDLNTNSLRGLANAIDISLK 893

Query: 892 TFRRVKLNLFWALCYNVFMLPIAMGILVPWGITLHPMVAGLAMAFXXXXXXXXXLMLKWW 951
           TF+R+KLNLFWALCYN+FM+PIAMG+L+PWGITL PM+AGLAMAF         LMLK W
Sbjct: 894 TFKRIKLNLFWALCYNIFMIPIAMGVLIPWGITLPPMLAGLAMAFSSVSVVLSSLMLKKW 953

Query: 952 KAPELTSK 959
             P++ S 
Sbjct: 954 TPPDIESH 961

>Scas_615.9
          Length = 942

 Score =  826 bits (2133), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/943 (46%), Positives = 617/943 (65%), Gaps = 40/943 (4%)

Query: 78  LCRGFIGIKGMTCSSCVATVTKQLEAIEGVSDVDVSLMTEECTVVFDPQLVAIEDIKETI 137
           L +G + ++GMTCS+C + +  Q+  ++GV  V+VSL+T EC V F  + V++E I+ET+
Sbjct: 10  LYKGTLAVQGMTCSACTSAIIAQVGKLDGVGSVEVSLVTSECHVEFQLEKVSLELIRETV 69

Query: 138 DDCGFDGTVSSSEPVGGADSR-AKYVDLRLL--------GFNSKDDNELDQLTDKLRGFK 188
           +DCGFD  V +S P+G AD+   + V  ++L        GF+++  + +  + D  +  K
Sbjct: 70  EDCGFDAQVLTSTPMGSADADIVRTVTFKVLRSNYDVSSGFSAESGDSV-SMEDTEKVGK 128

Query: 189 QDNAGILDMALNTEDYCLSVHFDTQIIGIRKIIDILESLGINAVVD----VSFDKHTQLN 244
           QD  GIL +    E    ++ +D   IGIR +I     LG +A V+    +S    TQL 
Sbjct: 129 QD--GILSLEPALEVNTFNITYDENKIGIRDLIYFFNYLGYDATVESSNIISVSSATQLA 186

Query: 245 LLTKASEIRYWKSACVKSCIVAFVTMVLYMGLPALFPSLMKDKIFPYSSVGAVNGLYYRD 304
           LL+K  EI++WK  C+K+C+ A V M LYM +P +FP+L+K+  FP+     V+GL+YRD
Sbjct: 187 LLSKWDEIQFWKFTCLKACVCAIVAMALYMWIPMIFPNLIKNNHFPFKETFFVHGLFYRD 246

Query: 305 IIGFFLASYVQFVIGATFYKSAWASLKHYAGTMDTLVCFSTTCAYLFSLYSMTECIV--- 361
           IIG+ +A+Y QF +G  FYK+AW+S+KH +GTMDTL+  ST+CAYLFS++S+   +V   
Sbjct: 247 IIGWAIATYSQFRLGIYFYKAAWSSMKHGSGTMDTLIALSTSCAYLFSIFSIIHTMVLSR 306

Query: 362 SPPASGKLPKVIFDTSVMIVAYISIGKYLENXXXXXXXXXXXXXXXXXPSSCIIVDKDDD 421
               S  LP V+FDTSVM++A+IS GK LEN                 PS CII+   ++
Sbjct: 307 GNEESPMLPNVVFDTSVMLIAFISFGKLLENKAKAQTSSSLSKLIQLTPSKCIILQDKNN 366

Query: 422 SITQEIGIE--LLEVGDIAMVKPGAKIPSDGIVTKGISEVDESLMTGETNLVVKEIGSVV 479
             +  I IE  LL+  DI  +KPG KIP+DGI+ +G SE+DESLMTGE+ LV K+ GS V
Sbjct: 367 IQSSHIEIETNLLQRNDIIEIKPGMKIPADGIIIQGESEIDESLMTGESILVHKQKGSQV 426

Query: 480 TGGTINGSGLIYFEVTSVGDDTKLANIIKVMKNAQLKKASIQRYTDYVASIFVPTVLILS 539
             G++NG G  YF+  ++GDDTKLA II+ MK+AQL KA IQ   DY+ASIFVPT+L LS
Sbjct: 427 IAGSLNGPGHFYFKAINIGDDTKLAQIIQTMKSAQLNKAPIQNNADYLASIFVPTILCLS 486

Query: 540 LLTFIVWTSLTRSEKIISKLSIFGETSESRFYMCLQIATSVVIVACPCALGLATPTAIMV 599
           ++TFI W  +T S  +     IF   +  +FY   QIA SV++VACPCALGLATPTAIMV
Sbjct: 487 IITFITW--ITLSNLLTKPPVIFTNNNNGKFYTSFQIAISVIVVACPCALGLATPTAIMV 544

Query: 600 GTGVASENGVLIKGGDVLEKFNEVNTFVFDKTGTLTTGHMTVQQFVGNAEMIKNLFYLEC 659
           GTG+ +++GVLIKGGD+LE+FN +   VFDKTGT+TTG MTVQ+F+  +    +L  L C
Sbjct: 545 GTGIGAQHGVLIKGGDILERFNTITKIVFDKTGTITTGQMTVQRFIPYSN--DDLPVLPC 602

Query: 660 IERAEALSDHPVSKAVVKYCRDLLGESFEG--TSMIIEDEQLITGKGIKCTVKAADKTLR 717
           I  A+++S+HPV+KA+V YC    GES +     +I+   ++I GKG++C  +   +   
Sbjct: 603 IMAAQSISEHPVAKAIVNYC----GESSQDCDAGVIVTKSEIIIGKGVRCECEYQGRNYT 658

Query: 718 ITVGNKSLMDEDSLGEFWQMYGRAGPCTVTYLAIDDKVCGRFELLDEVKSDAKDVIRYLR 777
           +TVG+K+LM +            +   T +Y++I+D + G+FE+ D VK D  D+I+YL+
Sbjct: 659 VTVGHKALMTDSMFDS--NSDNTSDDFTKSYVSINDTLVGKFEIRDSVKEDVADIIQYLQ 716

Query: 778 NNNYEVFMVTGDTHKSAMKVAEMVDIPPNNVYSEVTPDGKSQTVEYLREEG-RVIAFIGD 836
             +Y+++MVTGD+H +AMKVA+ V I  NNVYS VTP GK + VE L+ +    +AF+GD
Sbjct: 717 GLHYDIYMVTGDSHGAAMKVAQQVGIAANNVYSGVTPSGKCEIVESLQADSVGGVAFVGD 776

Query: 837 GINDSLALVTSDLGIAISSGTEVAIEAAGIVILNDPDTDEPTLKGVVNALDLSIRTFRRV 896
           GINDS  LVTSD+G+A+S+GT++A+EAA IV+L +   +  +LKG++ ALD+S  TF RV
Sbjct: 777 GINDSPVLVTSDIGVALSTGTDIAMEAADIVVLGNDQDERESLKGLIYALDISAMTFSRV 836

Query: 897 KLNLFWALCYNVFMLPIAMGILVPWGITLHPMVAGLAMAFXXXXXXXXXLMLKWWKAPEL 956
           K NLFWAL YN+FM+PIAMGILVPWGIT+HPMVAGLAMA          L LK WK P +
Sbjct: 837 KWNLFWALGYNIFMIPIAMGILVPWGITIHPMVAGLAMALSSVFVVLNSLRLKSWKPPVI 896

Query: 957 TSKNSHSSKGYGYYTKGTEQL----NRLLGSASTGMSDDTEIE 995
             ++  SS    Y+ KGT  +     +L G +S  +  D E++
Sbjct: 897 GDEHPLSSD--YYHHKGTSWIRSGWRKLFGMSSEVVYQDLELQ 937

 Score = 76.3 bits (186), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 82/164 (50%), Gaps = 22/164 (13%)

Query: 6   LIVRGMTCASCVNAVVGQVEALEGVSSCDVSLVTSECKVVSE-DSVATDGIIEAVEDCGF 64
           L V+GMTC++C +A++ QV  L+GV S +VSLVTSEC V  + + V+ + I E VEDCGF
Sbjct: 15  LAVQGMTCSACTSAIIAQVGKLDGVGSVEVSLVTSECHVEFQLEKVSLELIRETVEDCGF 74

Query: 65  DCELIREKSMAPA------------------LCRGFIGIKGMTCSSCVATVTKQLEAIEG 106
           D +++    M  A                  +  GF    G + S      T+++   +G
Sbjct: 75  DAQVLTSTPMGSADADIVRTVTFKVLRSNYDVSSGFSAESGDSVS---MEDTEKVGKQDG 131

Query: 107 VSDVDVSLMTEECTVVFDPQLVAIEDIKETIDDCGFDGTVSSSE 150
           +  ++ +L      + +D   + I D+    +  G+D TV SS 
Sbjct: 132 ILSLEPALEVNTFNITYDENKIGIRDLIYFFNYLGYDATVESSN 175

>KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces
           cerevisiae YDR270w CCC2 probable copper-transporting
           ATPase, start by similarity
          Length = 975

 Score =  824 bits (2129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/989 (45%), Positives = 626/989 (63%), Gaps = 41/989 (4%)

Query: 3   EVVLIVRGMTCASCVNAVVGQVEALEGVSSCDVSLVTSECKVV-SEDSVATDGIIEAVED 61
           + ++ V+GMTC +CV  V  QV  ++GV+ C+VSL+T EC V+  +    T  I+E +++
Sbjct: 5   QALISVQGMTCGACVKTVQTQVGNVDGVTECEVSLLTEECHVLFDKGRTTTSEILETIDE 64

Query: 62  CGFDCELIREKSM-----APALCRGFIGIKGMTCSSCVATVTKQLEAIEGVSDVDVSLMT 116
           CGFD  LI E+ +           G + + GMTC +CV TVT Q+  + GV + DVSL+T
Sbjct: 65  CGFDGSLISEEPLDYDVTTTEQISGILLVSGMTCGACVKTVTGQVLKLSGVLECDVSLVT 124

Query: 117 EECTVVFDPQLVAIEDIKETIDDCGFDGTVSSSEPVGGADSRAKYVDLRLLGFNSKDDN- 175
           EEC V FDP   ++ +I E IDDCGFD  V S E      S  K + L++ G  S+ D  
Sbjct: 125 EECKVKFDPHFTSMAEIAECIDDCGFDAKVIS-ENSSSVPSNEKRLCLKIFGMLSESDRA 183

Query: 176 ELDQLTDKLRGFKQDNAGILDMALNTEDYCLSVHFDTQIIGIRKIIDILESLGINAVVDV 235
           +++    +L+G        +D +L +E+   +V  D   IG R IID +E +G    +  
Sbjct: 184 DIESKVSELKGVIS-----IDTSLQSEEA--TVIHDANEIGNRDIIDCIEEMGFQTFISN 236

Query: 236 SFDKHTQLNLLTKASEIRYWKSACVKSCIVAFVTMVLYMGLPALFPSLMKDKIFPYSSVG 295
           + D  TQL+LL+K  EI++WK  C++  I + + M LYM +P LFP+++    FP+    
Sbjct: 237 TLDNSTQLSLLSKTKEIQFWKKNCIRGGISSILIMGLYMCVPMLFPAVLTH--FPFVQTP 294

Query: 296 AVNGLYYRDIIGFFLASYVQFVIGATFYKSAWASLKHYAGTMDTLVCFSTTCAYLFSLYS 355
            + GL+YRDIIG  + +YVQ  +G+ FYK+AW SLKH +GTMDTL+  ST CAY+FS YS
Sbjct: 295 II-GLFYRDIIGIIITTYVQIYVGSYFYKAAWISLKHGSGTMDTLIGLSTVCAYIFSCYS 353

Query: 356 MTECIVSPPASGKLPKVIFDTSVMIVAYISIGKYLENXXXXXXXXXXXXXXXXXPSSCII 415
           +   I     S K+PKVIFDT+VM++ +IS+GK LEN                 PSSC I
Sbjct: 354 IISSIYH--KSTKMPKVIFDTAVMLLTFISLGKLLENKAKSETSTAMSKLISLTPSSCSI 411

Query: 416 VDKDDDSITQEIGIELLEVGDIAMVKPGAKIPSDGIVTKGISEVDESLMTGETNLVVKEI 475
           V  D    T+EI +ELL+  DI  V PG KIP+DG+V +  +EVDESL+TGE+ LV K +
Sbjct: 412 VLPDGS--TREISVELLQPNDIVEVVPGMKIPADGVVIRNETEVDESLITGESMLVEKIV 469

Query: 476 GSVVTGGTINGSGLIYFEVTSVGDDTKLANIIKVMKNAQLKKASIQRYTDYVASIFVPTV 535
           GS V GG++NG G  YF    VG+DTKLANII  MK AQL KA IQ+Y D +A IFVP V
Sbjct: 470 GSQVIGGSVNGPGHFYFRAIRVGEDTKLANIIATMKKAQLSKAPIQKYADKMAGIFVPFV 529

Query: 536 LILSLLTFIVWTSLTRSEKIISKLSIFGETSESRFYMCLQIATSVVIVACPCALGLATPT 595
           + LS +TFI W  ++ + K  +   IF  +   +F+MC+Q++ SV+IVACPCALGLA PT
Sbjct: 530 ISLSAITFITWMLVSYTMK--TPPLIF-NSENGKFFMCMQMSISVIIVACPCALGLAAPT 586

Query: 596 AIMVGTGVASENGVLIKGGDVLEKFNEVNTFVFDKTGTLTTGHMTVQQFVGNAEMIKNLF 655
           AIMVGTGV + +GVLIKGGDVLEK + + TF+FDKTGTLTTG M+V+ F+     + +L 
Sbjct: 587 AIMVGTGVGASHGVLIKGGDVLEKCSALQTFLFDKTGTLTTGRMSVENFINYNSDVSDLH 646

Query: 656 YLECIERAEALSDHPVSKAVVKYCRDLLGES--FEGTSMIIEDEQLITGKGIKCTV--KA 711
           + + I   E++ +HPV+KA+V Y    + +S  F+   + + +E+++ GKGI C +  K 
Sbjct: 647 W-KMISLCESIGEHPVAKAIVNYADSHVNKSSIFD---LDLSNEEVLIGKGISCNITDKN 702

Query: 712 ADKTLRITVGNKSLMDEDSLGEFWQMYGRAGPCTVTYLAIDDKVCGRFELLDEVKSDAKD 771
             K   IT+GNK L  ++SL +       +   T +Y++ID  + G+FE+ D VK DA  
Sbjct: 703 TSKIHTITIGNKKLFPDESLSDI-----ASSTLTESYVSIDGSLVGKFEISDRVKEDAHF 757

Query: 772 VIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIPPNNVYSEVTPDGKSQTVEYLREEG-RV 830
           V+ YL+N   +  MVTGD H+SA+KVA+ + I  N+V+SEVTP+ K   V  L+  G   
Sbjct: 758 VVEYLQNLGIKCCMVTGDAHQSALKVAQQLGISANDVFSEVTPEQKRDIVIQLQNNGTER 817

Query: 831 IAFIGDGINDSLALVTSDLGIAISSGTEVAIEAAGIVILNDPDTDEPTLKGVVNALDLSI 890
           +AF+GDGINDS ALV +DLGI+ISSGT++AIEAA IVIL D D    +LKG+V ALD++ 
Sbjct: 818 VAFVGDGINDSPALVEADLGISISSGTDIAIEAADIVIL-DSDNKNNSLKGLVYALDIAR 876

Query: 891 RTFRRVKLNLFWALCYNVFMLPIAMGILVPWGITLHPMVAGLAMAFXXXXXXXXXLMLKW 950
           +TF RVKLN FWA+CYN FM+PIAMG+L PWGITLHPM++  AMA          LMLK 
Sbjct: 877 KTFYRVKLNFFWAVCYNTFMIPIAMGLLAPWGITLHPMLSSAAMALSSVSVVCSSLMLKR 936

Query: 951 WKAPELTSKNSHSSKGYGYYTKGTEQLNR 979
           W  P L  K+  +S G  +   G    NR
Sbjct: 937 WTPPSLNIKSMEASGGLSWLRFGRNS-NR 964

>Kwal_55.21575
          Length = 989

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/969 (43%), Positives = 609/969 (62%), Gaps = 52/969 (5%)

Query: 5   VLIVRGMTCASCVNAVVGQVEALEGVSSCDVSLVTSECKVVSEDSVATDGIIE-AVEDCG 63
           VL+V GMTC +CV  +  Q++ ++GV    VSL+T EC+V  E     +  ++ A+ DCG
Sbjct: 8   VLLVEGMTCGACVATIESQLKRIKGVDEVTVSLITGECEVRFEKEDTDEETLKGAIIDCG 67

Query: 64  FDCELIREKSM-APALCR----GFIGIKGMTCSSCVATVTKQLEAIEGVSDVDVSLMTEE 118
           F   ++R + + A  + R      + ++ MTC +CVAT+T  LEA EGV +V VSL TEE
Sbjct: 68  FSATVLRVQDVEAGQIARQRKTAVLSVQHMTCGACVATITNNLEAQEGVLEVAVSLATEE 127

Query: 119 CTVVFDPQLVAIEDIKETIDDCGFDGTV---SSSEPVGGADSRAKYVDLRLLGFN----- 170
           C V FDP +V   ++K  IDD GF+  +    +  P  G  S  +   L++LG       
Sbjct: 128 CRVEFDPAVVTAAELKGIIDDSGFEAEIINDDAERPTRG--STVRKATLKVLGMTCGACV 185

Query: 171 SKDDNELDQLTDKLRGFKQDNAGILDMALNTEDYCLSVHFDTQIIGIRKIIDILESLGIN 230
           S  ++ L Q         +     + ++L TE+  L   ++  +IG+R I   +E LG  
Sbjct: 186 STVESALSQ---------EPGVVSIQVSLATEEAQL--EYNPAVIGVRAIASKIEDLGFE 234

Query: 231 AVVDVSFDKHTQLNLLTKASEIRYWKSACVKSCIVAFVTMVLYMGLPALFPSLMKDKIFP 290
           +    SF+   Q+NLL K  EI +WK  CV+SC    + ++LY   P   P+     +F 
Sbjct: 235 SAPVNSFNSVAQVNLLAKVREINFWKRTCVQSCCFMVLMLLLYKAGPLWIPA---RNLFF 291

Query: 291 YSSVGAVNGLYYRDIIGFFLASYVQFVIGATFYKSAWASLKHYAGTMDTLVCFSTTCAYL 350
           Y   G + GL+YRDIIGF +  YVQF +G  FY + W S++H +G+MDT+V  ST C++ 
Sbjct: 292 YKQTG-IPGLFYRDIIGFIITCYVQFWVGWHFYPAGWKSIRHGSGSMDTVVLLSTLCSFA 350

Query: 351 FSLYSMTECIVSPPASGKLPKVIFDTSVMIVAYISIGKYLENXXXXXXXXXXXXXXXXXP 410
           FSLYS+   +     S ++P VIFD SVM++ +IS+GK LEN                 P
Sbjct: 351 FSLYSIAMNVAK--KSERMPNVIFDASVMLIGFISVGKLLENKAKSKTNNSLSKLMSLAP 408

Query: 411 SSCIIVDKDDDSITQEIGIELLEVGDIAMVKPGAKIPSDGIVTKGISEVDESLMTGETNL 470
           S+C I++       +EI +E L+VGD   +KPGAKIP+DG++ +G SEVDESL+TGE+ +
Sbjct: 409 STCTIIENGK---AREIPVEFLQVGDTVEIKPGAKIPTDGVIIEGESEVDESLITGESLM 465

Query: 471 VVKEIGSVVTGGTINGSGLIYFEVTSVGDDTKLANIIKVMKNAQLKKASIQRYTDYVASI 530
           V +  G  V  G+ING        TSVGDDTKLA II+ MK AQL KA IQ Y DY+AS 
Sbjct: 466 VPRYKGFPVIAGSINGPNRFLLTATSVGDDTKLAQIIQTMKQAQLSKAPIQHYADYLASK 525

Query: 531 FVPTVLILSLLTFIVWTSLTRSEKIISKLSIFGETSESRFYMCLQIATSVVIVACPCALG 590
           FVP+VL+L+++TF+ WT L+R   ++S      ++   +F++CL++  SV++VACPCALG
Sbjct: 526 FVPSVLVLAMITFVTWTILSR---VLSNPPSIFDSPNGKFFICLEMTISVIVVACPCALG 582

Query: 591 LATPTAIMVGTGVASENGVLIKGGDVLEKFNEVNTFVFDKTGTLTTGHMTVQQFVGNAEM 650
           LA PTAIMVGTG+ +++GVLIKGGD+LEK + + TF+FDKTGTLTTGHMTV+QFV    +
Sbjct: 583 LAAPTAIMVGTGLGAKHGVLIKGGDILEKCSSLETFLFDKTGTLTTGHMTVEQFVPMG-V 641

Query: 651 IKNLFYLE--CIERAEALSDHPVSKAVVKYCRDLLGESFEGTSMIIEDEQLITGKGIKCT 708
             NL   E  CI  +EA+S+HPV KA+V++   L+ E  + T+++ + + ++ G G+ C 
Sbjct: 642 RDNLTTEELLCINASEAVSEHPVGKAIVEFTDSLI-EDCDRTAVVTKSKTIL-GGGLICD 699

Query: 709 VKAADKTLRITVGNKSLMDEDSLGEFWQMYGRAGPCTVTYLAIDDKVCGRFELLDEVKSD 768
            +   K   + +GN+++M + SL             T+ Y+ I+ ++ GRFE+ D +K D
Sbjct: 700 CELDGKAYHVVIGNRNVMQDMSLSA-------DASSTLAYVKINGELVGRFEISDFIKKD 752

Query: 769 AKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIPPNNVYSEVTPDGKSQTVEYLREEG 828
           A +V++YL    + V MVTGD HKSAMKVA  + I  NNVYSE+TP  K+Q V+ L++ G
Sbjct: 753 AAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGIEANNVYSELTPADKNQLVQDLQDGG 812

Query: 829 RV-IAFIGDGINDSLALVTSDLGIAISSGTEVAIEAAGIVILNDPDTDEPTLKGVVNALD 887
           R  +AFIGDGINDS ALVTSDLG++IS+GT++A+EAA ++ILN  + +  +L+ ++ ALD
Sbjct: 813 RKNVAFIGDGINDSPALVTSDLGVSISTGTDIAMEAADVIILNRSENNHVSLRELIYALD 872

Query: 888 LSIRTFRRVKLNLFWALCYNVFMLPIAMGILVPWGITLHPMVAGLAMAFXXXXXXXXXLM 947
           ++ +TFRRVK+N FWA+CYN+FMLPIAMG+LVPW IT+ P+VA   MA          L+
Sbjct: 873 IAQKTFRRVKINFFWAICYNLFMLPIAMGVLVPWEITMDPIVAVACMAASSVSVVGNSLL 932

Query: 948 LKWWKAPEL 956
           L  WK P+L
Sbjct: 933 LNLWKPPKL 941

 Score = 94.7 bits (234), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 57/164 (34%), Positives = 89/164 (54%), Gaps = 10/164 (6%)

Query: 2   KEVVLIVRGMTCASCVNAVVGQVEALEGVSSCDVSLVTSECKVVSEDSVATDGIIEA-VE 60
           K  VL V+ MTC +CV  +   +EA EGV    VSL T EC+V  + +V T   ++  ++
Sbjct: 88  KTAVLSVQHMTCGACVATITNNLEAQEGVLEVAVSLATEECRVEFDPAVVTAAELKGIID 147

Query: 61  DCGFDCELIREKSMAP----ALCRGFIGIKGMTCSSCVATVTKQLEAIEGVSDVDVSLMT 116
           D GF+ E+I + +  P     + +  + + GMTC +CV+TV   L    GV  + VSL T
Sbjct: 148 DSGFEAEIINDDAERPTRGSTVRKATLKVLGMTCGACVSTVESALSQEPGVVSIQVSLAT 207

Query: 117 EECTVVFDPQLVAIEDIKETIDDCGFDGTVSSSEPVGGADSRAK 160
           EE  + ++P ++ +  I   I+D GF+     S PV   +S A+
Sbjct: 208 EEAQLEYNPAVIGVRAIASKIEDLGFE-----SAPVNSFNSVAQ 246

 Score = 38.1 bits (87), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 34/66 (51%), Gaps = 1/66 (1%)

Query: 1   MKEVVLIVRGMTCASCVNAVVGQVEALEGVSSCDVSLVTSECKVVSEDSV-ATDGIIEAV 59
           +++  L V GMTC +CV+ V   +    GV S  VSL T E ++    +V     I   +
Sbjct: 169 VRKATLKVLGMTCGACVSTVESALSQEPGVVSIQVSLATEEAQLEYNPAVIGVRAIASKI 228

Query: 60  EDCGFD 65
           ED GF+
Sbjct: 229 EDLGFE 234

>ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH]
           (511968..514400) [2433 bp, 810 aa]
          Length = 810

 Score =  498 bits (1283), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 300/782 (38%), Positives = 461/782 (58%), Gaps = 39/782 (4%)

Query: 196 DMALNTEDYCLSVHFDTQIIGIRKIIDILESLGINAVVDVSFDKHTQLNLLTKASEIRYW 255
           +++L TE+ C  V ++ + +G+R+I++ +E  G  A V     +  Q+  L +A E   W
Sbjct: 53  EVSLVTEE-C-RVEYERKRVGLRQIVETIEDCGFEARVG-GCAREEQVRRLARAEETAQW 109

Query: 256 KSACVKSCIVAFVTMVLYMGLPALFPSLMKDKIFPYSSVGAVNGLYYRDIIGFFLASYVQ 315
           +    ++   A V M LYM  P      +++ + P      + GL++RD+ G  +AS V 
Sbjct: 110 RRRAAQAWAAAAVMMGLYMVAP------LEEALGPTP----LAGLFWRDVAGLAVASGVL 159

Query: 316 FVIGATFYKSAWASLKHYAGTMDTLVCFSTTCAYLFSLYSMTECIVSPPASGKLPKVIFD 375
              G  F +    +L+H  GTMDTLV  S+   YLFS+ ++   +     S   P    D
Sbjct: 160 ATAGRPFLR-GLGALRHGRGTMDTLVALSSGVTYLFSVATICRGVWL--GSADPPSTFLD 216

Query: 376 TSVMIVAYISIGKYLENXXXXXXXXXXXXXXXXXPSSCIIVDKDDDSITQEIGIELLEVG 435
           T+VM+VA+I +GK LE+                 PS C I +   D   +E+ +ELL+ G
Sbjct: 217 TTVMLVAFICVGKLLESRARARAADSLARMVSSAPSMCTIRESGSD---REVEVELLQAG 273

Query: 436 DIAMVKPGAKIPSDGIVTKGISEVDESLMTGETNLVVKEIGSVVTGGTINGSGLIYFEVT 495
           D+ +++PG K+P+DG V +G +EVDESLMTGE+ LV K  GS V  G++NG+    +   
Sbjct: 274 DVVVMRPGTKLPADGTVLEGEAEVDESLMTGESTLVPKYPGSRVLCGSVNGAAGFLYRAD 333

Query: 496 SVGDDTKLANIIKVMKNAQLKKASIQRYTDYVASIFVPTVLILSLLTFIVWTSLTRSEKI 555
            VG++T+LA I+  MK AQL KA IQRY D++AS F+P+VLIL+LLTF+ W  +     +
Sbjct: 334 LVGEETRLAGIVAAMKQAQLAKAPIQRYADFLASWFIPSVLILALLTFVCWMLIC--TLL 391

Query: 556 ISKLSIFGETSESRFYMCLQIATSVVIVACPCALGLATPTAIMVGTGVASENGVLIKGGD 615
            +  SIF  +  +R Y+C +IA +V++VACPC LGLA PTAIMVGTG+ +E G+L KGGD
Sbjct: 392 ATPPSIFNNS--NRLYVCSRIAITVIVVACPCPLGLAAPTAIMVGTGLGAERGLLFKGGD 449

Query: 616 VLEKFNEVNTFVFDKTGTLTTGHMTVQQFVGNAE-MIKNLFYLECIERAEALSDHPVSKA 674
           V+E    V   +FDKTGTLTTG +TV  F   ++ +  + + L C   AE LS+HP+++A
Sbjct: 450 VIETAAAVQAILFDKTGTLTTGKLTVHNFTSESKALTPDQWALVCA--AERLSEHPIARA 507

Query: 675 VVKYCRDLLGESFEGTS-MIIEDEQLITGKGIKCTVKAADKTLRITVGNKSLMDEDSLGE 733
           +V Y       S E  + +++ + +++ G G++C ++      RIT+G+  L+ E     
Sbjct: 508 IVTYAEPY--ASPEAVARIVVLNHEVLVGLGVRCVLQLDGVEHRITIGSARLLPERP--- 562

Query: 734 FWQMYGRAGPCTVTYLAIDDKVCGRFELLDEVKSDAKDVIRYLRNNNYEVFMVTGDTHKS 793
                 +    T +++A++D + GRF+L D ++ DA +V++ L +  + V MVTGD H++
Sbjct: 563 -----SKFSGSTASFVAVNDVLLGRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNHEA 617

Query: 794 AMKVAEMVDIPPNNVYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIAI 853
           AM V+  + IP NNV+SE  P+GK   +  LR++   +AFIGDGINDS+AL  SDLGI++
Sbjct: 618 AMHVSHALGIPLNNVFSERLPEGKCDVLRQLRQKYDYVAFIGDGINDSVALAESDLGISL 677

Query: 854 SSGTEVAIEAAGIVILNDPDTDEPTLKGVVNALDLSIRTFRRVKLNLFWALCYNVFMLPI 913
           S  +++  +AAGIV+L+   +  P L  ++ A+DL+  TF RVKLN+FWA+ YN  MLP+
Sbjct: 678 SGNSDIVADAAGIVVLD--HSSAPPLTRILYAIDLARATFNRVKLNIFWAVLYNSLMLPV 735

Query: 914 AMGILVPWGITLHPMVAGLAMAFXXXXXXXXXLMLKWWKAPELTSKNSHSSKGYGYYTKG 973
           +MG+L+PWGI L PM A   MA          L+L  W+     S+ +       ++ KG
Sbjct: 736 SMGVLIPWGIQLPPMAAAAGMAMSSVSVVTSSLLLARWRPVPAASRKAAVGSWRNFFKKG 795

Query: 974 TE 975
             
Sbjct: 796 PR 797

 Score = 73.6 bits (179), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 57/88 (64%)

Query: 59  VEDCGFDCELIREKSMAPALCRGFIGIKGMTCSSCVATVTKQLEAIEGVSDVDVSLMTEE 118
           +E  G + E+ R  + + A     + ++GMTC++CV TV + + A++GV + +VSL+TEE
Sbjct: 1   MEVTGLEAEMARMGNGSMAGTTAVLSVRGMTCAACVKTVDEAVRAVDGVVNAEVSLVTEE 60

Query: 119 CTVVFDPQLVAIEDIKETIDDCGFDGTV 146
           C V ++ + V +  I ETI+DCGF+  V
Sbjct: 61  CRVEYERKRVGLRQIVETIEDCGFEARV 88

 Score = 62.8 bits (151), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 43/65 (66%), Gaps = 1/65 (1%)

Query: 5  VLIVRGMTCASCVNAVVGQVEALEGVSSCDVSLVTSECKVVSE-DSVATDGIIEAVEDCG 63
          VL VRGMTCA+CV  V   V A++GV + +VSLVT EC+V  E   V    I+E +EDCG
Sbjct: 24 VLSVRGMTCAACVKTVDEAVRAVDGVVNAEVSLVTEECRVEYERKRVGLRQIVETIEDCG 83

Query: 64 FDCEL 68
          F+  +
Sbjct: 84 FEARV 88

>AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) [3702
            bp, 1233 aa]
          Length = 1233

 Score =  290 bits (741), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 258/991 (26%), Positives = 469/991 (47%), Gaps = 100/991 (10%)

Query: 20   VVGQVEALEGVSSCDVSLVTSECKVVSEDSVATDGIIEAVEDCGFDCELIREKSMAPALC 79
            V+  V     V    + L   +  V+  + +    + +A+ D  F  +L+  K +   L 
Sbjct: 223  VIRNVLKTSAVDENGMELTPGKLSVLLSNKLYAQSVADALRDNNFQAQLVDMKPVVNELK 282

Query: 80   RGFIGI-KGMTCSSCVATVTKQLEAIEGVSDVDVSLMTEECTVVFD-PQLVAIEDIKETI 137
                 I  G+TC+SC  ++T     ++ ++DV V+ +T+    + D     AI  +++ +
Sbjct: 283  YKITAIIGGITCASCCNSITAAASKLDFIADVAVNAVTKTAIFISDVNNERAINCLRDVV 342

Query: 138  DDCGFDGT---VSSSEPVGGADSRAKYVDLRLLGFNSKDDNELDQLTDKLRGFKQDNAGI 194
            ++CGF+     V  S       +  + V + + G   +   +  ++   L  + + N  +
Sbjct: 343  EECGFEFELVGVPQSTIHSSVQTERRVVTIEIDGMYCQSCPQ--RVVASLENYNKANIEV 400

Query: 195  LDMALNTEDYCLSVHFDTQIIG--IRKIIDILES--LGINAVVDVSFDKHTQLNLL-TKA 249
              +      +    +   Q  G  IR +++ + +  L  N+   +S  K  + +LL +K 
Sbjct: 401  TQVPTLKSPHLTFSYVPNQSNGTTIRALVEHVRTSILPANSSYQISV-KVVEGSLLDSKL 459

Query: 250  SEIRYWKSACVKSC-----IVAFVTMVLYMGLPALFPSLMKDKIFPYSSVGAVNGLYYRD 304
             ++   +   +  C     IVA  T V  +   +L P   + + +    +   N    R 
Sbjct: 460  KDLNEREQKSIMRCLIFAAIVAIPTFVFGIIGMSLLPGEHRFRKWLEKPLWVKN--VPRV 517

Query: 305  I-IGFFLASYVQFVIGATFYKSA-------WASLKHYA------GTMDTLVCFSTTCAYL 350
            I I   L++ V F +   F+  A       WA  K +       G+M+ LV   T+ AY 
Sbjct: 518  IWILLILSTPVYFSVAEQFHAKACRELHFLWAYQKSWTARLFKFGSMNLLVSLGTSVAYF 577

Query: 351  FSLYSMTECIVSPPASGKL--PKVIFDTSVMIVAYISIGKYLENXXXXXXXXXXXXXXXX 408
             S+  +    +   A+     P   FD+ V +  ++ IG+ LE+                
Sbjct: 578  ASILLLILSALKKDANHHKGSPDTYFDSVVFLTLFLLIGRLLESLSKSKMVKTLESLTSL 637

Query: 409  XPSSCIIVDKD---DDSITQEIGIELLEVGDIAMVKPGAKIPSDGIVTKGISEVDESLMT 465
               + I++  D   D      +  E+LE+GD  ++KPGA    D ++ +G +E DES +T
Sbjct: 638  KQRTGILMQADGARDFKKETSVSAEMLELGDHILIKPGASPAVDALIVQGETEFDESSLT 697

Query: 466  GETNLVVKEIGSVVTGGTIN-GSGLIYFEVTSVGDDTKLANIIKVMKNAQLKKASIQRYT 524
            GE+  +    G  +  GT+N G   +  +V++   ++ L ++I  +++ QL+ A I+R  
Sbjct: 698  GESRPITHFPGDQIFAGTVNVGQCAVIAKVSTAPGNSLLDHVISAVRDGQLRGAPIERIA 757

Query: 525  DYVASIFVPTVLILSLLTFIVWTSLTRSEKIISKLSIFGETSESRFYMCLQIATSVVIVA 584
            D +   FVP +++L++LT+ +W  L  +  ++S+  + G      F+  L+ A +V ++A
Sbjct: 758  DVLTGYFVPFIVLLAILTWAIWLILGFA-GVLSQEKLDGSVGGWPFW-SLEFAIAVFVIA 815

Query: 585  CPCALGLATPTAIMVGTGVASENGVLIKGGD-VLEKFNEVNTFVFDKTGTLTTG---HMT 640
            CPC +GLA PTA+ VG  +A++ G+L +GG    +  ++V T  FDKTGTLT G    +T
Sbjct: 816  CPCGIGLAAPTALFVGANIAAKYGILARGGSAAFQMGSKVTTVCFDKTGTLTKGCAPEVT 875

Query: 641  VQQFVGNAEMIKNLFYLECIERAEALSDHPVSKAVVKYCRDLLGESFEGTSMIIEDEQLI 700
                  +  + K L   + +      S HP+S ++  +    LGE     +++   E  I
Sbjct: 876  DYAIYPDPRIHKILG--KVLHEFGLASKHPLSHSMKCFALKTLGEDLSDINVLEIKE--I 931

Query: 701  TGKGIKCTVK---AADKTLR-------ITVGNKSLM---------DEDSLGEFWQMYGR- 740
             GKG+   ++   A     R       + VGN+  M         D++SL   W++ GR 
Sbjct: 932  PGKGMTGVIEPSPAQPSGFRDELVPSEVIVGNEKFMAENGCQLSPDQESLLYSWKIEGRS 991

Query: 741  ------------AGPCTVTYLAIDDKVCGRFELLDEVKSDAKDVIRYLRNNNYEVFMVTG 788
                        A  C +  L +  +        DE++ +AK+V++ L     E +M++G
Sbjct: 992  IIIIGMNFPEGAATQCFIPTLFLAVR--------DELRPEAKEVVQALHERGIECWMISG 1043

Query: 789  DTHKSAMKVAEMVDIPPNNVYSEVTPDGKSQTVEYLRE---EGRVIAFIGDGINDSLALV 845
            D   +A  VA  V I   +V ++V P+GK++ ++++RE   +G  IA +GDG+ND+ A+ 
Sbjct: 1044 DNSLAANAVALEVGI--KHVIADVLPEGKAEKIQWIRETSGQGVAIAMVGDGMNDAPAIA 1101

Query: 846  TSDLGIAISSGTEVAIEAAGIVILNDPDTDEPTLKGVVNALDLSIRTFRRVKLNLFWALC 905
             +D+GI+++SG+++A+ +   V+L+  +     L G+V  L LS + FRRVK N  WAL 
Sbjct: 1102 AADVGISLASGSDLAMISCDFVLLSKKN----PLTGIVVLLQLSKKVFRRVKFNFVWALV 1157

Query: 906  YNVFMLPIAMGILVPWGIT-LHPMVAGLAMA 935
            YN+  +PIA G+L P+  T L P+ A +AMA
Sbjct: 1158 YNIICVPIAAGVLYPYKETRLSPVWASIAMA 1188

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 52/108 (48%), Gaps = 8/108 (7%)

Query: 3   EVVLIVRGMTCASCVNAVVGQVEALEGVSSCDVSLVTSECKVVSE--DSVATDGIIEAVE 60
           ++  I+ G+TCASC N++      L+ ++   V+ VT     +S+  +  A + + + VE
Sbjct: 284 KITAIIGGITCASCCNSITAAASKLDFIADVAVNAVTKTAIFISDVNNERAINCLRDVVE 343

Query: 61  DCGFDCELIR------EKSMAPALCRGFIGIKGMTCSSCVATVTKQLE 102
           +CGF+ EL+         S+        I I GM C SC   V   LE
Sbjct: 344 ECGFEFELVGVPQSTIHSSVQTERRVVTIEIDGMYCQSCPQRVVASLE 391

>YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transporting
            ATPase, involved in resistance to cadmium [3651 bp, 1216
            aa]
          Length = 1216

 Score =  289 bits (739), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 248/896 (27%), Positives = 426/896 (47%), Gaps = 120/896 (13%)

Query: 83   IGIKGMTCSSCVATVTKQLEAIEGVSDVDVSLMTEECTVVFDPQLVAIEDIKETIDDCGF 142
            + + GM+C+ C + + K   A++ V  +  SL+  +     D    +++D+ + +     
Sbjct: 414  LSVSGMSCTGCESKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDVIKHLSKT-- 471

Query: 143  DGTVSSSEPVGGADSRAKYVDLRLLGFNSKD--DNELDQLTDKLRGFKQDNAGILDMALN 200
              T    E +    S    V    + + +KD  + E  Q             G+ ++ + 
Sbjct: 472  --TEFKYEQISNHGSTIDVV----VPYAAKDFINEEWPQ-------------GVTELKI- 511

Query: 201  TEDYCLSVHFDTQIIGIRKIIDILESLGINAVVDVSFDKHTQLNLLTKASEIRYWKSACV 260
             E   + ++FD ++IG R +++   S+ ++      F  H  + +  K       +  C 
Sbjct: 512  VERNIIRIYFDPKVIGARDLVNEGWSVPVSIA---PFSCHPTIEVGRK----HLVRVGCT 564

Query: 261  KSCIVAFVTMVLYMGLPALFPSLMKDKIFPYSSVGAVNGLYYRDIIGFFLASYVQFVIGA 320
             +  +     +L M   A  P L ++KI   S+                LA+ +QFVI  
Sbjct: 565  TALSIILTIPILVM---AWAPQL-REKISTISA-------------SMVLATIIQFVIAG 607

Query: 321  TFYKSAWASLKHYAG-TMDTLVCFSTTCAYLFSLYSMTECIVSPPASGKLPKVIFDTSVM 379
             FY +A  SL       MD L+  ST+ AY+FS+ S    +V  P S    +  F+TS +
Sbjct: 608  PFYLNALKSLIFSRLIEMDLLIVLSTSAAYIFSIVSFGYFVVGRPLS---TEQFFETSSL 664

Query: 380  IVAYISIGKYLENXXXXXXXXXXXXXXXXXPSSCIIVDKDDDSITQEIGIELLEVGDIAM 439
            +V  I +G+++ +                  SS I+VDK       EI I LL+ GDI  
Sbjct: 665  LVTLIMVGRFV-SELARHRAVKSISVRSLQASSAILVDKTGKET--EINIRLLQYGDIFK 721

Query: 440  VKPGAKIPSDGIVTKGISEVDESLMTGETNLVVKEIGSVVTGGTINGSGLIYFEVTSVGD 499
            V P ++IP+DG V  G SEVDE+L+TGE+  V K+  S+V  G++NG+G ++ +++ +  
Sbjct: 722  VLPDSRIPTDGTVISGSSEVDEALITGESMPVPKKCQSIVVAGSVNGTGTLFVKLSKLPG 781

Query: 500  DTKLANIIKVMKNAQLKKASIQRYTDYVASIFVPTVLILSLLTFIVWTSL-TRSEKIISK 558
            +  ++ I  ++  A+L K  IQ   D +AS FVPT++ ++++TF VW ++  R EK    
Sbjct: 782  NNTISTIATMVDEAKLTKPKIQNIADKIASYFVPTIIGITVVTFCVWIAVGIRVEK---- 837

Query: 559  LSIFGETSESRFYMCLQI---ATSVVIVACPCALGLATPTAIMVGTGVASENGVLIKGGD 615
                    +SR    +Q    A +V+IV+CPC +GLA P   ++ +GVA++ GV+ K  +
Sbjct: 838  --------QSRSDAVIQAIIYAITVLIVSCPCVIGLAVPIVFVIASGVAAKRGVIFKSAE 889

Query: 616  VLEKFNEVNTFVFDKTGTLTTGHMTV--QQFVGNAEMIKNLFYLECIERAEALSDHPVSK 673
             +E  +  +  VFDKTGTLT G +TV  +   G+    ++L     +   E +  HPVS 
Sbjct: 890  SIEVAHNTSHVVFDKTGTLTEGKLTVVHETVRGDRHNSQSLL----LGLTEGI-KHPVSM 944

Query: 674  AVVKYCRDLLGESFEGTSMIIEDEQLITGKGIKCTVKAADKTLRITVGNKSLM----DED 729
            A+  Y ++  G S +  S    + + +TGK ++ T  +    L++  GN   +    D D
Sbjct: 945  AIASYLKE-KGVSAQNVS----NTKAVTGKRVEGTSYSG---LKLQGGNCRWLGHNNDPD 996

Query: 730  SLGEFWQMYGRAGPCTVTYLAIDDKVCGRFELLDEVKSDAKDVIRYLRNNNYEVFMVTGD 789
                  Q Y      +V   +++  V   + L D +++DA   I  LR     + +++GD
Sbjct: 997  VRKALEQGY------SVFCFSVNGSVTAVYALEDSLRADAVSTINLLRQRGISLHILSGD 1050

Query: 790  THKSAMKVAEMVDIPPNNVYSEVTPDGKSQTVEYLRE--EGR-----------VIAFIGD 836
               +   +A  + I  +N+ S  TP  KS   EY+++  EGR           V+ F GD
Sbjct: 1051 DDGAVRSMAARLGIESSNIRSHATPAEKS---EYIKDIVEGRNCDSSSQSKRPVVVFCGD 1107

Query: 837  GINDSLALVTSDLGIAISSGTEVAIEAAGIVILNDPDTDEPTLKGVVNALDLSIRTFRRV 896
            G ND++ L  + +G+ I+ G+EVA  AA +V+L      +P L  ++  + +S +   RV
Sbjct: 1108 GTNDAIGLTQATIGVHINEGSEVAKLAADVVML------KPKLNNILTMITVSQKAMFRV 1161

Query: 897  KLNLFWALCYNVFMLPIAMGILVPWGITLHPMVAGLAMAFXXXXXXXXXLMLKWWK 952
            KLN  W+  YN+F + +A G  V + I   P  AGL             ++L++ K
Sbjct: 1162 KLNFLWSFTYNLFAILLAAGAFVDFHIP--PEYAGLGELVSILPVIFVAILLRYAK 1215

>KLLA0D04092g complement(344666..348124) some similarities with
            sp|P38995 Saccharomyces cerevisiae YDR270w CCC2 probable
            copper-transporting ATPase P16.2.f2.1, hypothetical start
          Length = 1152

 Score =  286 bits (732), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 256/941 (27%), Positives = 453/941 (48%), Gaps = 122/941 (12%)

Query: 85   IKGMTCSSCVATVTKQLEAIEGVSDVDVSLMTEECTVVFDPQ-LVAIEDIKETIDDCGFD 143
            I G+TC++C +++T  +  ++ VSDV V+++++    + D      ++ +KET++DCGF 
Sbjct: 193  IGGITCAACASSITNAVSDLDFVSDVAVNVVSKVGVFILDSDDQSKLDQLKETVEDCGFV 252

Query: 144  GTVSSSEPVGG---ADSRAKYVDLRLLGFNSKDDNELDQLTDKLRGFKQDNAGILDMAL- 199
                 S  +       S A++V +++ G    +          +R  K     +LD+A  
Sbjct: 253  YEAVGSPTLTNHISVKSPARHVTVKIEGMFCSNC--------PVRTIKS----LLDIANA 300

Query: 200  -----NTEDYCLS---VHFD-----TQIIGIRKIID-ILESLGINAVVDVSFDKHTQLNL 245
                 NT++  L    + F       + I IR I   I E L      D+      ++ L
Sbjct: 301  ELIIDNTDELTLKHPYIKFTYIPNVERGITIRNIFSKITEELTTEEHKDIKVVIVKEVTL 360

Query: 246  LTKASEIRYWKSACVKSCIVAFVTMVL------YMGLPALFPS--LMKDKIFPYSSVGAV 297
                 E+   ++  +   ++A   M +       +G+ AL PS    ++ +   + VG V
Sbjct: 361  EEHLKEMAKKETWSIAKRLIAVTVMAIPTFAFGIVGM-ALLPSSNKFREWVDEPTWVGNV 419

Query: 298  NGLYYRDIIGFFLASYVQFVIGATFYKSA-------------WASLKHYAGTMDTLVCFS 344
            + + +   I F +++ V F +   F++ A             W       G+M+ L+   
Sbjct: 420  SRVVW---ILFIISTPVYFFVADIFHRKAVKEIYSLWKHSNNWKRRLFRFGSMNLLMSLG 476

Query: 345  TTCAYLFSLYSMTECIVSPPASGK------LPKVIFDTSVMIVAYISIGKYLENXXXXXX 398
            TT AY  S+  +      P  +        L    FD+ V +  ++ IG+ LE+      
Sbjct: 477  TTVAYFASIALLGIAASRPRDTSDSRMHKGLSTTYFDSVVFLTFFLLIGRLLESLAKTKT 536

Query: 399  XXXXXXXXXXXPSSCIIVDKDDDSITQ--EIGIELLEVGDIAMVKPGAKIPSDGIVTKGI 456
                         +  ++ K  D   +   + I+ LE+GD   + PG   P D I+ +G 
Sbjct: 537  ASAISNLSSFKQETATLMQKVGDQYQEVETVQIQYLELGDYIKISPGQSPPLDSIILEGE 596

Query: 457  SEVDESLMTGETNLVVKEIGSVVTGGTIN-GSGLIYFEVTSVGDDTKLANIIKVMKNAQL 515
            +E DES +TGE+  +V+  G  +  GT+N GS  +  +V+S   ++ L  I+  +++ QL
Sbjct: 597  TEFDESALTGESIPMVRLRGDQIFAGTVNVGSSSVIAKVSSFDGESLLDQIVNTVRDGQL 656

Query: 516  KKASIQRYTDYVASIFVPTVLILSLLTFIVWTSLTRSEKIISKLSIFGETSESRFYM-CL 574
             +A I+R  D +   FVP ++ L++LT++VW SL  S K+      + +T    + +  L
Sbjct: 657  NRAPIERLADILTGYFVPIIIFLAILTWVVWLSLGLSGKLPEH---YLDTDIGGWPVWSL 713

Query: 575  QIATSVVIVACPCALGLATPTAIMVGTGVASENGVLIKGGD-VLEKFNEVNTFVFDKTGT 633
            + A SV ++ACPC +GLA PTA+ VG+G+A++ G+L +GG    ++  ++    FDKTGT
Sbjct: 714  EFAISVFVIACPCGIGLAAPTALFVGSGMAAKFGILCRGGGAAFQEGCKIAIVCFDKTGT 773

Query: 634  LTTGH-MTVQQFVGNAEMIKNLFYLECIERAEALSDHPVSKAVVKYCRDLLGESFEGTSM 692
            LT G+ M V  +  + +       +E     E+ S HP++  V K+  +  G+  +  ++
Sbjct: 774  LTLGNEMKVTNYSLHGDEKLAKIGIEVTRDMESGSRHPLAIGVKKFIDNTFGK--KTGTV 831

Query: 693  IIEDEQLITGKGIKCTV--------------KAADKTLRITVGNKSLM---------DED 729
             + D   ITG G+K  +              K  D  + I VGN+ L+         ++ 
Sbjct: 832  KVPDPVEITGGGLKGEIIIDNDLSLPDARIWKEVDPEMAI-VGNERLLRDYKCHLTSEQL 890

Query: 730  SLGEFWQMYGRAGPCTV----TYLAIDD----KVCGRFELLDEVKSDAKDVIRYLRNNNY 781
             L   W+  G++   T     +Y   D+     +C      DE++ +AKDVI+ LR +  
Sbjct: 891  KLLAEWKARGKSLMVTAIKSRSYFGNDNFYPVMMCA---AKDEIRPEAKDVIKELRRSGI 947

Query: 782  EVFMVTGDTHKSAMKVAEMVDIPPNNVYSEVTPDGKSQTVEYLREEG-------RVIAFI 834
            E +M++GD   +A  VA+ +DI  +NV +EV P+ K+  V++++          +V+A +
Sbjct: 948  ECWMISGDNEVTARAVAQELDI--DNVIAEVLPEEKAAKVKWIQHNNIGANGHHKVVAMV 1005

Query: 835  GDGINDSLALVTSDLGIAISSGTEVAIEAAGIVILNDPDTDEPTLKGVVNALDLSIRTFR 894
            GDGIND+ AL  +D+GIA++SG+E+A+ +   V+L+  +T    L  +  +  +    F 
Sbjct: 1006 GDGINDAPALAAADVGIALASGSELAMTSCDFVLLSPINTLVSLLALLKLSKTV----FN 1061

Query: 895  RVKLNLFWALCYNVFMLPIAMGILVPWGIT-LHPMVAGLAM 934
            R+K N  WAL YN+  LPIA G++ P+  T L P+ A  AM
Sbjct: 1062 RIKFNFTWALVYNMLALPIAAGVIYPYHNTRLSPVWASAAM 1102

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 51/101 (50%), Gaps = 10/101 (9%)

Query: 10  GMTCASCVNAVVGQVEALEGVSSCDVSLVTSECKVV--SEDSVATDGIIEAVEDCGFDCE 67
           G+TCA+C +++   V  L+ VS   V++V+     +  S+D    D + E VEDCGF  E
Sbjct: 195 GITCAACASSITNAVSDLDFVSDVAVNVVSKVGVFILDSDDQSKLDQLKETVEDCGFVYE 254

Query: 68  LIREKSM-------APALCRGFIGIKGMTCSSCVATVTKQL 101
            +   ++       +PA     + I+GM CS+C     K L
Sbjct: 255 AVGSPTLTNHISVKSPAR-HVTVKIEGMFCSNCPVRTIKSL 294

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score = 95.5 bits (236), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 123/518 (23%), Positives = 209/518 (40%), Gaps = 84/518 (16%)

Query: 435 GDIAMVKPGAKIPSDG-IVTKG-ISEVDESLMTGETNLVVKEIGSVVTGGTINGSGLIYF 492
           GDI  ++ G  IP+DG IVT+    ++D+S +TGE+  V K  G      +    G  + 
Sbjct: 199 GDILQLEDGTVIPTDGRIVTEDCFLQIDQSAITGESLAVDKHYGDQTFSSSTVKRGEGFM 258

Query: 493 EVTSVGDDTKLANIIKVMKNAQLKKASIQRYTDYVASIFVPTVLILSLLTFIVWTS-LTR 551
            VT+ GD+T +     ++  A   +       + +  I +  VL+++ L  +VWT+   R
Sbjct: 259 VVTATGDNTFVGRAAALVNKAAGGQGHFTEVLNGIGIILL--VLVIATL-LLVWTACFYR 315

Query: 552 SEKIISKLSIFGETSESRFYMCLQIATSVVIVACPCALGLATPTAIMVGTGVASENGVLI 611
           +  I+                 L+    + I+  P  L     T + VG    ++   ++
Sbjct: 316 TNGIVR---------------ILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIV 360

Query: 612 KGGDVLEKFNEVNTFVFDKTGTLTTGHMTVQQ-FVGNAEMIKNLFYLEC----------- 659
           +    +E    V     DKTGTLT   +++ + +        +L    C           
Sbjct: 361 QKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSPDDLMLTACLAASRKKKGLD 420

Query: 660 -IERA--EALSDHPVSKAVVKYCRDLLGESFEGTS----MIIEDEQLITGKGIKCTVKAA 712
            I++A  ++L  +P +K  +   + L    F+  S     ++E  +   G+ I C VK A
Sbjct: 421 AIDKAFLKSLKQYPKAKDALTKYKVLEFHPFDPVSKKVTAVVESPE---GERIVC-VKGA 476

Query: 713 DKTLRITVGNKSLMDEDSLGEFWQMYGRAGPCTVTYLAIDDKVC-GRFELL------DEV 765
              +  TV     + ED    +              L +  K   G +E+L      D  
Sbjct: 477 PLFVLKTVEEDHPIPEDVHENYENKVAELASRGFRALGVARKRGEGHWEILGVMPCMDPP 536

Query: 766 KSDAKDVIRYLRNNNYEVFMVTGDTHKSA--------------------------MKVAE 799
           + D    +   R+    V M+TGD    A                          M  +E
Sbjct: 537 RDDTAQTVSEARHLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSE 596

Query: 800 MVDIPPN-NVYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIAISSGTE 858
           + D   N + ++EV P  K + VE L+  G ++A  GDG+ND+ +L  +D GIA+   T+
Sbjct: 597 LADFVENADGFAEVFPQHKYRVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAVEGATD 656

Query: 859 VAIEAAGIVILNDPDTDEPTLKGVVNALDLSIRTFRRV 896
            A  AA IV L       P L  +++AL  S + F R+
Sbjct: 657 AARSAADIVFL------APGLSAIIDALKTSRQIFHRM 688

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score = 94.7 bits (234), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 126/518 (24%), Positives = 213/518 (41%), Gaps = 84/518 (16%)

Query: 435 GDIAMVKPGAKIPSDG-IVTKG-ISEVDESLMTGETNLVVKEIGSVVTGGTINGSGLIYF 492
           GDI  ++ G  IP+DG IVT+G   ++D+S +TGE+  V K  G      +    G  + 
Sbjct: 180 GDILQLEDGVIIPADGRIVTEGCFVQIDQSAITGESLAVDKRYGDATFSSSTVKRGEGFM 239

Query: 493 EVTSVGDDTKLANIIKVMKNAQLKKASIQRYTDYVASIFVPTVLILSLLTFIVWTS-LTR 551
            VT+ GD T +     ++  A    A    +T+ +  I    ++++ L   +V+ +   R
Sbjct: 240 IVTATGDSTFVGRAAALVNKAS---AGSGHFTEVLNGIGTILLILVILTLLVVYVACFYR 296

Query: 552 SEKIISKLSIFGETSESRFYMCLQIATSVVIVACPCALGLATPTAIMVGTGVASENGVLI 611
           S  I++                L+   ++ +V  P  L     T + VG    ++   ++
Sbjct: 297 SIDIVT---------------ILRYTLAITVVGVPVGLPAVVTTTMAVGAAYLAKKKAIV 341

Query: 612 KGGDVLEKFNEVNTFVFDKTGTLTTGHMTVQQ-FVGNAEMIKNLFYLEC----------- 659
           +    +E    V     DKTGTLT   +++ + +        +L    C           
Sbjct: 342 QKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVEADDLMLTACLAASRKKKGLD 401

Query: 660 -IERA--EALSDHPVSKAVVKYCRDLLGESFEGTS----MIIEDEQLITGKGIKCTVKAA 712
            I++A  ++L ++P +KA +   + L    F+  S     I+E  +   G+ I C VK A
Sbjct: 402 AIDKAFLKSLINYPRAKAALTKYKVLEFHPFDPVSKKVTAIVESPE---GERIVC-VKGA 457

Query: 713 DKTLRITVGNKSLMDEDSLGEFWQMYGRAGPCTVTYLAIDDKVC-GRFELL------DEV 765
              +  TV    L+ ED    +              L +  K   G +E+L      D  
Sbjct: 458 PLFVLKTVEENHLIPEDVKENYENKVAELASRGYRALGVARKRGEGHWEILGVMPCMDPP 517

Query: 766 KSDAKDVIRYLRNNNYEVFMVTGDTHKSA--------------------------MKVAE 799
           + D    +   R+    V M+TGD    A                          M  +E
Sbjct: 518 RDDTAQTVNEARHLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSE 577

Query: 800 MVDIPPN-NVYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIAISSGTE 858
           + D   N + ++EV P  K   VE L++ G ++A  GDG+ND+ +L  +D GIA+   T+
Sbjct: 578 LADFVENADGFAEVFPQHKYNVVEILQQRGYLVAMTGDGVNDAPSLKKADTGIAVEGATD 637

Query: 859 VAIEAAGIVILNDPDTDEPTLKGVVNALDLSIRTFRRV 896
            A  AA IV L       P L  +++AL  S + F R+
Sbjct: 638 AARSAADIVFL------APGLSAIIDALKTSRQIFHRM 669

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score = 94.4 bits (233), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 123/518 (23%), Positives = 211/518 (40%), Gaps = 84/518 (16%)

Query: 435 GDIAMVKPGAKIPSDG-IVTKG-ISEVDESLMTGETNLVVKEIGSVVTGGTINGSGLIYF 492
           G+I  ++ G   P+DG IVT+    ++D+S +TGE+    K  G  V   +   +G  + 
Sbjct: 228 GEILQLESGTIAPADGRIVTEDCFLQIDQSAITGESLAAEKHYGDEVFSSSTVKTGEAFM 287

Query: 493 EVTSVGDDTKLANIIKVMKNAQLKKASIQRYTDYVASIFVPTVLILSLLTFIVWTS-LTR 551
            VT+ GD+T +     ++  A   +       + +  I +  VL+++ L  +VWT+   R
Sbjct: 288 VVTATGDNTFVGRAAALVGQASGVEGHFTEVLNGIGIILL--VLVIATL-LLVWTACFYR 344

Query: 552 SEKIISKLSIFGETSESRFYMCLQIATSVVIVACPCALGLATPTAIMVGTGVASENGVLI 611
           +  I+S                L+    + I+  P  L     T + VG    ++   ++
Sbjct: 345 TVGIVS---------------ILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIV 389

Query: 612 KGGDVLEKFNEVNTFVFDKTGTLTTGHMTVQQ-FVGNAEMIKNLFYLEC----------- 659
           +    +E    V     DKTGTLT   +++ + +        +L    C           
Sbjct: 390 QKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSPDDLMLTACLAASRKKKGLD 449

Query: 660 -IERA--EALSDHPVSKAVVKYCRDLLGESFEGTS----MIIEDEQLITGKGIKCTVKAA 712
            I++A  ++L ++P +K  +   + L    F+  S     ++E  +   G+ I C VK A
Sbjct: 450 AIDKAFLKSLIEYPKAKDALTKYKVLEFHPFDPVSKKVTAVVESPE---GERIVC-VKGA 505

Query: 713 DKTLRITVGNKSLMDEDSLGEFWQMYGRAGPCTVTYLAIDDKVC-GRFELL------DEV 765
              +  TV     + ED    +              L +  K   G +E+L      D  
Sbjct: 506 PLFVLKTVEEDHPIPEDVHENYENKVAELASRGFRALGVARKRGEGHWEILGVMPCMDPP 565

Query: 766 KSDAKDVIRYLRNNNYEVFMVTGDTHKSA--------------------------MKVAE 799
           + D    I   RN    + M+TGD    A                          M  +E
Sbjct: 566 RDDTAQTINEARNLGLRIKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSE 625

Query: 800 MVDIPPN-NVYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIAISSGTE 858
           + D   N + ++EV P  K + VE L+  G ++A  GDG+ND+ +L  +D GIA+   T+
Sbjct: 626 LADFVENADGFAEVFPQHKYRVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAVEGATD 685

Query: 859 VAIEAAGIVILNDPDTDEPTLKGVVNALDLSIRTFRRV 896
            A  AA IV L       P L  +++AL  S + F R+
Sbjct: 686 AARSAADIVFL------APGLSAIIDALKTSRQIFHRM 717

>Scas_710.41
          Length = 904

 Score = 92.8 bits (229), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 127/532 (23%), Positives = 214/532 (40%), Gaps = 84/532 (15%)

Query: 421 DSITQEIGIELLEVGDIAMVKPGAKIPSDG-IVTKG-ISEVDESLMTGETNLVVKEIGSV 478
           D   QEI    +  GDI  +  G  IP+DG +VT+    +VD+S +TGE+  V K  G V
Sbjct: 172 DGTLQEIPANEIVPGDILELDEGTIIPADGRLVTENRFLQVDQSAITGESLAVDKNYGDV 231

Query: 479 VTGGTINGSGLIYFEVTSVGDDTKLANIIKVMKNAQLKKASIQRYTDYVASIFVPTVLIL 538
               +   +G     VT+ GD+T +     ++  A   +     +TD +  I    ++++
Sbjct: 232 TFSSSTVKTGTSVMVVTATGDNTFVGRAAALVGEASGGQG---HFTDILNDIGTILLVLV 288

Query: 539 SLLTFIVWTS-LTRSEKIISKLSIFGETSESRFYMCLQIATSVVIVACPCALGLATPTAI 597
            +   +VWT+   R++ I+               M L+    + I+  P  L     T +
Sbjct: 289 IITLLLVWTACFYRTDGIV---------------MILRFTLGITIIGVPVGLPAVVTTTM 333

Query: 598 MVGTGVASENGVLIKGGDVLEKFNEVNTFVFDKTGTLTTGHM------TVQQFVGNAEMI 651
            VG    ++   +++    +E    V     DKTGTLT   +      TV+    +  M+
Sbjct: 334 AVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSADDLML 393

Query: 652 -------KNLFYLECIERA--EALSDHPVSKAVVKYCRDLLGESFEGTS----MIIEDEQ 698
                  +    L+ I+RA  ++L+ +P +   +   + L    F+  S     +++  +
Sbjct: 394 TACLAATRKKKGLDAIDRAFLKSLNQYPKAMNALPKYKILEFHPFDPVSKKVTAVVKSPE 453

Query: 699 LITGKGIKCTVKAADKTLRITVGNKSLMDEDSLGEFWQMYGRAGPCTVTYLAIDDK---- 754
              G+ I C VK A   +  TV     + ED    +              L +  K    
Sbjct: 454 ---GETITC-VKGAPLFVLKTVEEDHPVPEDVHENYENKVAELASRGFRSLGVARKRGEG 509

Query: 755 ---VCGRFELLDEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSA----------------- 794
              + G    +D  + D    I   R     V M+TGD    A                 
Sbjct: 510 YWEILGVMPCMDPPRDDTARTIAEARTLGLRVKMLTGDAVGIAKETSRQLGLGVNIYNAE 569

Query: 795 ---------MKVAEMVDIPPN-NVYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLAL 844
                    M  +E+ D   N + ++EV P  K + VE L+  G ++A  GDG+ND+ +L
Sbjct: 570 KLGLGGGGDMPGSELADFVENADGFAEVFPQHKYKVVEILQNRGYLVAMTGDGVNDAPSL 629

Query: 845 VTSDLGIAISSGTEVAIEAAGIVILNDPDTDEPTLKGVVNALDLSIRTFRRV 896
             +D GIA+   T+ A  AA IV L       P L  +++ L  S + F R+
Sbjct: 630 KKADTGIAVEGATDAARSAADIVFL------APGLSAIIDGLKTSRQIFHRM 675

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score = 91.3 bits (225), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 123/518 (23%), Positives = 208/518 (40%), Gaps = 84/518 (16%)

Query: 435 GDIAMVKPGAKIPSDG-IVTKG-ISEVDESLMTGETNLVVKEIGSVVTGGTINGSGLIYF 492
           GDI  ++ G  IP+DG +VT+    ++D+S +TGE+  V K  G      +    G  + 
Sbjct: 180 GDILQLEDGVVIPADGRLVTEDCFIQIDQSAITGESLAVDKRFGDSTFSSSTVKRGEAFM 239

Query: 493 EVTSVGDDTKLANIIKVMKNAQLKKASIQRYTDYVASIFVPTVLILSLLTFIVW-TSLTR 551
            VT+ GD T +    +         A    +T+ +  I    ++++ +   +VW  S  R
Sbjct: 240 IVTATGDSTFVG---RAAALVNKAAAGSGHFTEVLNGIGTILLILVIVTLLLVWVASFYR 296

Query: 552 SEKIISKLSIFGETSESRFYMCLQIATSVVIVACPCALGLATPTAIMVGTGVASENGVLI 611
           + KI+                 L+   ++ IV  P  L     T + VG    ++   ++
Sbjct: 297 TNKIVR---------------ILRYTLAITIVGVPVGLPAVVTTTMAVGAAYLAKKQAIV 341

Query: 612 KGGDVLEKFNEVNTFVFDKTGTLTTGHMTVQQ-------------FVGNAEMIKNLFYLE 658
           +    +E    V     DKTGTLT   +++ +                     +    L+
Sbjct: 342 QKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVDPDDLMLTACLAASRKKKGLD 401

Query: 659 CIERA--EALSDHPVSKAVVKYCRDLLGESFEGTS----MIIEDEQLITGKGIKCTVKAA 712
            I++A  ++L  +P +KA +   + L    F+  S     I+E  +   G+ I C VK A
Sbjct: 402 AIDKAFLKSLISYPRAKAALTKYKLLEFHPFDPVSKKVTAIVESPE---GERIIC-VKGA 457

Query: 713 DKTLRITVGNKSLMDEDSLGEFWQMYGRAGPCTVTYLAIDDKVC-GRFELL------DEV 765
              +  TV  +  + ED    +              L +  K   G +E+L      D  
Sbjct: 458 PLFVLKTVEEEHPIPEDVRENYENKVAELASRGFRALGVARKRGEGHWEILGVMPCMDPP 517

Query: 766 KSDAKDVIRYLRNNNYEVFMVTGDTHKSA--------------------------MKVAE 799
           + D    +   R+    V M+TGD    A                          M  +E
Sbjct: 518 RDDTAQTVNEARHLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSE 577

Query: 800 MVDIPPN-NVYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIAISSGTE 858
           + D   N + ++EV P  K   VE L++ G ++A  GDG+ND+ +L  +D GIA+   T+
Sbjct: 578 LADFVENADGFAEVFPQHKYNVVEILQQRGYLVAMTGDGVNDAPSLKKADTGIAVEGATD 637

Query: 859 VAIEAAGIVILNDPDTDEPTLKGVVNALDLSIRTFRRV 896
            A  AA IV L       P L  +++AL  S + F R+
Sbjct: 638 AARSAADIVFL------APGLSAIIDALKTSRQIFHRM 669

>Scas_688.1
          Length = 913

 Score = 90.1 bits (222), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 126/541 (23%), Positives = 224/541 (41%), Gaps = 85/541 (15%)

Query: 435 GDIAMVKPGAKIPSDG-IVTKG-ISEVDESLMTGETNLVVKEIGSVVTGGTINGSGLIYF 492
           GDI  ++ G  IP+DG IVT+    ++D+S +TGE+    K  G      +    G  + 
Sbjct: 194 GDILQLEDGVIIPADGRIVTEDCFVQIDQSAITGESLAADKHYGDQTFSSSTVKRGEAFM 253

Query: 493 EVTSVGDDTKLANIIKVMKNAQLKKASIQRYTDYVASIFVPTVLILSLLTFIVWT-SLTR 551
            +T+ GD+T +     ++  A   +     +T+ +  I +  ++++ +   +VWT S  R
Sbjct: 254 VITATGDNTFVGRAAALVNKASGGQG---HFTEVLNGIGIILLVLVIVTLLLVWTASFYR 310

Query: 552 SEKIISKLSIFGETSESRFYMCLQIATSVVIVACPCALGLATPTAIMVGTGVASENGVLI 611
           ++ I+                 L+    + IV  P  L     T + VG    ++   ++
Sbjct: 311 TDGIVR---------------ILRYTLGITIVGVPVGLPAVVTTTMAVGAAYLAKKQAIV 355

Query: 612 KGGDVLEKFNEVNTFVFDKTGTLTTGHM------TVQQFVGNAEMI-------KNLFYLE 658
           +    +E    V     DKTGTLT   +      TV+    +  M+       +    L+
Sbjct: 356 QKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSADDLMLTACLAASRKKKGLD 415

Query: 659 CIERA--EALSDHPVSKAVVKYCRDLLGESFEGTS----MIIEDEQLITGKGIKCTVKAA 712
            I++A  ++L+ +P +K  +   + L    F+  S     ++E  +   G+ I C VK A
Sbjct: 416 AIDKAFLKSLAQYPAAKNALTKYKVLEFHPFDPVSKKVTAVVESPE---GERIIC-VKGA 471

Query: 713 DKTLRITVGNKSLMDEDSLGEFWQMYGRAGPCTVTYLAIDDKVC-GRFELL------DEV 765
              +  TV     + ED    +              L +  K   G +E+L      D  
Sbjct: 472 PLFVLKTVEEDHPIPEDIHENYENKVAELASRGFRALGVARKRGEGHWEILGVMPCMDPP 531

Query: 766 KSDAKDVIRYLRNNNYEVFMVTGDTHKSA--------------------------MKVAE 799
           + D  + +   R     V M+TGD    A                          M  +E
Sbjct: 532 RDDTGETVAEARRLGLRVKMLTGDAVGIAKETCRQLGLGTNVYNAERLGLSGGGDMPGSE 591

Query: 800 MVDIPPN-NVYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIAISSGTE 858
           + D   N + ++EV P  K + VE L+  G ++A  GDG+ND+ +L  +D GIA+   T+
Sbjct: 592 LADFVENADGFAEVFPQDKYRVVEILQTRGYLVAMTGDGVNDAPSLKKADTGIAVEGATD 651

Query: 859 VAIEAAGIVILNDPDTDEPTLKGVVNALDLSIRTFRRVKLNLFWALCYNVFMLPIAMGIL 918
            A  AA IV L       P L  +++AL  S + F R+   + + +  ++  L I +G+ 
Sbjct: 652 AARSAADIVFL------APGLSAIIDALKTSRQIFHRMYSYVVYRIALSIH-LEIFLGLW 704

Query: 919 V 919
           +
Sbjct: 705 I 705

>Kwal_47.17522
          Length = 899

 Score = 85.9 bits (211), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 117/518 (22%), Positives = 207/518 (39%), Gaps = 84/518 (16%)

Query: 435 GDIAMVKPGAKIPSDG--IVTKGISEVDESLMTGETNLVVKEIGSVVTGGTINGSGLIYF 492
           GDI  ++ G  I +DG  +  +   ++D+S +TGE+  V K  G      +    G  + 
Sbjct: 180 GDIMQLEDGVVICADGRLVTEECFLQIDQSAITGESLAVDKHYGDTTFSSSTVKRGEGFM 239

Query: 493 EVTSVGDDTKLANIIKVMKNAQLKKASIQRYTDYVASIFVPTVLILSLLTFIVWTS-LTR 551
            VT+ GD+T +     ++  A   +     +T+ +  I    ++++ +   +VWT+   R
Sbjct: 240 IVTATGDNTFVGRAAALVNQAAGDQG---HFTEVLNGIGTILLVLVIVTLLLVWTACFYR 296

Query: 552 SEKIISKLSIFGETSESRFYMCLQIATSVVIVACPCALGLATPTAIMVGTGVASENGVLI 611
           +++I+                 L+    + I+  P  L     T + VG    ++   ++
Sbjct: 297 TDRIVR---------------ILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIV 341

Query: 612 KGGDVLEKFNEVNTFVFDKTGTLTTGHMTVQQ-FVGNAEMIKNLFYLEC----------- 659
           +    +E    V     DKTGTLT   +++ + +        +L    C           
Sbjct: 342 QKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVEPDDLMLTACLAASRKKKGLD 401

Query: 660 -IERA--EALSDHPVSKAVVKYCRDLLGESFEGTS----MIIEDEQLITGKGIKCTVKAA 712
            I++A  ++L  +P +K  +   + L    F+  S     ++E  +   G+ I C VK A
Sbjct: 402 AIDKAFLKSLIQYPRAKNALTKYKVLDFHPFDPVSKKVTAVVESPE---GERIIC-VKGA 457

Query: 713 DKTLRITVGNKSLMDEDSLGEFWQMYGRAGPCTVTYLAIDDKVC-GRFELL------DEV 765
              +  TV     + ED    +              L +  K   G +E+L      D  
Sbjct: 458 PLFVLKTVEEDHPIPEDVHENYENKVAELASRGFRALGVARKRGEGHWEILGVMPCMDPP 517

Query: 766 KSDAKDVIRYLRNNNYEVFMVTGDTHKSA--------------------------MKVAE 799
           + D    +   R     V M+TGD    A                          M  +E
Sbjct: 518 RDDTAQTVHEARRLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSE 577

Query: 800 MVDIPPN-NVYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIAISSGTE 858
           + D   N + ++EV P  K   VE L++ G ++A  GDG+ND+ +L  +D GIA+   T+
Sbjct: 578 LADFVENADGFAEVFPQHKYSVVEILQQRGYLVAMTGDGVNDAPSLKKADTGIAVEGATD 637

Query: 859 VAIEAAGIVILNDPDTDEPTLKGVVNALDLSIRTFRRV 896
            A  AA IV L       P L  +++AL  S + F R+
Sbjct: 638 AARSAADIVFL------APGLSAIIDALKTSRQIFHRM 669

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 122/518 (23%), Positives = 213/518 (41%), Gaps = 84/518 (16%)

Query: 435 GDIAMVKPGAKIPSDG-IVTKG-ISEVDESLMTGETNLVVKEIGSVVTGGTINGSGLIYF 492
           GDI  ++ G  IP+DG +VT+    +VD+S +TGE+  V K  G      +    G  + 
Sbjct: 183 GDILQLEDGTIIPADGRLVTENCFLQVDQSAITGESLAVDKGYGDQTFSSSTVKRGEAFM 242

Query: 493 EVTSVGDDTKLANIIKVMKNAQLKKASIQRYTDYVASIFVPTVLILSLLTFIVWTS-LTR 551
            VT+ GD+T +     ++  A   +     +T+ +  I +  ++++ +    VW +   R
Sbjct: 243 VVTATGDNTFVGRAAALVNKASGGQG---HFTEVLNGIGILLLVLVIVTLLGVWAACFYR 299

Query: 552 SEKIISKLSIFGETSESRFYMCLQIATSVVIVACPCALGLATPTAIMVGTGVASENGVLI 611
           ++ I+  L         RF +       + I+  P  L     T + VG    ++   ++
Sbjct: 300 TDNIVKIL---------RFTL------GITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIV 344

Query: 612 KGGDVLEKFNEVNTFVFDKTGTLTTGHM------TVQQFVGNAEMIKNLFY-------LE 658
           +    +E    V     DKTGTLT   +      TV+    +  M+            L+
Sbjct: 345 QKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSADDLMLTACLAASRKKKGLD 404

Query: 659 CIERA--EALSDHPVSKAVVKYCRDLLGESFEGTS----MIIEDEQLITGKGIKCTVKAA 712
            I++A  ++L ++P +K  +   + +    F+  S     ++E  +   G+ I C VK A
Sbjct: 405 AIDKAFLKSLINYPKAKDALTKYKVIEFHPFDPVSKKVTAVVESPE---GERIVC-VKGA 460

Query: 713 DKTLRITVGNKSLMDEDSLGEFWQMYGRAGPCTVTYLAIDDKVC-GRFELL------DEV 765
              +  TV     + ED    +              L +  K   G +E+L      D  
Sbjct: 461 PLFVLKTVEEDHPIPEDVHENYENKVAELASRGFRALGVARKRGEGHWEILGVMPCMDPP 520

Query: 766 KSDAKDVIRYLRNNNYEVFMVTGDTHKSA--------------------------MKVAE 799
           + D  + +   R     V M+TGD    A                          M  +E
Sbjct: 521 RDDTAETVNEARRLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSE 580

Query: 800 MVDIPPN-NVYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIAISSGTE 858
           + D   N + ++EV P  K + VE L+  G ++A  GDG+ND+ +L  +D GIA+   ++
Sbjct: 581 LADFVENADGFAEVFPQHKYKVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAVEGASD 640

Query: 859 VAIEAAGIVILNDPDTDEPTLKGVVNALDLSIRTFRRV 896
            A  AA IV L       P L  +++AL  S + F R+
Sbjct: 641 AARSAADIVFL------APGLSAIIDALKTSRQIFHRM 672

>Scas_707.48*
          Length = 741

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 59/231 (25%), Positives = 105/231 (45%), Gaps = 44/231 (19%)

Query: 714 KTLRITVGNKSLMDE--DSLG-EFWQMYGRA------GPCTVTYLAIDDKV-CGRFELLD 763
           KT ++T G + ++ E  +SL  E  +M   A       P  +T  ++ D +  G   + D
Sbjct: 514 KTEKLTQGQRDVIIETANSLASEGLRMLAFAKTTLPDSPTLLTEESVGDLIFTGLIGMND 573

Query: 764 EVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIP---PN-------------- 806
             +   K  I  L      + M+TGD+  +A+ +A  + IP   P               
Sbjct: 574 PPRPTVKPAIEQLLQGGVHIIMITGDSENTAVNIARQIGIPVLDPKLSVLSGDKLNEMSD 633

Query: 807 ----------NVYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIAISS- 855
                     N+++  TP+ K   V  LR+ G V+A  GDG+ND+ AL  +D+G+++   
Sbjct: 634 DQLANVIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLADIGVSMGRM 693

Query: 856 GTEVAIEAAGIVILNDPDTDEPTLKGVVNALDLSIRTFRRVKLNLFWALCY 906
           GT+VA EA+ +V+ +D          ++ A++     F  ++  L + LC+
Sbjct: 694 GTDVAKEASDMVLTDD------DFSTILTAIEEGKGIFNNIQNFLTFQLCW 738

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 56/238 (23%), Positives = 95/238 (39%), Gaps = 51/238 (21%)

Query: 435 GDIAMVKPGAKIPSDGIVTKGIS-EVDESLMTGETNLVVKE------------------- 474
           GD+   K G +IP+D  + + +   +DES +TGE   V K                    
Sbjct: 172 GDLVHFKIGDRIPADLRIIEAVDLSIDESNLTGENEPVHKSAKEVNKDSFNDQPNSIIPI 231

Query: 475 --------IGSVVTGGTINGSGLIYFEVTSVGDDTKLANIIKVMKNAQLKKASIQRYTDY 526
                   +G++V  G  +G G+    V  +G +T    I +++ N +  K  +Q   D 
Sbjct: 232 SDRTCVAYMGTLVKEG--HGKGI----VVGIGKNTSFGAIFEMLSNIEKPKTPLQNAMDK 285

Query: 527 VASIFVPTVLILSLLTFIVWTSLTRSEKIISKLSIFGETSESRFYMCLQIATSVVIVACP 586
           +          LSL +FIV          I  + + G      +    QI+ S+ + A P
Sbjct: 286 LGKD-------LSLFSFIV----------IGLICLVGILQGRSWLEMFQISVSLAVAAIP 328

Query: 587 CALGLATPTAIMVGTGVASENGVLIKGGDVLEKFNEVNTFVFDKTGTLTTGHMTVQQF 644
             L +     + +G    ++   +++    +E    VN    DKTGTLT+ HMT  + 
Sbjct: 329 EGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTASKI 386

>CAGL0J01870g 181666..184506 highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1, hypothetical
           start
          Length = 946

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 92/201 (45%), Gaps = 35/201 (17%)

Query: 757 GRFELLDEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVD-------------- 802
           G F L D  + + K  I  L      + M+TGD+  +A+ +AE +               
Sbjct: 570 GLFGLADPPRPNVKASIEKLHRGGVHIIMITGDSVNTAVSIAEKIGLSVQDRESSVMTGD 629

Query: 803 -------------IPPNNVYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDL 849
                        I   N+++  TP+ K   V+ LR+ G ++A  GDG+ND+ AL  +D+
Sbjct: 630 KVSELTEDELSKVIDKVNIFARATPENKLNIVKALRKRGDIVAMTGDGVNDAPALKLADI 689

Query: 850 GIAIS-SGTEVAIEAAGIVILNDPDTDEPTLKGVVNALDLSIRTFRRVKLNLFWALCYNV 908
           GIA+  SGT+VA E + +++ +D          ++ A++     F  ++  L + L  +V
Sbjct: 690 GIAMGISGTDVAKEVSDMILTDD------DFSSILTAIEEGKGIFNNIRNFLTFQLSISV 743

Query: 909 FMLP-IAMGILVPWGITLHPM 928
             L  IA+  +      L+PM
Sbjct: 744 ATLSLIAITTIAKLPAPLNPM 764

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 60/254 (23%), Positives = 102/254 (40%), Gaps = 39/254 (15%)

Query: 410 PSSCIIVDKDDDSITQEIGIELLEVGDIAMVKPGAKIPSDGIVTKGIS-EVDESLMTGET 468
           P+ C ++    +S T  +  EL+  GD+   K G +IP+D  + + +   +DES +TGET
Sbjct: 160 PTKCHLIRYGRESNT--LASELVP-GDLVRFKIGDRIPADVRIIEAVDLSIDESNLTGET 216

Query: 469 ------------------NLVVKEIGSVVTGGTINGSGLIYFEVTSVGDDTKLANIIKVM 510
                             N+ V E   +   GT+   G     V   G +T    I +++
Sbjct: 217 EPLHKDAQTIDPEEYDNRNVPVSERSCIAYMGTLVKEGHGKGIVIGTGTNTSYGAIFEMV 276

Query: 511 KNAQLKKASIQRYTDYVASIFVPTVLILSLLTFIVWTSLTRSEKIISKLSIFGETSESRF 570
            + +  K  +Q   D +              T + + S      I     I G +     
Sbjct: 277 NSIEKPKTPLQETMDRLG-------------TELSYISFFIIAIISIVGIIRGNS----L 319

Query: 571 YMCLQIATSVVIVACPCALGLATPTAIMVGTGVASENGVLIKGGDVLEKFNEVNTFVFDK 630
            M  Q++ S+ + A P  L +     + +G    ++   +++    +E    VN    DK
Sbjct: 320 LMMFQVSVSLAVAAIPEGLPIIVTVTLALGVLRMTKQNAIVRRLPSVETLGSVNVICTDK 379

Query: 631 TGTLTTGHMTVQQF 644
           TGTLTT HMTV + 
Sbjct: 380 TGTLTTNHMTVSKL 393

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
           Ca2+-transporting P-type ATPase of Golgi membrane
           involved in Ca2+ and Mn2+ import into Golgi [2853 bp,
           950 aa]
          Length = 950

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 68/137 (49%), Gaps = 28/137 (20%)

Query: 763 DEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIP---PN------------- 806
           D  + + K  I  L      + M+TGD+  +A+ +A+ + IP   P              
Sbjct: 580 DPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGIPVIDPKLSVLSGDKLDEMS 639

Query: 807 -----------NVYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIAISS 855
                      N+++  TP+ K   V  LR+ G V+A  GDG+ND+ AL  SD+G+++  
Sbjct: 640 DDQLANVIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGR 699

Query: 856 -GTEVAIEAAGIVILND 871
            GT+VA EA+ +V+ +D
Sbjct: 700 IGTDVAKEASDMVLTDD 716

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 96/238 (40%), Gaps = 51/238 (21%)

Query: 435 GDIAMVKPGAKIPSDGIVTKGIS-EVDESLMTGETNLVVKE------------------- 474
           GD+   + G +IP+D  + + I   +DES +TGE   V K                    
Sbjct: 172 GDLVHFRIGDRIPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPI 231

Query: 475 --------IGSVVTGGTINGSGLIYFEVTSVGDDTKLANIIKVMKNAQLKKASIQRYTDY 526
                   +G++V  G  +G G+    V   G +T    + ++M N +  K  +Q   D 
Sbjct: 232 SERSCIAYMGTLVKEG--HGKGI----VVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDK 285

Query: 527 VASIFVPTVLILSLLTFIVWTSLTRSEKIISKLSIFGETSESRFYMCLQIATSVVIVACP 586
           +          LSL++FIV          I  + + G      +    QI+ S+ + A P
Sbjct: 286 LGKD-------LSLVSFIV----------IGMICLVGIIQGRSWLEMFQISVSLAVAAIP 328

Query: 587 CALGLATPTAIMVGTGVASENGVLIKGGDVLEKFNEVNTFVFDKTGTLTTGHMTVQQF 644
             L +     + +G    ++   +++    +E    VN    DKTGTLT+ HMTV + 
Sbjct: 329 EGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKL 386

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
           complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 68/143 (47%), Gaps = 28/143 (19%)

Query: 757 GRFELLDEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIP---PN------- 806
           G   + D  +S  +  I  L      V M+TGD   +A+ +A  + IP   P        
Sbjct: 581 GLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPVINPEISVLTGD 640

Query: 807 -----------------NVYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDL 849
                            N+++  TP+ K   V  L++ G ++A  GDG+ND+ AL  +D+
Sbjct: 641 RLDQMTDDQLAGVIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADI 700

Query: 850 GIAISS-GTEVAIEAAGIVILND 871
           G+A+   GT+VA EA+ +V+ +D
Sbjct: 701 GVAMGHMGTDVAKEASDMVLTDD 723

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 60/253 (23%), Positives = 96/253 (37%), Gaps = 49/253 (19%)

Query: 435 GDIAMVKPGAKIPSD-GIVTKGISEVDESLMTGETNLVVKEIGSV-------VTGGTI-- 484
           GD+   K G +IP+D  I+      +DES +TGET  V K    V       V GG I  
Sbjct: 178 GDLVYFKVGDRIPADVRIIESTDLSLDESTLTGETEPVHKSCTPVNSATYSDVPGGIIPI 237

Query: 485 ----------------NGSGLIYFEVTSVGDDTKLANIIKVMKNAQLKKASIQRYTDYVA 528
                           +G G+    V + G  T    + ++M + +  K  +Q   D + 
Sbjct: 238 GERTSIAYMGTLVREGHGKGI----VVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLR 293

Query: 529 SIFVPTVLILSLLTFIVWTSLTRSEKIISKLSIFGETSESRFYMCLQIATSVVIVACPCA 588
                   +LS + F++     RS                 +    QI+ S+ + A P  
Sbjct: 294 RDLSYVRFVLSGIIFLLGVIQGRS-----------------WLEMFQISVSLAVAAIPEG 336

Query: 589 LGLATPTAIMVGTGVASENGVLIKGGDVLEKFNEVNTFVFDKTGTLTTGHMTVQQF--VG 646
           L +     + +G    +    +++    +E    VN    DKTGTLT  HMT  +   +G
Sbjct: 337 LPIIVTVTLALGVLRMANRKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTASKIWCLG 396

Query: 647 NAEMIKNLFYLEC 659
           +     N+  LE 
Sbjct: 397 SMANKNNVLSLEA 409

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 951

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 65/137 (47%), Gaps = 28/137 (20%)

Query: 763 DEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIP---PN------------- 806
           D  +S  K  I         + M+TGD+  +A+ +A  + IP   P              
Sbjct: 581 DPPRSSVKFAIDQFLQGGIHIIMITGDSENTAVNIARQIGIPVIDPKLSVLSGDKLNEMT 640

Query: 807 -----------NVYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIAISS 855
                      N+++  TP+ K   V  LR  G V+A  GDG+ND+ AL  +D+G+++  
Sbjct: 641 DDQLANVIDHVNIFARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGR 700

Query: 856 -GTEVAIEAAGIVILND 871
            GT+VA EA+ +++ +D
Sbjct: 701 MGTDVAKEASDMILTDD 717

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 97/238 (40%), Gaps = 53/238 (22%)

Query: 435 GDIAMVKPGAKIPSD-GIVTKGISEVDESLMTGETNLVVKE------------------- 474
           GD+   + G +IP+D  I+      +DES +TGET+ V K                    
Sbjct: 180 GDLVRFRIGDRIPADIRIIECNDLTIDESNLTGETDPVHKSYKALSRDSYNDQPNSIVPV 239

Query: 475 --------IGSVVTGGTINGSGLIYFEVTSVGDDTKLANIIKVMKNAQLKKASIQRYTDY 526
                   +G++V  G  NG G+    V   G +T   N+ ++M + +  K  +Q   D 
Sbjct: 240 AERTNIAYMGTLVKEG--NGRGI----VVGTGRETSFGNVFEMMSSIEKPKTPLQLTMDK 293

Query: 527 VASIFVPTVLILSLLTFIVWTSLTRSEKIISKLSIFGETSESRFYM-CLQIATSVVIVAC 585
           +          LSL +F+V   +                 + R ++   QI+ S+ + A 
Sbjct: 294 LGKD-------LSLASFVVIGIICVVG-----------IIQGRSWLEMFQISVSLAVAAI 335

Query: 586 PCALGLATPTAIMVGTGVASENGVLIKGGDVLEKFNEVNTFVFDKTGTLTTGHMTVQQ 643
           P  L +     + +G    ++   +++    +E    VN    DKTGTLT+ HMTV +
Sbjct: 336 PEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSK 393

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
           Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 68/143 (47%), Gaps = 28/143 (19%)

Query: 757 GRFELLDEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIP---PN------- 806
           G   + D  +   +  I  L   +  V M+TGD   +A+ +A  + IP   P        
Sbjct: 562 GLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIGIPVINPEYSVLSGD 621

Query: 807 -----------------NVYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDL 849
                            NV++  TP+ K   V  L++ G ++A  GDG+ND+ AL  +D+
Sbjct: 622 KLDQMTDDQLASVIDHVNVFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADI 681

Query: 850 GIAISS-GTEVAIEAAGIVILND 871
           G+++   GT+VA EA+ +V+ +D
Sbjct: 682 GVSMGKMGTDVAKEASDMVLTDD 704

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 56/236 (23%), Positives = 93/236 (39%), Gaps = 49/236 (20%)

Query: 435 GDIAMVKPGAKIPSDGIVTKGISE-VDESLMTGETNLVVKEIGSV-------VTGGTI-- 484
           GD+   K G +IP+D  + + I   VDES +TGE   V K  G+V       + G  I  
Sbjct: 167 GDLVRFKVGDRIPADLRIVESIDLCVDESNLTGENEPVHKSSGAVDPKNYSHIPGSIIPV 226

Query: 485 ----------------NGSGLIYFEVTSVGDDTKLANIIKVMKNAQLKKASIQRYTDYVA 528
                           +G G+    V + G  T   ++ ++M      K  +Q   D + 
Sbjct: 227 GDRNCIGFMGTLVREGHGKGI----VIATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLG 282

Query: 529 SIFVPTVLILSLLTFIVWTSLTRSEKIISKLSIFGETSESRFYM-CLQIATSVVIVACPC 587
                    LS ++F++   +                 + R ++   QIA S+ + A P 
Sbjct: 283 QD-------LSYMSFVLIGIICLIG-----------IIQGRSWLEMFQIAVSLAVAAIPE 324

Query: 588 ALGLATPTAIMVGTGVASENGVLIKGGDVLEKFNEVNTFVFDKTGTLTTGHMTVQQ 643
            L +     + +G    ++   +++    +E    VN    DKTGTLT  HMTV +
Sbjct: 325 GLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTVSK 380

>Kwal_14.1498
          Length = 939

 Score = 63.2 bits (152), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 68/144 (47%), Gaps = 28/144 (19%)

Query: 756 CGRFELLDEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIP---PN------ 806
            G   + D  +   K  +  L   +  + M+TGD   +A+ +A  + IP   P       
Sbjct: 562 AGLLGMNDPPRPSVKAAVERLSEGSVHIIMITGDAENTAVSIARQIGIPVVNPETAVLTG 621

Query: 807 ------------------NVYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSD 848
                             N+++  TP+ K   V  L++ G ++A  GDG+ND+ AL  +D
Sbjct: 622 DKLDHMSEDQLASIIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLAD 681

Query: 849 LGIAISS-GTEVAIEAAGIVILND 871
           +G+++   GT+VA EA+ +V+ +D
Sbjct: 682 IGVSMGKMGTDVAKEASDMVLTDD 705

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/231 (22%), Positives = 91/231 (39%), Gaps = 39/231 (16%)

Query: 435 GDIAMVKPGAKIPSDGIVTKGIS-EVDESLMTGETNLVVK------------EIGSVVT- 480
           GD+   + G +IP+D  + + +   ++ES +TGE   V K             +GS+V  
Sbjct: 167 GDVVRFRVGDRIPADLRIIEAVDLSIEESNLTGENEPVHKSTATVNKEFYKENLGSIVPV 226

Query: 481 --------GGTINGSGLIYFEVTSVGDDTKLANIIKVMKNAQLKKASIQRYTDYVASIFV 532
                    GT+   G     V     +T    + ++M   +  K  +Q   D +     
Sbjct: 227 SERSCIAFMGTLVREGHGRGIVIGTAKNTAFGKVFEMMNAIEKPKTPLQTAMDKLGKD-- 284

Query: 533 PTVLILSLLTFIVWTSLTRSEKIISKLSIFGETSESRFYMCLQIATSVVIVACPCALGLA 592
                LS ++FIV          I  + + G      +    QI+ S+ + A P  L + 
Sbjct: 285 -----LSFMSFIV----------IGIICLIGVIQGRSWLEMFQISVSLAVAAIPEGLPII 329

Query: 593 TPTAIMVGTGVASENGVLIKGGDVLEKFNEVNTFVFDKTGTLTTGHMTVQQ 643
               + +G    ++   +I+    +E    VN    DKTGTLT  HM+V +
Sbjct: 330 VTVTLALGVLRMAKRRAIIRRLPSVETLGSVNVICSDKTGTLTANHMSVNK 380

>Kwal_47.17547
          Length = 1240

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 78/289 (26%), Positives = 123/289 (42%), Gaps = 39/289 (13%)

Query: 427 IGIELLEVGDIAMVKPGAKIPSDGIVTKGISEVDESLMTGETNLVVK------------- 473
           I I  + VGDI  ++ G  +P+D I+ KG  E DES +TGE+  + K             
Sbjct: 199 ISIHDILVGDILSLQTGDVVPADCILVKGSCECDESALTGESATIKKAAIDVCYEKYKQL 258

Query: 474 -------EIGS---------VVTGGTINGSGLIYFEVTSVGDDTKLANIIKVMKNAQLKK 517
                  +IG+         ++  G+   SGL    VTSVG ++     +  +K  + + 
Sbjct: 259 SATDAAIDIGTPGAEKVPDPMLISGSKLLSGLGRAVVTSVGVNSMHGRTLMALK-VEAET 317

Query: 518 ASIQRYTDYVA-SIFVPTVLILSLLTFIVWTSLTRSEKIISKLSIFGETSE-SRFYMCLQ 575
             +Q   D +A SI V       LL FI++     + K   +L       + SRF     
Sbjct: 318 TPLQERLDSLANSISVYGSAAALLLFFILFMRFLANLKKGGELHDLTPAQKGSRFMNIFI 377

Query: 576 IATSVVIVACPCALGLATPTAIMVGTGVASENGVLIKGGDVLEKFNEVNTFVFDKTGTLT 635
           +  +V++VA P  L LA   A+   T   +++G L++     E          DKTGTLT
Sbjct: 378 VGITVIVVAVPEGLPLAVTLALAFATTRMAKDGNLVRVLRACETMGSATAVCSDKTGTLT 437

Query: 636 TGHMT-VQQFVGNAEMIKNLFYLECIERAEALSDHPVSKAVVKYCRDLL 683
              MT V+ F+G+       F+ E      + S+  V  A+   C + L
Sbjct: 438 ENRMTVVKGFLGST------FFDEAESVGPSDSETDVDLAIANECSEEL 480

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 61/110 (55%), Gaps = 14/110 (12%)

Query: 799 EMVDIPPN-NVYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIAIS-SG 856
           E V I PN  V +  +P+ K   VE L++ G V+A  GDG ND+ AL  +D+G ++  +G
Sbjct: 790 ERVRILPNLRVLARSSPEDKRILVETLKKMGDVVAVTGDGTNDAPALKLADVGFSMGIAG 849

Query: 857 TEVAIEAAGIVILNDPDTDEPTLKGVVNALDL------SIRTFRRVKLNL 900
           TEVA EA+ I+++ D          +VNA+        SI+ F + +L +
Sbjct: 850 TEVAREASDIILMTD------DFSAIVNAIKWGRCVSTSIKKFIQFQLTV 893

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
           cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
           efflux, start by similarity
          Length = 1082

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 129/535 (24%), Positives = 208/535 (38%), Gaps = 89/535 (16%)

Query: 410 PSSCIIVDKDDDSITQEIGIELLEVGDIAMVKPGAKIPSDGIVTKGIS-EVDESLMTGET 468
           PS+ +I D +D +I  +   EL+  GDI ++K G  +P+D  + + I+ E DE+L+TGE+
Sbjct: 130 PSAHVIRDGNDITIQSK---ELVP-GDICIIKVGDTVPADLRLLESINLETDEALLTGES 185

Query: 469 NLVVKEIGSVVTGGTINGSGL-IYFEVTSVGDDTKLANIIKVMKNAQLKK--ASIQRYTD 525
             V K    V    T  G  L + F  ++V        +IK   N ++ K   S++  T 
Sbjct: 186 LPVAKSHSEVYEKDTPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKSETS 245

Query: 526 YVA----SIFVPTVLIL------SLLTFIVWTSLTRSEKIISKLSIF----------GET 565
           +++      F   + I       S L   V T L R    +S+L+I              
Sbjct: 246 FISKDENKSFGQNLWITLKETIGSFLGTNVGTPLHRK---LSQLAILLFVVAVIFAIVVM 302

Query: 566 SESRFYMCLQIATSVVIVA---CPCALGLATPTAIMVGTGVASENGVLIKGGDVLEKFNE 622
              ++ +  Q+A   + VA    P +L +     +  G  V +   V+++  D LE    
Sbjct: 303 GTQKYRVNKQVAIYAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGA 362

Query: 623 VNTFVFDKTGTLTTGHMTVQQFVGNAEMIKNLFYLECIERAEALSD-----HPVSK-AVV 676
           VN    DKTGTLT G M  +Q       I     +   E  E  +      H + K +  
Sbjct: 363 VNDICSDKTGTLTQGKMIAKQV-----WIPQFGTITVQESNEPFNPTIGEIHLIPKFSPY 417

Query: 677 KYCRDLLGESFEGTSMIIED--EQLITGKGIKCTVKAADKTLRI-TVGNKSLMDEDSLGE 733
           +Y  D      E    II D   + + G+     V   D+ L   T+ N + + +DS  +
Sbjct: 418 QYKHDD-----EEDVGIIPDFKSKYLAGELGPLNVSLFDQWLYTATLANIATVFQDSETQ 472

Query: 734 FWQMYGRAGPCTVTYLAIDDKVCGRFELLDEVKSDAKDVIRYLRNNNYE-----VFMVTG 788
            W+ +G      +   A    +  R  L  E K D KD      N+++E      F  + 
Sbjct: 473 DWKAHGDPTEIAIQVFATRMDL-PRHVLTGEDKDDEKDA---RANSSFEHVAEFPFDSSV 528

Query: 789 DTHKSAMKVAEMVDIPPNNVYSE--------------VTPDGK------------SQTVE 822
               +  K  E    P   V+++               TPDGK             + V+
Sbjct: 529 KRMSAIYKNTEDPATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVD 588

Query: 823 YLREEG-RVIAFIGDGINDSLALVTSDLGIAISSGTEVAIEAAGIVILNDPDTDE 876
            L  EG RV+AF     N+S      D  +      E  +   G++ + DP   E
Sbjct: 589 TLSSEGLRVLAFAKKSFNESEFNANKDKLLKERDFVECKLTFLGLIGIYDPPRQE 643

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 83/201 (41%), Gaps = 49/201 (24%)

Query: 744 CTVTYLAIDDKVCGRFELLDEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDI 803
           C +T+L       G   + D  + ++   ++        V M+TGD   +A  +A+ V I
Sbjct: 626 CKLTFL-------GLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGI 678

Query: 804 PPNNVY-----------------------------------SEVTPDGKSQTVEYLREEG 828
            P+N+Y                                   +   P  K + +E L    
Sbjct: 679 LPHNLYHYPKEVVNFMVMAATDFDALSDQEIDDLRVLPLVIARCAPQTKVRMIEALHRRS 738

Query: 829 RVIAFIGDGINDSLALVTSDLGIAIS-SGTEVAIEAAGIVILNDPDTDEPTLKGVVNALD 887
           +  A  GDG+NDS +L  +++GIA+  +G++VA +A+ IV+ +D          ++NA++
Sbjct: 739 KFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDD------NFASILNAVE 792

Query: 888 LSIRTFRRVKLNLFWALCYNV 908
              R    ++  +   L  NV
Sbjct: 793 EGRRMSDNIQKFVLQLLAENV 813

>Kwal_23.3160
          Length = 1100

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 66/260 (25%), Positives = 118/260 (45%), Gaps = 30/260 (11%)

Query: 410 PSSCIIVDKDDDSITQEIGIELLEVGDIAMVKPGAKIPSDGIVTKGIS-EVDESLMTGET 468
           PS+ +I D +D++I  +     L  GD+ +VK G  +P+D  + + ++ E DE+L+TGE+
Sbjct: 134 PSAHVIRDGNDETIPSK----QLVPGDLCVVKAGDTVPADLRLIECVNFETDEALLTGES 189

Query: 469 NLVVKEIGSV--VTGGTINGSGL-IYFEVTSVGDDTKLANIIKVMKNAQLKKAS------ 519
             + KE   V   T  T  G  L + F  ++V        ++K   N ++ K +      
Sbjct: 190 LPIAKEASQVYPATEDTPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGD 249

Query: 520 ---IQRYTDYVASIFVPTVLILSLLTFIVWTSLTRSEKIISKLSIF----------GETS 566
              I +  +          L  ++ +F+  T+ T   + +SKL++              +
Sbjct: 250 NSLISKDENKTFWANAGITLAATIGSFLGTTTGTPLHRKLSKLAVLLFFIAVVFAIVVMA 309

Query: 567 ESRFYMCLQIATSVVIVAC---PCALGLATPTAIMVGTGVASENGVLIKGGDVLEKFNEV 623
             +F +  ++A   + VA    P +L +     + VG  + +   V+++  D LE    V
Sbjct: 310 TQKFVVNKEVAIYAICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAV 369

Query: 624 NTFVFDKTGTLTTGHMTVQQ 643
           N    DKTGTLT G M V+Q
Sbjct: 370 NDVCSDKTGTLTQGKMIVKQ 389

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/184 (21%), Positives = 75/184 (40%), Gaps = 42/184 (22%)

Query: 761 LLDEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIPPNNVY----------- 809
           + D  + +    ++        V M+TGD   +A  +A+ V I P N+Y           
Sbjct: 653 IYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSMV 712

Query: 810 ------------------------SEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALV 845
                                   +   P  K + ++ L    +  A  GDG+NDS +L 
Sbjct: 713 MTAAQFDQLTDEEIDNLLLLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLK 772

Query: 846 TSDLGIAIS-SGTEVAIEAAGIVILNDPDTDEPTLKGVVNALDLSIRTFRRVKLNLFWAL 904
            +++GIA+  +G++VA +A+ IV+ +D          ++NA++   R    ++  +   L
Sbjct: 773 KANVGIAMGINGSDVAKDASDIVLSDD------NFASILNAVEEGRRMSDNIQKFVLQLL 826

Query: 905 CYNV 908
             NV
Sbjct: 827 AENV 830

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
           Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
           involved in Na+ efflux, hypothetical start
          Length = 1082

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 69/260 (26%), Positives = 116/260 (44%), Gaps = 32/260 (12%)

Query: 410 PSSCIIVDKDDDSITQEIGIELLEVGDIAMVKPGAKIPSDGIVTKGIS-EVDESLMTGET 468
           PS+ +I   +D +I  +   EL+  GDI +++ G  +P+D  + + I+ E DE+L+TGE+
Sbjct: 130 PSAHVIRAGNDLTIESK---ELVP-GDICIIRVGDTVPADLRLFEAINLETDEALLTGES 185

Query: 469 NLVVKEIGSVVTGGTINGSGL-IYFEVTSVGDDTKLANIIKVMKNAQLKKA--------- 518
             V K  G V    T  G  L + F  ++V        +IK   N ++ K          
Sbjct: 186 LPVAKSHGEVYEQDTPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKSEAS 245

Query: 519 --SIQRYTDYVASIFVPTVLILSLLTFIVWTSLTRSEKIISKLSIF----------GETS 566
             S  +   +  ++++   L  S+ TF+  +  T   + +S+L+I               
Sbjct: 246 LISRDKSKSFGRNLWI--TLRESIGTFLGTSVGTPLHRKLSQLAILLFVVAVIFAIVVMG 303

Query: 567 ESRFYMCLQIATSVVIVAC---PCALGLATPTAIMVGTGVASENGVLIKGGDVLEKFNEV 623
             +F +  Q+A   + VA    P +L +     +  G  V +   V+I+  D LE    V
Sbjct: 304 TQKFKVNKQVAIYAICVALSMIPSSLVVVLTITMSAGAKVMATRHVIIRKLDSLEALGAV 363

Query: 624 NTFVFDKTGTLTTGHMTVQQ 643
           N    DKTGTLT G M  +Q
Sbjct: 364 NDICSDKTGTLTQGKMIAKQ 383

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 79/185 (42%), Gaps = 45/185 (24%)

Query: 783 VFMVTGDTHKSAMKVAEMVDIPPNNVY--------------------------------- 809
           V M+TGD   +A  +A+ V I P+N+Y                                 
Sbjct: 658 VHMLTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMTATDFDALSDKEIDELPVLPL 717

Query: 810 --SEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIAIS-SGTEVAIEAAGI 866
             +   P  K + +E L    R  A  GDG+NDS +L  +++GIA+  +G++VA +A+ I
Sbjct: 718 VIARCAPQTKVRMIEALHRRNRFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDI 777

Query: 867 VILNDPDTDEPTLKGVVNALDLSIRTFRRVKLNLFWALCYNV---FMLPIAMGILVPWGI 923
           V+ +D          ++NA++   R    ++  +   L  NV     L + +  L   G 
Sbjct: 778 VLSDD------NFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFLDEEGF 831

Query: 924 TLHPM 928
           ++ P+
Sbjct: 832 SVFPL 836

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
           Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 1280

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 59/103 (57%), Gaps = 13/103 (12%)

Query: 803 IPPNNVYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIAIS-SGTEVAI 861
           IP   V +  +P+ K   VE L++ G V+A  GDG ND+ AL  +D+G ++  SGTEVA 
Sbjct: 832 IPKLRVLARSSPEDKRILVETLKKMGEVVAVTGDGTNDAPALKLADVGFSMGISGTEVAR 891

Query: 862 EAAGIVILNDPDTDEPTLKGVVNAL------DLSIRTFRRVKL 898
           EA+ I+++ D  T       +VNA+       +SI+ F + +L
Sbjct: 892 EASDIILMTDDFT------AIVNAIKWGRCVSVSIKKFIQFQL 928

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 68/255 (26%), Positives = 110/255 (43%), Gaps = 36/255 (14%)

Query: 427 IGIELLEVGDIAMVKPGAKIPSDGIVTKGISEVDESLMTGETNLVVK------------- 473
           I I  L VGD+  ++ G  +P+D ++  G  E DES +TGE++ + K             
Sbjct: 252 ISIHDLLVGDVISLQTGDVVPADAVLISGSCECDESALTGESDTIKKVALKPALEKYKQI 311

Query: 474 -------EIGSVVTGGT------INGSGLI----YFEVTSVGDDTKLANIIKVMKNAQLK 516
                  +IGS   G        I+GS L+       +TSVG+++    I+  +K     
Sbjct: 312 FEKDPTIDIGSHGVGEKVPDPLLISGSKLLSGIGNAVITSVGENSVNGRIMMALKTESES 371

Query: 517 KASIQRYTDYVASIFV---PTVLILSLLTFIVWTSLTRSEKIISKLSIFGETSESRFYMC 573
               +R ++   +I +      L+L ++ FI + +   + K    L        S+F   
Sbjct: 372 TPLQERLSNLADNISIYGCMAALVLFIILFIRFLTYLPNGKKYHDLP--PAQKGSKFMNI 429

Query: 574 LQIATSVVIVACPCALGLATPTAIMVGTGVASENGVLIKGGDVLEKFNEVNTFVFDKTGT 633
              A +V++VA P  L LA   A+   T   +++G L++     E          DKTGT
Sbjct: 430 FITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRACETMGSATAICSDKTGT 489

Query: 634 LTTGHMT-VQQFVGN 647
           LT   MT V+ F GN
Sbjct: 490 LTENRMTVVKGFAGN 504

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
           Ca2+-transporting P-type ATPase, member of the cation
           transporting (E1-E2) P-type ATPase superfamily,
           functions to pump Ca2+ into the vacuole [3522 bp, 1173
           aa]
          Length = 1173

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 60/108 (55%), Gaps = 14/108 (12%)

Query: 799 EMVDIPPN-NVYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIAIS-SG 856
           E + I PN  V +  +P+ K   VE L+  G V+A  GDG ND+ AL  +D+G ++  SG
Sbjct: 803 ERIRILPNLRVLARSSPEDKRLLVETLKGMGDVVAVTGDGTNDAPALKLADVGFSMGISG 862

Query: 857 TEVAIEAAGIVILNDPDTDEPTLKGVVNAL------DLSIRTFRRVKL 898
           TEVA EA+ I+++ D          +VNA+       +SI+ F + +L
Sbjct: 863 TEVAREASDIILMTD------DFSAIVNAIKWGRCVSVSIKKFIQFQL 904

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 75/282 (26%), Positives = 122/282 (43%), Gaps = 53/282 (18%)

Query: 414 IIVDKDDDSITQEIGIELLEVGDIAMVKPGAKIPSDGIVTKGISEVDESLMTGETNLVVK 473
           IIV ++D  I   I I  + VGD+  ++ G  +P+D ++  G  E DES +TGE+N + K
Sbjct: 194 IIVIRNDQEIL--ISIHHVLVGDVISLQTGDVVPADCVMISGKCEADESSITGESNTIQK 251

Query: 474 -------------------------EIGSVVTGGT-------ING----SGLIYFEVTSV 497
                                    +IG V   G        I+G    SGL    +TSV
Sbjct: 252 FPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGSRILSGLGRGVITSV 311

Query: 498 GDDTKLANIIKVMKNAQLKKASIQRYTDYVA---SIF-VPTVLILSLLTFIVWTSLTRSE 553
           G ++     +  + NA+ +   +Q +   +A   S++   + +IL L+ F  +       
Sbjct: 312 GINSVYGQTMTSL-NAEPESTPLQLHLSQLADNISVYGCVSAIILFLVLFTRYLFY---- 366

Query: 554 KIISKLSIFGETSE----SRFYMCLQIATSVVIVACPCALGLATPTAIMVGTGVASENGV 609
            II +   F +       S+F      + +V++VA P  L LA   A+   T   +++G 
Sbjct: 367 -IIPEDGRFHDLDPAQKGSKFMNIFITSITVIVVAVPEGLPLAVTLALAFATTRMTKDGN 425

Query: 610 LIKGGDVLEKFNEVNTFVFDKTGTLTTGHMT-VQQFVGNAEM 650
           L++     E          DKTGTLT   MT V+ F GN++ 
Sbjct: 426 LVRVLRSCETMGSATAVCSDKTGTLTENVMTVVRGFPGNSKF 467

>Scas_297.1
          Length = 800

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 50/87 (57%), Gaps = 1/87 (1%)

Query: 786 VTGDTHKSAMKVAEMVDIPPNNVYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALV 845
           + G   ++  K   +  +P   V +  +P+ K   VE L+  G V+A  GDG ND+ AL 
Sbjct: 29  IEGPKFRTLTKQERIKMLPNLRVMARSSPEDKRLLVETLKGMGDVVAVTGDGTNDAPALK 88

Query: 846 TSDLGIAIS-SGTEVAIEAAGIVILND 871
            +D+G ++  SGTEVA EA+ I+++ D
Sbjct: 89  LADVGFSMGISGTEVAREASDIILMTD 115

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 41/66 (62%), Gaps = 4/66 (6%)

Query: 424 TQEI--GIELLEVGDIAMVKPGAKIPSDGIVTKGISEVDESLMTGETNLV--VKEIGSVV 479
           +QE+   I  L VGDI  ++ G  IP+DG++ +G  EVDES +TGE++ +  VK   ++ 
Sbjct: 606 SQELLTSIHNLLVGDIITLQTGDVIPADGVLVEGQCEVDESSITGESDTIKKVKVFNALK 665

Query: 480 TGGTIN 485
           T   IN
Sbjct: 666 TFDVIN 671

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
           cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 74/274 (27%), Positives = 110/274 (40%), Gaps = 70/274 (25%)

Query: 421 DSITQEIGIELLEVGDIAMVKPGAKIPSDGIVTKGISEVDESLMTGETNLVVK------- 473
           D+    I I  L VGD+  ++ G  +P+D ++ +G  E DES +TGE+N + K       
Sbjct: 164 DAAESLISIHNLLVGDLLKLQTGDVVPADCVLVRGECETDESALTGESNTIKKLPLADAL 223

Query: 474 ---------EIGSVVTGGT--------------ING----SGLIYFEVTSVGDDTKLANI 506
                    +IG     G               I+G    SGL    VT+VG      N 
Sbjct: 224 EYHSAHGGRDIGDTSASGASGAADDSRCPDCMLISGSRVLSGLASAIVTNVG-----VNS 278

Query: 507 IKVMKNAQLKKAS--------IQRYTDY------VASIFVPTVLILSLLTFIV-----WT 547
           +     A LK+ S        + + TD       VA+I +  VL    L++I+     + 
Sbjct: 279 VHGKTMASLKEDSEDTPLQMRLSQLTDNISVYGCVAAITLFVVLFARYLSYILPSGGKYH 338

Query: 548 SLTRSEKIISKLSIFGETSESRFYMCLQIATSVVIVACPCALGLATPTAIMVGTGVASEN 607
            L  +EK             S+F      A +V++VA P  L LA   A+   T   +++
Sbjct: 339 DLPPAEK------------GSKFMDIFITAITVIVVAVPEGLPLAVTLALAFATTRMTKD 386

Query: 608 GVLIKGGDVLEKFNEVNTFVFDKTGTLTTGHMTV 641
           G L++     E          DKTGTLT   MTV
Sbjct: 387 GNLVRVLRSCETMGSATAVCSDKTGTLTENIMTV 420

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 49/85 (57%), Gaps = 7/85 (8%)

Query: 803 IPPNNVYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIAIS-SGTEVAI 861
           +P   V +  +P+ K   V  L+E G V+A  GDG ND+ AL  +D+G ++  +GTEVA 
Sbjct: 763 LPKLRVLARSSPEDKKILVRALKEMGEVVAVTGDGTNDAPALKLADVGFSMGITGTEVAR 822

Query: 862 EAAGIVILNDPDTDEPTLKGVVNAL 886
           EA+ I+++ D          +VNA+
Sbjct: 823 EASDIILMTD------DFSAIVNAI 841

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
           (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 108/239 (45%), Gaps = 34/239 (14%)

Query: 435 GDIAMVKPGAKIPSDGIVTKGIS-EVDESLMTGETNLVVKEIGSVVTGGTINGSGL-IYF 492
           GDI  V+ G  +P+D  + + ++ E DE+L+TGE   V K+  +V    T  G  L + F
Sbjct: 153 GDIVQVRVGDTVPADLRLVEALNLETDEALLTGEALPVAKDPAAVFEQDTPVGDRLNLAF 212

Query: 493 EVTSV--GDDTKL-------ANIIKVMKNAQLKKASIQRYTDYVASIFVPTVLIL----- 538
             ++V  G  T +       + I K+ ++ Q K++ I R  D   S    TVL +     
Sbjct: 213 ASSTVSKGRATGIVVRTGLRSEIGKIAESLQGKQSLISR--DENKSGLQNTVLTVKASVG 270

Query: 539 SLLTFIVWTSLTRSEKIISKLSI----------FGETSESRFYMCLQIATSVVIVAC--- 585
           S L   V T L R    ++KL++              +  +F +  ++A   + VA    
Sbjct: 271 SFLGTNVGTPLHRK---LAKLALILFAIAVLFALIVMATQKFIVNREVAIYAICVALSMI 327

Query: 586 PCALGLATPTAIMVGTGVASENGVLIKGGDVLEKFNEVNTFVFDKTGTLTTGHMTVQQF 644
           P +L +     +  G  V S   V+++  D LE    VN    DKTGTLT G M ++Q 
Sbjct: 328 PSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTGTLTQGKMILKQL 386

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/184 (21%), Positives = 76/184 (41%), Gaps = 42/184 (22%)

Query: 761 LLDEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIPPNNVY----------- 809
           + D  + +    ++        V M+TGD   +A  +A+ V I P+N+Y           
Sbjct: 642 IYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVDIMV 701

Query: 810 ------------------------SEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALV 845
                                   +   P  K + ++ L    +  A  GDG+NDS +L 
Sbjct: 702 MTATQFDSLTDEELDQLPVLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLK 761

Query: 846 TSDLGIAIS-SGTEVAIEAAGIVILNDPDTDEPTLKGVVNALDLSIRTFRRVKLNLFWAL 904
            +++GIA+  +G++VA +A+ IV+ +D          ++NA++   R    ++  +   L
Sbjct: 762 KANVGIAMGINGSDVAKDASDIVLSDD------NFASILNAVEEGRRMSDNIQKFVLQLL 815

Query: 905 CYNV 908
             NV
Sbjct: 816 AANV 819

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
           complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 80/175 (45%), Gaps = 43/175 (24%)

Query: 763 DEVKSDAKDVIRYLRNNNYEVFMVTGDT---------------------HKSAMK----- 796
           D ++   K+ ++  + +   V M+TGD                      H+ AM+     
Sbjct: 714 DPLRPGVKESVKNCQQSGVTVRMITGDNITTGRAIARACGILSESEYADHECAMEGPVFR 773

Query: 797 ---VAEMVDIPPN-NVYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIA 852
                +M+D  P   V +  +P+ K   V+ L++   V+A  GDG ND+ AL  +D+G +
Sbjct: 774 KLSRRQMMDAAPKLKVLARSSPEDKRIFVDILKKMNEVVAVTGDGTNDAPALTLADVGFS 833

Query: 853 IS-SGTEVAIEAAGIVILNDPDTDEPTLKGVVNAL------DLSIRTFRRVKLNL 900
           +  SGT VA EA+ I+++ D          +VNA+       LSI+ F + +L +
Sbjct: 834 MGISGTGVAREASDIILMTD------DFTSIVNAIKWGRCVSLSIKKFIQFQLTV 882

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 68/265 (25%), Positives = 109/265 (41%), Gaps = 49/265 (18%)

Query: 427 IGIELLEVGDIAMVKPGAKIPSDGIVTKGISEVDESLMTGETNLVVK------------- 473
           I +  L VGD+  ++ G  +P D I+ +G  E DES +TGE++ + K             
Sbjct: 196 ISVHDLLVGDLLSLQTGDVVPVDCILVEGKCECDESGITGESDTIKKVSLAMSLQVYRTV 255

Query: 474 -------EIGSVVTGGT-------INGSGLI----YFEVTSVGDDTKLANIIKVMKNAQL 515
                  +IGS   G +       I+GS L+    +  VT+VG  +    ++  +K+   
Sbjct: 256 AADNPSADIGSSDNGHSLVPDPMLISGSKLLSGIGHAVVTAVGPHSVHGKMMLALKSEPE 315

Query: 516 KKASIQRYTDY---------VASIFVPTVLILSLLTFIVWTSLTRSEKIISKLSIFGETS 566
                +R             VA+  +  VL L  L+++    L        K        
Sbjct: 316 TTPLQERLNTLADDISIYGSVAAFLLFVVLFLRFLSYLPKGRLYHDLPSARK-------- 367

Query: 567 ESRFYMCLQIATSVVIVACPCALGLATPTAIMVGTGVASENGVLIKGGDVLEKFNEVNTF 626
            SRF      A +V++VA P  L LA   A+   T   +++G L++     E      T 
Sbjct: 368 GSRFMDIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRACETMGSATTV 427

Query: 627 VFDKTGTLTTGHM-TVQQFVGNAEM 650
             DKTGTLT   M  V+ F+G++  
Sbjct: 428 CSDKTGTLTQNKMVVVKGFLGSSHF 452

>CAGL0K12034g complement(1161299..1164562) highly similar to
           sp|P13587 Saccharomyces cerevisiae YDR040c ENA1 or
           sp|Q01896 Saccharomyces cerevisiae YDR039c ENA2 or
           sp|Q12691 Saccharomyces cerevisiae YDR038c ENA5,
           hypothetical start
          Length = 1087

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 62/236 (26%), Positives = 100/236 (42%), Gaps = 30/236 (12%)

Query: 435 GDIAMVKPGAKIPSD-GIVTKGISEVDESLMTGETNLVVKEIGSVVTGGTINGSGL-IYF 492
           GD+ +VK G  IP+D  +V++   E DE+L+TGE+  V K+   +    T  G  + + F
Sbjct: 145 GDLVVVKVGDTIPADLRLVSQQNFETDEALLTGESLPVSKDANEIFDDETPVGDRINLAF 204

Query: 493 EVTSV------------GDDTKLANIIKVMKNAQLKKASIQRYTDYVASIFVPTVLILSL 540
             ++V            G +T++  I K ++      +     T Y  +       + + 
Sbjct: 205 SSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNELISRDPAKTWYQNAWISTKRTVGAF 264

Query: 541 LTFIVWTSLTRSEKIISKLSIF----------GETSESRFYMCLQIATSVVIVAC---PC 587
           L     T L R    +SKL++              +  +F +   +A   V VA    P 
Sbjct: 265 LGTTQGTPLHRK---LSKLAVLLFWIAVVFAIVVMASQKFDVDRGVAIYAVCVALSMIPS 321

Query: 588 ALGLATPTAIMVGTGVASENGVLIKGGDVLEKFNEVNTFVFDKTGTLTTGHMTVQQ 643
           +L +     + VG  V +   V+I+  D LE    VN    DKTGTLT G M  +Q
Sbjct: 322 SLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLTQGKMIAKQ 377

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 77/188 (40%), Gaps = 42/188 (22%)

Query: 757 GRFELLDEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIPPNNVY------- 809
           G   + D  + +    ++        V M+TGD   +A  +A+ V I P N+Y       
Sbjct: 638 GLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEVV 697

Query: 810 ----------------------------SEVTPDGKSQTVEYLREEGRVIAFIGDGINDS 841
                                       +  +P  K + +E L    +  A  GDG+NDS
Sbjct: 698 DIMVMTGKQFDNLSEDEIDNLPVLPLVIARCSPQTKVRMIEALHRREKFCAMTGDGVNDS 757

Query: 842 LALVTSDLGIAIS-SGTEVAIEAAGIVILNDPDTDEPTLKGVVNALDLSIRTFRRVKLNL 900
            +L  +++GIA+  +G++VA +A+ IV+ +D          ++NA++   R    ++  +
Sbjct: 758 PSLKMANVGIAMGINGSDVAKDASDIVLSDD------NFASILNAVEEGRRMSDNIQKFV 811

Query: 901 FWALCYNV 908
              L  NV
Sbjct: 812 LQLLAENV 819

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 70/249 (28%), Positives = 106/249 (42%), Gaps = 54/249 (21%)

Query: 435 GDIAMVKPGAKIPSDG--IVTKGISEVDESLMTGETNLVVKEIGSVVTGGTINGSGLIYF 492
           GDI +VK G  IP+D   I TK   + DESL+TGE+ L V +  ++V G           
Sbjct: 149 GDICLVKVGDTIPADLRLIETKNF-DTDESLLTGES-LPVSKDANLVFGKE--------- 197

Query: 493 EVTSVGDDTKLAN-------------IIKVMKNAQLKKASIQRYTD-----------YVA 528
           E TSVGD   LA              +IK   N+++ K +     D           ++ 
Sbjct: 198 EETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQ 257

Query: 529 SIFVPTVLIL-SLLTFIVWTSLTRSEKIISKLSIFG----------ETSESRFYMCLQIA 577
           + ++ T  +  + L   V T L R    +SKL++              +  +F +  ++A
Sbjct: 258 NTWISTKKVTGAFLGTNVGTPLHRK---LSKLAVLLFWIAVLFAIIVMASQKFDVDKRVA 314

Query: 578 TSVVIVAC---PCALGLATPTAIMVGTGVASENGVLIKGGDVLEKFNEVNTFVFDKTGTL 634
              + VA    P +L +     + VG  V     V+++  D LE    VN    DKTGTL
Sbjct: 315 IYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTL 374

Query: 635 TTGHMTVQQ 643
           T G M  +Q
Sbjct: 375 TQGKMLARQ 383

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 78/188 (41%), Gaps = 42/188 (22%)

Query: 757 GRFELLDEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIPPNNVY------- 809
           G   + D  +++    ++        V M+TGD   +A  +A+ V I P N+Y       
Sbjct: 643 GLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIV 702

Query: 810 ----------------------------SEVTPDGKSQTVEYLREEGRVIAFIGDGINDS 841
                                       +  +P  K + +E L    +  A  GDG+NDS
Sbjct: 703 DSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDS 762

Query: 842 LALVTSDLGIAIS-SGTEVAIEAAGIVILNDPDTDEPTLKGVVNALDLSIRTFRRVKLNL 900
            +L  +++GIA+  +G++V+ EA+ IV+ +D          ++NA++   R    ++  +
Sbjct: 763 PSLKMANVGIAMGINGSDVSKEASDIVLSDD------NFASILNAVEEGRRMTDNIQKFV 816

Query: 901 FWALCYNV 908
              L  NV
Sbjct: 817 LQLLAENV 824

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 78/188 (41%), Gaps = 42/188 (22%)

Query: 757 GRFELLDEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIPPNNVY------- 809
           G   + D  +++    ++        V M+TGD   +A  +A+ V I P N+Y       
Sbjct: 643 GLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIV 702

Query: 810 ----------------------------SEVTPDGKSQTVEYLREEGRVIAFIGDGINDS 841
                                       +  +P  K + +E L    +  A  GDG+NDS
Sbjct: 703 DSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDS 762

Query: 842 LALVTSDLGIAIS-SGTEVAIEAAGIVILNDPDTDEPTLKGVVNALDLSIRTFRRVKLNL 900
            +L  +++GIA+  +G++V+ EA+ IV+ +D          ++NA++   R    ++  +
Sbjct: 763 PSLKMANVGIAMGINGSDVSKEASDIVLSDD------NFASILNAVEEGRRMTDNIQKFV 816

Query: 901 FWALCYNV 908
              L  NV
Sbjct: 817 LQLLAENV 824

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 70/249 (28%), Positives = 106/249 (42%), Gaps = 54/249 (21%)

Query: 435 GDIAMVKPGAKIPSDG--IVTKGISEVDESLMTGETNLVVKEIGSVVTGGTINGSGLIYF 492
           GDI +VK G  IP+D   I TK   + DESL+TGE+ L V +  ++V G           
Sbjct: 149 GDICLVKVGDTIPADLRLIETKNF-DTDESLLTGES-LPVSKDANLVFGKE--------- 197

Query: 493 EVTSVGDDTKLAN-------------IIKVMKNAQLKKASIQRYTD-----------YVA 528
           E TSVGD   LA              +IK   N+++ K +     D           ++ 
Sbjct: 198 EETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQ 257

Query: 529 SIFVPTVLIL-SLLTFIVWTSLTRSEKIISKLSIFG----------ETSESRFYMCLQIA 577
           + ++ T  +  + L   V T L R    +SKL++              +  +F +  ++A
Sbjct: 258 NTWISTKKVTGAFLGTNVGTPLHRK---LSKLAVLLFWIAVLFAIIVMASQKFDVDKRVA 314

Query: 578 TSVVIVAC---PCALGLATPTAIMVGTGVASENGVLIKGGDVLEKFNEVNTFVFDKTGTL 634
              + VA    P +L +     + VG  V     V+++  D LE    VN    DKTGTL
Sbjct: 315 IYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTL 374

Query: 635 TTGHMTVQQ 643
           T G M  +Q
Sbjct: 375 TQGKMLARQ 383

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
           involved in Na+ and Li+ efflux, required for Na+
           tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 70/249 (28%), Positives = 106/249 (42%), Gaps = 54/249 (21%)

Query: 435 GDIAMVKPGAKIPSDG--IVTKGISEVDESLMTGETNLVVKEIGSVVTGGTINGSGLIYF 492
           GDI +VK G  IP+D   I TK   + DESL+TGE+ L V +  ++V G           
Sbjct: 149 GDICLVKVGDTIPADLRLIETKNF-DTDESLLTGES-LPVSKDANLVFGKE--------- 197

Query: 493 EVTSVGDDTKLAN-------------IIKVMKNAQLKKASIQRYTD-----------YVA 528
           E TSVGD   LA              +IK   N+++ K +     D           ++ 
Sbjct: 198 EETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQ 257

Query: 529 SIFVPTVLIL-SLLTFIVWTSLTRSEKIISKLSIFG----------ETSESRFYMCLQIA 577
           + ++ T  +  + L   V T L R    +SKL++              +  +F +  ++A
Sbjct: 258 NTWISTKKVTGAFLGTNVGTPLHRK---LSKLAVLLFWIAVLFAIIVMASQKFDVDKRVA 314

Query: 578 TSVVIVAC---PCALGLATPTAIMVGTGVASENGVLIKGGDVLEKFNEVNTFVFDKTGTL 634
              + VA    P +L +     + VG  V     V+++  D LE    VN    DKTGTL
Sbjct: 315 IYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTL 374

Query: 635 TTGHMTVQQ 643
           T G M  +Q
Sbjct: 375 TQGKMLARQ 383

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 41/188 (21%), Positives = 77/188 (40%), Gaps = 42/188 (22%)

Query: 757 GRFELLDEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIPPNNVY------- 809
           G   + D  +++    ++        V M+TGD   +A  +A+ V I P N+Y       
Sbjct: 643 GLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIV 702

Query: 810 ----------------------------SEVTPDGKSQTVEYLREEGRVIAFIGDGINDS 841
                                       +  +P  K + +E L    +     GDG+NDS
Sbjct: 703 DSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDS 762

Query: 842 LALVTSDLGIAIS-SGTEVAIEAAGIVILNDPDTDEPTLKGVVNALDLSIRTFRRVKLNL 900
            +L  +++GIA+  +G++V+ EA+ IV+ +D          ++NA++   R    ++  +
Sbjct: 763 PSLKMANVGIAMGINGSDVSKEASDIVLSDD------NFASILNAVEEGRRMTDNIQKFV 816

Query: 901 FWALCYNV 908
              L  NV
Sbjct: 817 LQLLAENV 824

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 50/84 (59%), Gaps = 5/84 (5%)

Query: 782  EVFMVTGDTHKSAMKVAEMVD--IPPNNVYSEVTPDGKSQTVEYLREEGRVIAFIGDGIN 839
            EVF +   T KS  ++ E+++  +   ++Y+ ++PD K + VE L+  G  + F GDG N
Sbjct: 1110 EVFRLLFKTDKS--QIEEVINNILLKTSIYARMSPDEKHELVERLQSIGYQVGFCGDGAN 1167

Query: 840  DSLALVTSDLGIAISSGTEVAIEA 863
            D  AL  +D+GI++S   E ++ A
Sbjct: 1168 DCGALKAADIGISLSEA-EASVAA 1190

>Scas_569.0d
          Length = 468

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 68/136 (50%), Gaps = 11/136 (8%)

Query: 776 LRNNNYEVFMVTGDTHKSAMKVAEMVDIPP--NNVYSEVTPDGKSQTVEYLREEGRVIAF 833
           +++N+ E  ++TG          E +D  P    V +  +P  K + +E L    +  A 
Sbjct: 72  MKSNSTENMVMTGSQFDEL--TPEQIDNLPVLPLVIARCSPQTKVRMIEALHRRDKFCAM 129

Query: 834 IGDGINDSLALVTSDLGIAIS-SGTEVAIEAAGIVILNDPDTDEPTLKGVVNALDLSIRT 892
            GDG+NDS +L  +++GIA+  +G++VA +A+ IV+ +D          ++NA++   R 
Sbjct: 130 TGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVLSDD------NFASILNAIEEGRRM 183

Query: 893 FRRVKLNLFWALCYNV 908
              ++  +   L  NV
Sbjct: 184 SDNIQKFVLQLLAENV 199

>Scas_665.30
          Length = 1439

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 808 VYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIAISSGTEVAIEAA 864
           +Y+ ++PD K + +E L+     + F GDG ND  AL  +D+GI++S   E ++ A 
Sbjct: 929 IYARMSPDEKHELMEQLQRLNYTVGFCGDGANDCGALKAADVGISLSEA-EASVAAP 984

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 36/57 (63%), Gaps = 1/57 (1%)

Query: 807  NVYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIAISSGTEVAIEA 863
            ++++ ++PD K + VE L++    + F GDG ND  AL  +D+GI++S   E ++ A
Sbjct: 1138 SIFARMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALKAADVGISLSEA-EASVAA 1193

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 32/50 (64%)

Query: 807  NVYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIAISSG 856
            ++Y+ ++PD K + VE L++    + F GDG ND  AL  +++GI++S  
Sbjct: 1125 SIYARMSPDEKHELVEQLQKLDYNVGFCGDGANDCGALKAANIGISLSEA 1174

>Kwal_26.9207
          Length = 1469

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 42/76 (55%), Gaps = 7/76 (9%)

Query: 786  VTGDTHKSAMKVAEMVD-------IPPNNVYSEVTPDGKSQTVEYLREEGRVIAFIGDGI 838
            VTGD  +   K  E++        +  +++Y+ ++PD K + V  L+    V+ F GDG 
Sbjct: 1127 VTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQGLDYVVGFCGDGA 1186

Query: 839  NDSLALVTSDLGIAIS 854
            ND  AL  +D+G+++S
Sbjct: 1187 NDCGALKAADVGVSLS 1202

>Scas_583.14*
          Length = 875

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 808 VYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIAISSGTEVAIEA 863
           VY+ V+P  K   +  L+E G      GDG ND  AL  + +G+A+ +GTE ++ A
Sbjct: 442 VYARVSPSQKEFILNNLKEMGYQTLMCGDGTNDVGALKQAHVGVALLNGTEESMTA 497

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative
           Ca2+-transporting ATPase, member of the P-type ATPase
           superfamily of membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%)

Query: 808 VYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIAISSGTEVAIEAAG 865
           VY+ V+P  K   +  L++ G      GDG ND  AL  + +GIA+ +GTE  ++  G
Sbjct: 788 VYARVSPSQKEFLLNTLKDMGYQTLMCGDGTNDVGALKQAHVGIALLNGTEEGLKKLG 845

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 103/459 (22%), Positives = 182/459 (39%), Gaps = 135/459 (29%)

Query: 446 IPSDGIVTKGISEVDESLMTGETNLVVKE-----------------IGSVVTGGT----- 483
           IP D I+  G + V+E++++GE+  ++KE                   +V+ GGT     
Sbjct: 289 IPCDLILLDGSAIVNEAMLSGESTPLLKESIKLRPSEDNLQLDGVDKIAVLHGGTKALQV 348

Query: 484 ------------INGSGLIYFEVTSVGDDTKLANIIKVMKNAQLKKASIQRYTDYVASIF 531
                        +G  L    VT  G +T   ++++VM    +  A      +  A +F
Sbjct: 349 TPPEHKSDIPPPPDGGALAI--VTKTGFETSQGSLVRVM----IYSAERVSVDNKEALMF 402

Query: 532 VPTVLILSLL-TFIVWTSLTRSEKIISKLSIFGETSESRFYMCLQIATSVVIVACPCALG 590
           +  +LI +++ ++ VW   T+  +I SKL +           C+ I TSVV    P  L 
Sbjct: 403 ILFLLIFAVIASWYVWVEGTKMGRIQSKLIL----------DCILIITSVVPPELPMELT 452

Query: 591 LATPTAIMVGTGVASENGVLIKGGDVLEKFN-----EVNTFVFDKTGTLTTGHMTVQQFV 645
           +A      V + +A+     +      E F       ++   FDKTGTLT   +  +   
Sbjct: 453 MA------VNSSLAALAKFYVY---CTEPFRIPFAGRIDVCCFDKTGTLTGEDLVFEGLA 503

Query: 646 G---NAEMIKNLF-----------------YLECIERAEALSDHPVSKAVVKYC------ 679
           G   ++E I++L+                  L  +E  + + D P+ KA +K        
Sbjct: 504 GISADSENIRHLYSAAEAPESTILVIGAAHALVKLEDGDIVGD-PMEKATLKAVGWAVER 562

Query: 680 -----RDLLGE-----SFEGTSMIIEDEQLIT-GKGIKCTVKAADKTLRITVGNKSLMD- 727
                R+  G+      F+ +S +     + +    +   VK A +T+R     + L D 
Sbjct: 563 KNSNYREGTGKLDIIRRFQFSSALKRSASIASHNDALFAAVKGAPETIR-----ERLSDI 617

Query: 728 EDSLGEFWQMYGRAGPCTVTYLA-----------IDDKVCGRFELLDE------------ 764
             +  E ++ + R+G   V  LA           IDD    R ++  E            
Sbjct: 618 PKNYDEIYKSFTRSG-SRVLALASKSLPKMSQSKIDD--LNRDDVESELTFNGFLIFHCP 674

Query: 765 VKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDI 803
           +K DA + I+ L  +++   M+TGD   +A+ VA+ V I
Sbjct: 675 LKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGI 713

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 36/59 (61%), Gaps = 1/59 (1%)

Query: 806  NNVYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIAISSGTEVAIEAA 864
            +++Y+ ++PD K + +  L++    + F GDG ND  AL  +D+GI++S   E ++ A 
Sbjct: 1157 SSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGALKAADVGISLSEA-EASVAAP 1214

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
           (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score = 37.4 bits (85), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%)

Query: 808 VYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIAISSGTE 858
           VY+ V+P  K   +  L++ G      GDG ND  AL  + +GIA+ +GTE
Sbjct: 789 VYARVSPAQKEFIMNSLKDMGYQTLMCGDGTNDVGALKQAHVGIALLNGTE 839

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
           cerevisiae YIL048w NEO1 ATPase whose overproduction
           confers neomycin resistance, hypothetical start
          Length = 1144

 Score = 37.4 bits (85), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 45/97 (46%), Gaps = 8/97 (8%)

Query: 737 MYGRAGPCTVT---YLAIDDKVCGRFELLDEVKSDAKDVIRYLRNNNYEVFMVTGDTHKS 793
           MY R      T   YL  D ++ G   + D+++ D K  I  LRN   +++M+TGD  ++
Sbjct: 714 MYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVET 773

Query: 794 AMKVAEMVDIPPNNVYSEVT-----PDGKSQTVEYLR 825
           A  V+    +     Y  V      P+G    +EYL+
Sbjct: 774 ARCVSISAKLISRGQYVHVVTKLSKPEGAFNQLEYLK 810

>CAGL0L01419g 156123..159767 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           hypothetical start
          Length = 1214

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%)

Query: 808 VYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIAISSGTE 858
           +Y+ V+P  K   +  L++ G      GDG ND  AL  + +G+A+ +GTE
Sbjct: 786 IYARVSPAQKEFILNNLKDMGYQTLMCGDGTNDVGALKQAHVGVALLNGTE 836

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 101/469 (21%), Positives = 184/469 (39%), Gaps = 121/469 (25%)

Query: 430 ELLEVGDIAMVKPG--AKIPSDGIVTKGISEVDESLMTGETNLVVKE------------- 474
           ELL +  +++V+    + +P D I+  G   V+E++++GE+  ++KE             
Sbjct: 269 ELLPMDVVSVVRTAEDSALPCDLILVDGTCIVNEAMLSGESTPLLKESIRLRPGNEELQI 328

Query: 475 ----IGSVVTGGT-----------------INGSGLIYFEVTSVGDDTKLANIIKVMKNA 513
                 SV+ GGT                  +G  +    VT  G +T   ++++VM  +
Sbjct: 329 EGTDKISVLHGGTKVLQVTTPEKTGKVPSPPDGGAIAI--VTKTGFETSQGSLVRVMIYS 386

Query: 514 QLKKASIQRYTDYVASIFVPTVLILSLL-TFIVWTSLTRSEKIISKLSIFGETSESRFYM 572
             +     +   Y    F+  +LI +++ ++ VW   T+  ++ SKL +           
Sbjct: 387 SERVGVDNKEALY----FILFLLIFAVVASWYVWVEGTKMGRVQSKLIL----------D 432

Query: 573 CLQIATSVVIVACPCALGLATPTAIMVGTGVASENGVLIKGGDVLEKFNEVNTFVFDKTG 632
           C+ I TSVV    P  L +A  +++       S+  V       +     ++   FDKTG
Sbjct: 433 CILIITSVVPPELPMELTMAVNSSL----SALSKFYVYCTEPFRIPFAGRIDVCCFDKTG 488

Query: 633 TLTTGHMTVQQFVGNAEMIKNLFYL----EC----------------IERAEALSDHPVS 672
           TLT   +  +   G +   K++ +L    +C                +E  E + D P+ 
Sbjct: 489 TLTGEDLVFEGLAGLSSDPKDIRHLYSATDCPNSTSLVVGAAHALVRLEDGEIVGD-PME 547

Query: 673 KAVVKYCR-------DLLGES---------FEGTSMIIEDEQLITGKG-IKCTVKAADKT 715
           KA +K  +        +  E          F+ +S +     + T  G +   VK A +T
Sbjct: 548 KATLKALKWTVEKGDKVFNEKNGQVTILRRFQFSSALKRSSSVATHDGKLYSAVKGAPET 607

Query: 716 LRITVGNKSLMDEDSLGEFWQMYGRAGPCTVTYLA-----------IDDKVCGRFELLDE 764
           +R     +      +  E ++ + R+G   V  LA           I+D     FE   E
Sbjct: 608 IR----ERLFTIPANYDEIYKSFTRSG-SRVLALASKKLEKMSQSQIEDADREHFERDLE 662

Query: 765 ----------VKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDI 803
                     +K DA + I+ L  + +   M+TGD   +A+ VA+ V I
Sbjct: 663 FNGFLIFHCPLKHDAIETIQMLNESAHRCVMITGDNPLTAVHVAKEVGI 711

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           start by similarity
          Length = 1206

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%)

Query: 808 VYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIAISSGTE 858
           +Y+ V+P  K   +  L++ G      GDG ND  AL  + +GIA+ +GTE
Sbjct: 786 IYARVSPSQKEFILITLKDMGYQTLMCGDGTNDVGALKQAHVGIALLNGTE 836

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 56/234 (23%), Positives = 97/234 (41%), Gaps = 51/234 (21%)

Query: 446 IPSDGIVTKGISEVDESLMTGETNLVVKE-----------------IGSVVTGGTI---- 484
           IP D ++  G   V+E++++GE+  ++KE                   +V+ GGT     
Sbjct: 288 IPCDLLLIDGSCIVNEAMLSGESTPLLKESIKLRPANDQLQLDGVDKNAVLHGGTKALQV 347

Query: 485 ----NGSGLIYFE-------VTSVGDDTKLANIIKVMKNAQLKKASIQRYTDYVASIFVP 533
               N +G+I          VT  G +T   ++++VM    +  A      +  A  F+ 
Sbjct: 348 TAPENRTGVITPPDGGALAVVTKTGFETSQGSLVRVM----IFSAERVDVGNKEALYFIL 403

Query: 534 TVLILSLL-TFIVWTSLTRSEKIISKLSIFGETSESRFYMCLQIATSVVIVACPCALGLA 592
            +LI +++ ++ VW   TR  +I SKL +           C+ I TSVV    P  L +A
Sbjct: 404 FLLIFAIVASWYVWKEGTRMGRIQSKLIL----------DCILIITSVVPPELPMELTMA 453

Query: 593 TPTAIMVGTGVASENGVLIKGGDVLEKFNEVNTFVFDKTGTLTTGHMTVQQFVG 646
             +++       S+  V       +     ++   FDKTGTLT   +  +   G
Sbjct: 454 VNSSL----AALSKFYVYCTEPFRIPYAGRIDVCCFDKTGTLTAEDLVFEGLAG 503

>Scas_704.38
          Length = 1161

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 42/83 (50%), Gaps = 5/83 (6%)

Query: 748 YLAIDDKVCGRFELLDEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIPPNN 807
           YL  D ++ G   + D++++D K  I  LRN   +++M+TGD  ++A  V+    +    
Sbjct: 745 YLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRG 804

Query: 808 VYSEV-----TPDGKSQTVEYLR 825
            Y  +      P+G    +EYL+
Sbjct: 805 QYVHIITKLTKPEGALNQLEYLK 827

>Scas_89.1
          Length = 271

 Score = 33.9 bits (76), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 34/68 (50%), Gaps = 5/68 (7%)

Query: 763 DEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIPPNNVYSEVT-----PDGK 817
           D++++D K  I  LRN   +++M+TGD  ++A  V+    +     Y         P+G 
Sbjct: 45  DKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGA 104

Query: 818 SQTVEYLR 825
              +EYL+
Sbjct: 105 LNALEYLK 112

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 41/91 (45%), Gaps = 6/91 (6%)

Query: 769 AKDVIRYLRNNNYEVFMVTGDTHKSAMKV--AEMVDIP---PNNVYSEVTPDGKSQTVEY 823
           A + + YL+ N     ++ G++    +     E  DI    P  +    TP  K+     
Sbjct: 104 ALNALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQKADVALL 163

Query: 824 LRE-EGRVIAFIGDGINDSLALVTSDLGIAI 853
           +RE  G+ +  IGDG ND   +  +D+G+ I
Sbjct: 164 IREITGKRVCCIGDGGNDVSMIQCADVGVGI 194

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the
           Drs2p-like ATPases family in the superfamily of P-type
           ATPases, overproduction confers neomycin resistance
           [3456 bp, 1151 aa]
          Length = 1151

 Score = 34.3 bits (77), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 44/83 (53%), Gaps = 5/83 (6%)

Query: 748 YLAIDDKVCGRFELLDEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIPPNN 807
           YL  D ++ G   + D+++ D K  I  LRN   +++M+TGD  ++A  V+    +    
Sbjct: 735 YLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRG 794

Query: 808 VY----SEVT-PDGKSQTVEYLR 825
            Y    ++VT P+G    +EYL+
Sbjct: 795 QYVHTITKVTRPEGAFNQLEYLK 817

>KLLA0B13926g 1220237..1221856 weakly similar to sgd|S0006179
           Saccharomyces cerevisiae YPL258c THI21, start by
           similarity
          Length = 539

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 50/106 (47%), Gaps = 12/106 (11%)

Query: 685 ESFEGTSMIIED-------EQLITGKGIKCTVKAADKTLRITVGNKSLMDEDSLGEFWQM 737
           E FE  +M++++       ++ I G+ IK  VK+ +  L  T     L +    G + Q+
Sbjct: 399 EHFERETMVLQNIIHEMAKQESILGENIKTHVKSIE-MLNYT---NYLKEVAQYGTWEQL 454

Query: 738 YGRAGPCTVTYLAIDDKVCGRFELLDEVKSDAKDVIR-YLRNNNYE 782
           Y  + PC + Y+    K+  +  + +E   D    ++ YLR + YE
Sbjct: 455 YTASMPCCLGYVFAVRKIADKITVTEESHPDLYQWLQEYLRPDFYE 500

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
           Ca-ATPase (P-type) required for ribosome assembly and
           involved in late Golgi function, member of the cation
           transporting (E1-E2) P-type ATPase superfamily [4068 bp,
           1355 aa]
          Length = 1355

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 6/69 (8%)

Query: 411 SSCIIVDKDDDSITQEIGIELLEVGDIAMVKPGAKIPSDGIV-----TKGISEVDESLMT 465
           S+  I  +  D   ++  I++  VGDI  VK    IP+D I+      +G+  ++ + + 
Sbjct: 282 STAEIFSEAHDDFVEKRWIDI-RVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLD 340

Query: 466 GETNLVVKE 474
           GETNL +K+
Sbjct: 341 GETNLKIKQ 349

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH]
           (544854..548354) [3501 bp, 1166 aa]
          Length = 1166

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 41/88 (46%), Gaps = 8/88 (9%)

Query: 773 IRYLRNNNYEVFMVTGDT------HKSAMKVAEMVDIPPNNVYSEVTPDGKSQTVEYLRE 826
           + YL+ N     ++ GD+      H  A +  E+V   P  +    TP  K+     +RE
Sbjct: 828 LEYLKANRNSCLLIDGDSLAIYMSHYRA-EFFEIVICLPVVIACRCTPQQKADVALLIRE 886

Query: 827 -EGRVIAFIGDGINDSLALVTSDLGIAI 853
             G+ +  IGDG ND   +  +D+G+ I
Sbjct: 887 MTGKRVCCIGDGGNDVSMIQCADVGVGI 914

 Score = 31.2 bits (69), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 41/90 (45%), Gaps = 8/90 (8%)

Query: 763 DEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIPPNNVYSE-----VTPDGK 817
           D+++ D K  I  LRN   +++M+TGD  ++A  V     +     Y          DG 
Sbjct: 765 DKLQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCVSAKLISRGQYVHTITKLTRRDGA 824

Query: 818 SQTVEYLREEGRVIAFIGDGINDSLALVTS 847
              +EYL+   R    + DG  DSLA+  S
Sbjct: 825 LSRLEYLK-ANRNSCLLIDG--DSLAIYMS 851

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 34/68 (50%), Gaps = 5/68 (7%)

Query: 763 DEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIPPNNVYSEVT-----PDGK 817
           D++++D K  I  LRN   +++M+TGD  ++A  V+    +     Y         P+G 
Sbjct: 742 DKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGA 801

Query: 818 SQTVEYLR 825
              +EYL+
Sbjct: 802 LNALEYLK 809

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
           Saccharomyces cerevisiae YAL026c DRS2 P-type
           amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 38/69 (55%), Gaps = 6/69 (8%)

Query: 411 SSCIIVDKDDDSITQEIGIELLEVGDIAMVKPGAKIPSDGIV-----TKGISEVDESLMT 465
           S C ++D+      ++  I++  VGDI  V+    IP+D I+      +G+  ++ + + 
Sbjct: 286 SLCDVLDERSGEFVRKKWIDI-AVGDIIRVRSEEAIPADLIILSSSEPEGLCYIETANLD 344

Query: 466 GETNLVVKE 474
           GETNL +K+
Sbjct: 345 GETNLKIKQ 353

>KLLA0C08393g 734655..738101 highly similar to sp|P40527
           Saccharomyces cerevisiae YIL048w NEO1 ATPase whose
           overproduction confers neomycin resistance, start by
           similarity
          Length = 1148

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 5/83 (6%)

Query: 748 YLAIDDKVCGRFELLDEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIPPNN 807
           +L  D ++ G   + D+++ D K  I  LRN   +++M+TGD  ++A  V+    +    
Sbjct: 732 FLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRG 791

Query: 808 VYSEVT-----PDGKSQTVEYLR 825
            Y         P+G    +EYL+
Sbjct: 792 QYVHTVTKVNKPEGALHHLEYLQ 814

>YMR038C (LYS7) [4002] chr13 complement(347510..348259) Copper
          chaperone for superoxide dismutase Sod1p [750 bp, 249
          aa]
          Length = 249

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 35/61 (57%), Gaps = 5/61 (8%)

Query: 11 MTCASCVNAVVGQVEALEGVSSCDVSLVTSECKVVS-EDSVATDGIIEAVEDCGFDCELI 69
          M C +CVN +   ++ + G++S +  +   E +++S E SVA   II  + +CG D  +I
Sbjct: 15 MHCENCVNDIKACLKNVPGINSLNFDI---EQQIMSVESSVAPSTIINTLRNCGKDA-II 70

Query: 70 R 70
          R
Sbjct: 71 R 71

>CAGL0G06270g 598357..602343 highly similar to sp|P39524
           Saccharomyces cerevisiae YAL026c DRS2, start by
           similarity
          Length = 1328

 Score = 31.2 bits (69), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 55/278 (19%), Positives = 107/278 (38%), Gaps = 79/278 (28%)

Query: 432 LEVGDIAMVKPGAKIPSDGIV-----TKGISEVDESLMTGETNLVVKEIGS--------- 477
           ++VGDI  V     IP+D I+      +G+  ++ + + GETNL +K+  +         
Sbjct: 285 IKVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDSR 344

Query: 478 ---------------------------------------VVTGGTINGSGLIYFEVTSVG 498
                                                  ++ G T+  +G I+  V   G
Sbjct: 345 ELRNIKGVISSEQPNSSLYTYEGTLEMNGTKIPLSPEQMILRGATLRNTGWIFGIVIFTG 404

Query: 499 DDTKLANIIKVMKNAQ---LKKASIQRYTDY----VASIFVPTVLILSLLTFIVWTSLTR 551
            +TKL      M+NA    +K+ ++++  +     + ++ V  +LI S+   I+ T+   
Sbjct: 405 HETKL------MRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNVIMSTA--- 455

Query: 552 SEKIISKLSIFGETSESRFYMCLQIATSVVIVACPCALGLATP-----TAIMVGTGV--- 603
             K +S L + G      F+        +     P +L +         A M+G+ +   
Sbjct: 456 DAKHLSYLYLQGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLY 515

Query: 604 --ASENGVLIKGGDVLEKFNEVNTFVFDKTGTLTTGHM 639
              ++   ++K   ++E+  ++     DKTGTLT   M
Sbjct: 516 YEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIM 553

>Kwal_23.5789
          Length = 1133

 Score = 31.2 bits (69), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 35/165 (21%), Positives = 60/165 (36%), Gaps = 59/165 (35%)

Query: 748 YLAIDDKVCGRFELLDEVKSDAKDVIRYLRNNNYEVFMVTGD------------------ 789
           +L  D ++ G   + D+++ D K  I  LRN   +++M+TGD                  
Sbjct: 716 HLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLVSRG 775

Query: 790 ----------------THKSAMKVA------------------------EMVDIPPNNVY 809
                           TH   +K+                         E+V   P  + 
Sbjct: 776 QYVHTVTKVNKPEGALTHLELLKINTNSCLLIDGESLGLYLEYYRQQFFEIVVNLPAVIA 835

Query: 810 SEVTPDGKSQTVEYLRE-EGRVIAFIGDGINDSLALVTSDLGIAI 853
              TP  K+    ++RE  G+ +  IGDG ND   + ++D+G+ I
Sbjct: 836 CRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSADVGVGI 880

>Kwal_26.7070
          Length = 1315

 Score = 30.8 bits (68), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 55/275 (20%), Positives = 106/275 (38%), Gaps = 73/275 (26%)

Query: 432 LEVGDIAMVKPGAKIPSDGIV-----TKGISEVDESLMTGETNLVVKEI----------- 475
           + VGDI  V     IP+D IV      +G+  ++ + + GETNL +K+            
Sbjct: 301 ISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSKFIDKD 360

Query: 476 ------GSVVT-------------------------------GGTINGSGLIYFEVTSVG 498
                 G V++                               G T+  +  IY  V   G
Sbjct: 361 DLAGMRGKVLSEHPNSSLYTYEGTMNLNGKNISLSPEQMVLRGATLRNTAWIYGLVVFTG 420

Query: 499 DDTKLANIIKVMKNAQ---LKKASIQRYTDYVASIFVPTVLILSLLTFI-VWTSLTRSEK 554
            +TKL      M+NA    +K+ +++R  +         +++L+L++ I     +T   +
Sbjct: 421 HETKL------MRNATATPIKRTAVERVINMQIVALFGVLIVLALISSIGNVIKVTSDAE 474

Query: 555 IISKLSIFGETSESRFYMCLQIATSVVIVACPCALGLATP-----TAIMVGTGV-----A 604
            ++ L + G      F+  +     +     P +L +         A M+ + +     A
Sbjct: 475 HLTYLYLQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLYDEA 534

Query: 605 SENGVLIKGGDVLEKFNEVNTFVFDKTGTLTTGHM 639
           S++  +++   ++E+  ++     DKTGTLT   M
Sbjct: 535 SDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVM 569

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.136    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 29,784,440
Number of extensions: 1237112
Number of successful extensions: 3943
Number of sequences better than 10.0: 69
Number of HSP's gapped: 3865
Number of HSP's successfully gapped: 127
Length of query: 997
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 886
Effective length of database: 12,753,511
Effective search space: 11299610746
Effective search space used: 11299610746
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)