Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M08580g19719410091e-142
YDR273W (DON1)365691164e-07
Kwal_55.21587464461103e-06
KLLA0F15994g427521094e-06
CAGL0L09933g408611085e-06
YOR042W (CUE5)411591085e-06
Scas_615.8d581371086e-06
Scas_699.4545072934e-04
ACR083C37554934e-04
Kwal_34.158319137640.60
YML097C (VPS9)45155642.1
Scas_626.847555632.8
YOL138C134177623.8
CAGL0M08866g54963606.2
KLLA0F24618g55657598.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M08580g
         (194 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M08580g complement(855443..856036) weakly similar to tr|Q08...   393   e-142
YDR273W (DON1) [1104] chr4 (1010168..1011265) Component of the p...    49   4e-07
Kwal_55.21587                                                          47   3e-06
KLLA0F15994g complement(1484383..1485666) weakly similar to sgd|...    47   4e-06
CAGL0L09933g 1067488..1068714 similar to tr|Q08412 Saccharomyces...    46   5e-06
YOR042W (CUE5) [4853] chr15 (408424..409659) Protein containing ...    46   5e-06
Scas_615.8d                                                            46   6e-06
Scas_699.45                                                            40   4e-04
ACR083C [1130] [Homologous to ScYOR042W - SH; ScYDR273W (DON1) -...    40   4e-04
Kwal_34.15831                                                          29   0.60 
YML097C (VPS9) [3874] chr13 complement(78335..79690) Protein inv...    29   2.1  
Scas_626.8                                                             29   2.8  
YOL138C (YOL138C) [4686] chr15 complement(61324..65349) Possible...    28   3.8  
CAGL0M08866g 884842..886491 similar to tr|Q03370 Saccharomyces c...    28   6.2  
KLLA0F24618g complement(2288943..2290613) similar to sp|P38070 S...    27   8.6  

>CAGL0M08580g complement(855443..856036) weakly similar to tr|Q08412
           Saccharomyces cerevisiae YOR042w, hypothetical start
          Length = 197

 Score =  393 bits (1009), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 194/194 (100%), Positives = 194/194 (100%)

Query: 1   MSIDGYSYLQKYLVFADIKQLNTEVEQNVHYEKLVKAFPTVDKLIIRAILLAARGDLAPA 60
           MSIDGYSYLQKYLVFADIKQLNTEVEQNVHYEKLVKAFPTVDKLIIRAILLAARGDLAPA
Sbjct: 1   MSIDGYSYLQKYLVFADIKQLNTEVEQNVHYEKLVKAFPTVDKLIIRAILLAARGDLAPA 60

Query: 61  FNALLSLTGEDIQLGLPMRRYEFLPDKTLMEQALRAKQEDMLEQLSQLQEPSSKAKSAGS 120
           FNALLSLTGEDIQLGLPMRRYEFLPDKTLMEQALRAKQEDMLEQLSQLQEPSSKAKSAGS
Sbjct: 61  FNALLSLTGEDIQLGLPMRRYEFLPDKTLMEQALRAKQEDMLEQLSQLQEPSSKAKSAGS 120

Query: 121 ETKEKSVPTGDGVSTEAMTGEAQSEPQMMENNAEDPKDITDKGLISDTKSEEANISVVEP 180
           ETKEKSVPTGDGVSTEAMTGEAQSEPQMMENNAEDPKDITDKGLISDTKSEEANISVVEP
Sbjct: 121 ETKEKSVPTGDGVSTEAMTGEAQSEPQMMENNAEDPKDITDKGLISDTKSEEANISVVEP 180

Query: 181 QVENGKSVNPFELL 194
           QVENGKSVNPFELL
Sbjct: 181 QVENGKSVNPFELL 194

>YDR273W (DON1) [1104] chr4 (1010168..1011265) Component of the
           prospore membrane [1098 bp, 365 aa]
          Length = 365

 Score = 49.3 bits (116), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 42/69 (60%), Gaps = 2/69 (2%)

Query: 13  LVFADIKQLNTEVEQNVHYEKLVKAFPTVDKLIIRAILLAARGDLAPAFNALLSLTG--E 70
           L +  I  L + VE+    ++L  AFP VD  +I+AIL+A++G L PAFN+LL  +   E
Sbjct: 69  LDYPTIGDLVSSVEKLCVLKELKIAFPEVDDTLIKAILIASQGVLEPAFNSLLYYSSPEE 128

Query: 71  DIQLGLPMR 79
           +    LPM+
Sbjct: 129 NTDFALPMK 137

>Kwal_55.21587
          Length = 464

 Score = 47.0 bits (110), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 32/46 (69%), Gaps = 4/46 (8%)

Query: 27  QNVHYE----KLVKAFPTVDKLIIRAILLAARGDLAPAFNALLSLT 68
           QNVH      +L +AFP +D   ++A+L+A++G L PAFNALL L+
Sbjct: 109 QNVHENPILAQLTEAFPGIDAKYVKAVLIASQGALDPAFNALLFLS 154

>KLLA0F15994g complement(1484383..1485666) weakly similar to
           sgd|S0005568 Saccharomyces cerevisiae YOR042w, start by
           similarity
          Length = 427

 Score = 46.6 bits (109), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 36/52 (69%)

Query: 27  QNVHYEKLVKAFPTVDKLIIRAILLAARGDLAPAFNALLSLTGEDIQLGLPM 78
           +N   ++L +AFP +++  ++A+L+A++G L PAFNALL ++  D +   P+
Sbjct: 91  ENPMLKQLKEAFPNIEEKYVKAVLIASQGQLDPAFNALLFISDPDFEKEAPL 142

>CAGL0L09933g 1067488..1068714 similar to tr|Q08412 Saccharomyces
           cerevisiae YOR042w, hypothetical start
          Length = 408

 Score = 46.2 bits (108), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 39/61 (63%), Gaps = 13/61 (21%)

Query: 33  KLVKAFPTVDKLIIRAILLAARGDLAPAFNALLSL----TGEDIQL---------GLPMR 79
           +L +AFP +++  ++A+++A++G L PAFNALL L    +G+DI+L          LP R
Sbjct: 82  QLKEAFPNIEEQYVKAVIIASQGALDPAFNALLFLSDPESGKDIELPREPVQQNPSLPPR 141

Query: 80  R 80
           R
Sbjct: 142 R 142

>YOR042W (CUE5) [4853] chr15 (408424..409659) Protein containing a
           CUE domain, has low similarity to uncharacterized C.
           albicans Orf6.1738p [1236 bp, 411 aa]
          Length = 411

 Score = 46.2 bits (108), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 41/59 (69%), Gaps = 5/59 (8%)

Query: 32  EKLVKAFPTVDKLIIRAILLAARGDLAPAFNALLSL----TGEDIQLGL-PMRRYEFLP 85
           ++L  AFP +++  I+A+++A++G L+PAFNALL L    +G+DI+L   P+R+    P
Sbjct: 103 QELKDAFPNLEEKYIKAVIIASQGVLSPAFNALLFLSDPESGKDIELPTQPVRKNPEAP 161

>Scas_615.8d
          Length = 581

 Score = 46.2 bits (108), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 29/37 (78%)

Query: 34  LVKAFPTVDKLIIRAILLAARGDLAPAFNALLSLTGE 70
           L KAFP+VD  +I+++L A+ G++ PAF+ALL LT +
Sbjct: 287 LAKAFPSVDINVIKSLLFASEGEVLPAFHALLFLTNQ 323

>Scas_699.45
          Length = 450

 Score = 40.4 bits (93), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 40/72 (55%), Gaps = 15/72 (20%)

Query: 24  EVEQNVHYEKLVKAFPTVDKLIIRAILLAARGDLAPAFNALLSL----TGEDIQL----- 74
           E  +N   ++L +AFP +++  ++ +L+A++G L PAF ALL L    + +DI+L     
Sbjct: 108 EESENPILKQLKEAFPNIEEKYVKTVLIASQGALDPAFEALLFLSDPNSSKDIELPTKPI 167

Query: 75  ------GLPMRR 80
                  LP RR
Sbjct: 168 AANATPALPQRR 179

>ACR083C [1130] [Homologous to ScYOR042W - SH; ScYDR273W (DON1) -
           SH] (505794..506921) [1128 bp, 375 aa]
          Length = 375

 Score = 40.4 bits (93), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 36/54 (66%), Gaps = 5/54 (9%)

Query: 20  QLNTEVEQNVHYE-----KLVKAFPTVDKLIIRAILLAARGDLAPAFNALLSLT 68
           Q + E EQ +  E     +L  AFP V++ I++A+++A++G L PAF+ALL L+
Sbjct: 87  QPSAEREQTLPKENSILSELKAAFPNVEEKIVKAVIIASQGILDPAFSALLFLS 140

>Kwal_34.15831
          Length = 91

 Score = 29.3 bits (64), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 3/37 (8%)

Query: 98  QEDMLEQLS---QLQEPSSKAKSAGSETKEKSVPTGD 131
           +ED+LE      +LQ  +SKA  AG++ KE   PTGD
Sbjct: 6   EEDLLEYSDNEQELQVEASKAAEAGTDAKESGEPTGD 42

>YML097C (VPS9) [3874] chr13 complement(78335..79690) Protein
           involved in vacuolar sorting [1356 bp, 451 aa]
          Length = 451

 Score = 29.3 bits (64), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 29/55 (52%), Gaps = 3/55 (5%)

Query: 17  DIKQLNTEVEQNVHYEKL---VKAFPTVDKLIIRAILLAARGDLAPAFNALLSLT 68
           D+  L  ++E+N   + L      FP +D  +I  + +A +  + P  +ALLSL+
Sbjct: 396 DVSSLIKKIEENERKDTLNTLQNMFPDMDPSLIEDVCIAKKSRIGPCVDALLSLS 450

>Scas_626.8
          Length = 475

 Score = 28.9 bits (63), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 3/55 (5%)

Query: 17  DIKQLNTEVEQNVHYEKL---VKAFPTVDKLIIRAILLAARGDLAPAFNALLSLT 68
           DI  L   +E+N + E L      FP +DK +I  + +A +  + P  + LL+L+
Sbjct: 420 DISHLVQRMEENENQETLDTLQSMFPGMDKELIEDVCIAKKYRIGPCVDILLTLS 474

>YOL138C (YOL138C) [4686] chr15 complement(61324..65349) Possible
           component of a glycogen synthase kinase, homozygous
           diploid null mutant accumulates glycogen [4026 bp, 1341
           aa]
          Length = 1341

 Score = 28.5 bits (62), Expect = 3.8,   Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 30/77 (38%), Gaps = 2/77 (2%)

Query: 103 EQLSQLQEPSSKAKSAGSETKE-KSVPTGDGVSTEAMTGEAQSEPQMMENNAEDPKDITD 161
           +  S +    S    AG   K  K  P  DG  T       +  PQ    N+++P D  +
Sbjct: 895 DNASNMDANESSDFEAGENLKTGKEFPEEDGAGTSGAESLVEERPQAFRANSDEPSD-AE 953

Query: 162 KGLISDTKSEEANISVV 178
           K  +S  K +  N  ++
Sbjct: 954 KKPVSKLKEQLKNTEII 970

>CAGL0M08866g 884842..886491 similar to tr|Q03370 Saccharomyces
           cerevisiae YDR479c, start by similarity
          Length = 549

 Score = 27.7 bits (60), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 7/63 (11%)

Query: 107 QLQEPSSKAKSAGSETKEKSVPTGDGVSTEAMTGEAQSEPQMMEN--NAEDPKDITDKGL 164
           +L+E S+  +S   ET  +S+    GVS  +M+G  ++E  + EN    ED   ITD  +
Sbjct: 486 KLREVSNPLRS--DETHSRSI---HGVSKGSMSGNVKTEADIEENAFTDEDDSHITDDSI 540

Query: 165 ISD 167
            S+
Sbjct: 541 ASN 543

>KLLA0F24618g complement(2288943..2290613) similar to sp|P38070
           Saccharomyces cerevisiae YBR028c, start by similarity
          Length = 556

 Score = 27.3 bits (59), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 6/57 (10%)

Query: 74  LGLPMRRYEF------LPDKTLMEQALRAKQEDMLEQLSQLQEPSSKAKSAGSETKE 124
           + LP+ + +F      LP  T  E+AL +  E+  E +S    P    +S  S+TKE
Sbjct: 47  MNLPLHKNQFRMDLSALPPNTYEEEALISDTEEQAEMMSGFLVPPDSGESKQSQTKE 103

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.309    0.128    0.337 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,926,579
Number of extensions: 232980
Number of successful extensions: 1198
Number of sequences better than 10.0: 111
Number of HSP's gapped: 1192
Number of HSP's successfully gapped: 122
Length of query: 194
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 98
Effective length of database: 13,272,781
Effective search space: 1300732538
Effective search space used: 1300732538
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 59 (27.3 bits)