Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M07854g1051045333e-72
Kwal_33.155171101032175e-24
Scas_647.16*1361112048e-22
Sklu_1420.51071031881e-19
ACL125C1061061714e-17
YJR022W (LSM8)1091041654e-16
KLLA0E16511g96601244e-10
Scas_704.53d22332640.40
YFL017W-A (SMX2)7743590.98
AFR511C7671591.0
Sklu_2326.841968611.4
KLLA0D07678g7133571.7
KLLA0E22968g11036581.8
Scas_693.37168364592.6
YGR110W44546582.8
YJL124C (LSM1)17283573.7
KLLA0E15224g17997573.8
Scas_716.644026574.2
CAGL0D02332g84330565.6
CAGL0J05764g11736555.6
AFR053C11736555.6
AGR194W64239565.9
Sklu_975.144129557.1
Scas_721.1464639557.7
Sklu_2405.764839558.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M07854g
         (104 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M07854g 785153..785470 similar to sp|P47093 Saccharomyces c...   209   3e-72
Kwal_33.15517                                                          88   5e-24
Scas_647.16*                                                           83   8e-22
Sklu_1420.5 YJR022W, Contig c1420 3327-3650 reverse complement         77   1e-19
ACL125C [924] [Homologous to ScYJR022W (LSM8) - SH] (128649..128...    70   4e-17
YJR022W (LSM8) [2923] chr10 (469698..470027) U6 snRNA-associated...    68   4e-16
KLLA0E16511g complement(1467758..1468048) weakly similar to sp|P...    52   4e-10
Scas_704.53d                                                           29   0.40 
YFL017W-A (SMX2) [1665] chr6 (103693..103926) Spliceosomal snRNA...    27   0.98 
AFR511C [3703] [Homologous to ScYFL017W-A (SMX2) - SH] (1352140....    27   1.0  
Sklu_2326.8 YKL004W, Contig c2326 11961-13220 reverse complement       28   1.4  
KLLA0D07678g 660221..660436 similar to sp|P40204 Saccharomyces c...    27   1.7  
KLLA0E22968g join(2038281..2038292,2038423..2038743) similar to ...    27   1.8  
Scas_693.37                                                            27   2.6  
YGR110W (YGR110W) [2069] chr7 (713711..715048) Member of the alp...    27   2.8  
YJL124C (LSM1) [2795] chr10 complement(187046..187564) Protein o...    27   3.7  
KLLA0E15224g 1349357..1349896 similar to sp|P47017 Saccharomyces...    27   3.8  
Scas_716.6                                                             27   4.2  
CAGL0D02332g 239710..242241 similar to tr|Q12102 Saccharomyces c...    26   5.6  
CAGL0J05764g join(548548..548559,548727..549068) highly similar ...    26   5.6  
AFR053C [3245] [Homologous to ScYNL147W (LSM7) - SH] (524978..52...    26   5.6  
AGR194W [4505] [Homologous to ScYPL093W (NOG1) - SH] complement(...    26   5.9  
Sklu_975.1 YBL086C, Contig c975 439-1764                               26   7.1  
Scas_721.14                                                            26   7.7  
Sklu_2405.7 YPL093W, Contig c2405 13698-15644 reverse complement       26   8.7  

>CAGL0M07854g 785153..785470 similar to sp|P47093 Saccharomyces
           cerevisiae YJR022w pre-mRNA splicing factor,
           hypothetical start
          Length = 105

 Score =  209 bits (533), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 104/104 (100%), Positives = 104/104 (100%)

Query: 1   MSPLLKQYLNKDIVVVTTAGEVMHVVLDGYDKYTNLVVKEGDKIRLLRGSEIVVCGLLED 60
           MSPLLKQYLNKDIVVVTTAGEVMHVVLDGYDKYTNLVVKEGDKIRLLRGSEIVVCGLLED
Sbjct: 1   MSPLLKQYLNKDIVVVTTAGEVMHVVLDGYDKYTNLVVKEGDKIRLLRGSEIVVCGLLED 60

Query: 61  AKALEGLPMDSHVYKDTKNVIKDEYLIWEAVNKKHQSTHKKRKL 104
           AKALEGLPMDSHVYKDTKNVIKDEYLIWEAVNKKHQSTHKKRKL
Sbjct: 61  AKALEGLPMDSHVYKDTKNVIKDEYLIWEAVNKKHQSTHKKRKL 104

>Kwal_33.15517
          Length = 110

 Score = 88.2 bits (217), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 47/103 (45%), Positives = 68/103 (66%), Gaps = 12/103 (11%)

Query: 1   MSPLLKQYLNKDIVVVTTAGEVMHVVLDGYDKYTNLVVK------EGDKIR---LLRGSE 51
           MSPLLK +LNK IV++TT G+ +   L+G+DK TNL++        GD +    L+RG++
Sbjct: 1   MSPLLKDFLNKRIVIITTEGQCVTATLEGFDKSTNLLLSNVRERVSGDVVASSYLMRGNQ 60

Query: 52  IVVCGLLEDAKALEGLPMDSHVY---KDTKNVIKDEYLIWEAV 91
           +V CGLLE+A+ L        VY   KDTKN ++DE+LIW++V
Sbjct: 61  VVCCGLLEEAEGLGPDLTSDTVYTELKDTKNYVRDEHLIWQSV 103

>Scas_647.16*
          Length = 136

 Score = 83.2 bits (204), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 68/111 (61%), Gaps = 15/111 (13%)

Query: 1   MSPLLKQYLNKDIVVVTTAGEVMHVVLDGYDKYTNLVVKEG---------DKIRLLRGSE 51
           MSPLLK+YLNK +V++T  G+     L+G+DK TNL++              ++LLRGSE
Sbjct: 25  MSPLLKEYLNKKVVIITVEGQCFTANLEGFDKNTNLMLSNVRDRFNHELITSVQLLRGSE 84

Query: 52  IVVCGLLEDAKALEGLPMDSHV------YKDTKNVIKDEYLIWEAVNKKHQ 96
           +VVCGLLE+ +  +    DS V       KDTKN I +E+LIWE V K+ +
Sbjct: 85  VVVCGLLEEIEEGKKDVEDSGVIIPMVKLKDTKNRILNEHLIWEQVWKQKR 135

>Sklu_1420.5 YJR022W, Contig c1420 3327-3650 reverse complement
          Length = 107

 Score = 77.0 bits (188), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 44/103 (42%), Positives = 64/103 (62%), Gaps = 15/103 (14%)

Query: 1   MSPLLKQYLNKDIVVVTTAGEVMHVVLDGYDKYTNLVVKE------GDKIR---LLRGSE 51
           MSPLLK +LN+ IV VTT G+ +  +L G+DK TNL++ +      G  +    +LRGSE
Sbjct: 1   MSPLLKDFLNQRIVAVTTEGQCLVAMLQGFDKNTNLLLSDDHERFAGKAVSPAYILRGSE 60

Query: 52  IVVCGLLEDA---KALEGLPMDSHVYKDTKNVIKDEYLIWEAV 91
           +V CGLLE++   K  + +P      +DTKN + +E+LIW  V
Sbjct: 61  VVFCGLLEESAEEKFGDNVP---SPLRDTKNRVPNEHLIWRKV 100

>ACL125C [924] [Homologous to ScYJR022W (LSM8) - SH]
           (128649..128969) [321 bp, 106 aa]
          Length = 106

 Score = 70.5 bits (171), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 61/106 (57%), Gaps = 11/106 (10%)

Query: 1   MSPLLKQYLNKDIVVVTTAGEVMHVVLDGYDKYTNLVVKE------GDKIR---LLRGSE 51
           MSPLLK+YL + +VVVTT G  +   L+G+DK  NL++ +      G+ +    LL+GS+
Sbjct: 1   MSPLLKEYLGRRVVVVTTDGGCLVATLEGFDKTANLLLSDVRQRATGEGLAAAFLLQGSQ 60

Query: 52  IVVCGLLEDAKALEGLPMDSHVYKDTKNVIKDEYLIWEAVNKKHQS 97
           IV CG LE     E  P  +   +DT+NV+  E+ IW    +  Q+
Sbjct: 61  IVCCGPLEGGGP-EQEP-QAAALRDTRNVVAREHDIWARAWQARQA 104

>YJR022W (LSM8) [2923] chr10 (469698..470027) U6 snRNA-associated
           protein of the Sm-like group [330 bp, 109 aa]
          Length = 109

 Score = 68.2 bits (165), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 64/104 (61%), Gaps = 14/104 (13%)

Query: 1   MSPLLKQYLNKDIVVVTTAGEVMHVVLDGYDKYTNLVV--------KEG-DKIRLLRGSE 51
           MS  LK YLNK +V++   GE +   L+G+DK TNL +        KE   K +LLRGSE
Sbjct: 1   MSATLKDYLNKRVVIIKVDGECLIASLNGFDKNTNLFITNVFNRISKEFICKAQLLRGSE 60

Query: 52  IVVCGLLEDAKALEGL-PMDSH---VYKDTKNVIKDEYLIWEAV 91
           I + GL+ DA+  + L P+D     + KDTKN I++E++IWE V
Sbjct: 61  IALVGLI-DAENDDSLAPIDEKKVPMLKDTKNKIENEHVIWEKV 103

>KLLA0E16511g complement(1467758..1468048) weakly similar to
          sp|P47093 Saccharomyces cerevisiae YJR022w LSM8
          splicing factor singleton, start by similarity
          Length = 96

 Score = 52.4 bits (124), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 41/60 (68%)

Query: 1  MSPLLKQYLNKDIVVVTTAGEVMHVVLDGYDKYTNLVVKEGDKIRLLRGSEIVVCGLLED 60
          MS LLK YL+K +++V   G+  +  + G+D   N+++ +  KI ++R SE+V+CGL++D
Sbjct: 1  MSALLKDYLDKKVMLVNVDGDTYYGEMKGFDHAGNMILLKDSKICIIRSSEVVLCGLIDD 60

>Scas_704.53d
          Length = 223

 Score = 29.3 bits (64), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 20/32 (62%)

Query: 33  YTNLVVKEGDKIRLLRGSEIVVCGLLEDAKAL 64
           Y+N+++KEGD I +   SE+     +ED + L
Sbjct: 150 YSNILIKEGDYINISSQSELSSADEIEDEETL 181

>YFL017W-A (SMX2) [1665] chr6 (103693..103926) Spliceosomal
          snRNA-associated Sm core protein, also likely
          associated with telomerase TLC1 RNA [234 bp, 77 aa]
          Length = 77

 Score = 27.3 bits (59), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 26/43 (60%)

Query: 2  SPLLKQYLNKDIVVVTTAGEVMHVVLDGYDKYTNLVVKEGDKI 44
          +P LK+Y++K I++       +  +L GYD + N+V+ +  +I
Sbjct: 4  TPELKKYMDKKILLNINGSRKVAGILRGYDIFLNVVLDDAMEI 46

>AFR511C [3703] [Homologous to ScYFL017W-A (SMX2) - SH]
          (1352140..1352343,1352394..1352420) [231 bp, 76 aa]
          Length = 76

 Score = 27.3 bits (59), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 34/71 (47%), Gaps = 12/71 (16%)

Query: 2  SPLLKQYLNKDIVVVTTAGEVMHVVLDGYDKYTNLVVKEGDKI------------RLLRG 49
          +P LK+Y+ + + +       +  VL GYD + N+V+ +  +I             ++RG
Sbjct: 4  TPELKKYMERKVFLQLNGARKVVGVLRGYDLFLNVVLDDAVEITRTGGKHGLGDHTIIRG 63

Query: 50 SEIVVCGLLED 60
          + IV   LLE 
Sbjct: 64 NSIVSLELLES 74

>Sklu_2326.8 YKL004W, Contig c2326 11961-13220 reverse complement
          Length = 419

 Score = 28.1 bits (61), Expect = 1.4,   Method: Composition-based stats.
 Identities = 20/68 (29%), Positives = 28/68 (41%), Gaps = 6/68 (8%)

Query: 8   YLNKDIVVVTTAGEVMHVVLDGYDKYTNLVVKEGDKIRLLRGSEIVVCGLLE------DA 61
           YL     V   AG V+  V+  Y KY +L V           SE+V C + +      D 
Sbjct: 290 YLTHHYFVDLMAGSVLSYVIFQYTKYFHLPVANSSLFSRWSYSEVVKCNIFQMDPLFFDP 349

Query: 62  KALEGLPM 69
             +E LP+
Sbjct: 350 NDVETLPL 357

>KLLA0D07678g 660221..660436 similar to sp|P40204 Saccharomyces
          cerevisiae YFL017wa SNP2 snRNP G protein (the homologue
          of the human Sm-G) singleton, start by similarity
          Length = 71

 Score = 26.6 bits (57), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 20/33 (60%)

Query: 6  KQYLNKDIVVVTTAGEVMHVVLDGYDKYTNLVV 38
          KQY++K +++       +  +L GYD + NLV+
Sbjct: 5  KQYMDKKLILQLNGNRKIIGILRGYDAFLNLVL 37

>KLLA0E22968g join(2038281..2038292,2038423..2038743) similar to
          sp|P53905 Saccharomyces cerevisiae YNL147w LSM7 Sm-like
          (Lsm) protein singleton, start by similarity
          Length = 110

 Score = 26.9 bits (58), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 21/36 (58%)

Query: 5  LKQYLNKDIVVVTTAGEVMHVVLDGYDKYTNLVVKE 40
          L QY + ++ V    G ++  +L GYD+  NLV+ E
Sbjct: 29 LAQYKDTEVRVKFIGGRLVTGILKGYDELMNLVLDE 64

>Scas_693.37
          Length = 1683

 Score = 27.3 bits (59), Expect = 2.6,   Method: Composition-based stats.
 Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 2/64 (3%)

Query: 26  VLDGYDKYTNLVVKEGDKIRLLRGSEIVVCGLLEDAKALEGLPMDSHVYKDTKNVIKDEY 85
           +++ Y+KY  LVV   D ++LL    +       D ++ E LP+   + +  KN +KD+ 
Sbjct: 137 LIELYEKY--LVVLPSDTLKLLIRPLLASLFPGIDDESNEFLPLTMRLIETLKNNLKDDS 194

Query: 86  LIWE 89
           L W+
Sbjct: 195 LFWQ 198

>YGR110W (YGR110W) [2069] chr7 (713711..715048) Member of the alpha
           or beta hydrolase fold family, has weak similarity to S.
           cerevisiae Ecm18p, which may be involved in cell wall
           structure or biosynthesis [1338 bp, 445 aa]
          Length = 445

 Score = 26.9 bits (58), Expect = 2.8,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 4/46 (8%)

Query: 1   MSPLLKQYLNK--DIVVVTTAGEVMHVVLDGYDKYTNLVVKEGDKI 44
           +S  LK+ L +  ++++V  +G   H+ LD Y  + N++ KE  KI
Sbjct: 402 VSRFLKEKLKQKSNVIIVPHSGH--HLYLDNYKFFNNILTKEMQKI 445

>YJL124C (LSM1) [2795] chr10 complement(187046..187564) Protein of
           the Sm class of RNA-binding proteins involved in control
           of mRNA decay, involved in sensitivity to UV irradiation
           [519 bp, 172 aa]
          Length = 172

 Score = 26.6 bits (57), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 41/83 (49%), Gaps = 22/83 (26%)

Query: 9   LNKDIVVVTTAGEVMHVVLDGYDKYTNLVVK---------------EGDK-IRLLRGSEI 52
           +++ I V+   G ++  VL  +D+Y NL+++               E D+ I ++RG  +
Sbjct: 50  VDRKIFVLLRDGRMLFGVLRTFDQYANLILQDCVERIYFSEENKYAEEDRGIFMIRGENV 109

Query: 53  VVCGLL----EDA--KALEGLPM 69
           V+ G +    ED   +A+E +P 
Sbjct: 110 VMLGEVDIDKEDQPLEAMERIPF 132

>KLLA0E15224g 1349357..1349896 similar to sp|P47017 Saccharomyces
           cerevisiae YJL124c LSM1 Sm-like (Lsm) protein singleton,
           start by similarity
          Length = 179

 Score = 26.6 bits (57), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 49/97 (50%), Gaps = 23/97 (23%)

Query: 9   LNKDIVVVTTAGEVMHVVLDGYDKYTNLVVK--------EGDK--------IRLLRGSEI 52
           +++ I V+   G +   VL  +D+Y NL+++        EG+         + ++RG  +
Sbjct: 57  VDRKIFVLLRDGRMFFGVLRTFDQYANLILQHTVERIYIEGENKYGECDRGVFMIRGENV 116

Query: 53  VVCGLL----EDA--KALEGLPM-DSHVYKDTKNVIK 82
           V+ G +    EDA  +++E +P  ++  YK+  + +K
Sbjct: 117 VMLGEVDIDKEDAPLESMERVPFEEAESYKEKMDEVK 153

>Scas_716.6
          Length = 440

 Score = 26.6 bits (57), Expect = 4.2,   Method: Composition-based stats.
 Identities = 11/26 (42%), Positives = 17/26 (65%), Gaps = 2/26 (7%)

Query: 15  VVTTAGEVMHVVLDGYDKYTNLVVKE 40
           V+ +AG   H+ LD Y  + NL++KE
Sbjct: 412 VIPSAGH--HLYLDNYKAFNNLIIKE 435

>CAGL0D02332g 239710..242241 similar to tr|Q12102 Saccharomyces
           cerevisiae YLR115w CFT2 cleavage and polyadenylation
           specificity factor, start by similarity
          Length = 843

 Score = 26.2 bits (56), Expect = 5.6,   Method: Composition-based stats.
 Identities = 12/30 (40%), Positives = 18/30 (60%)

Query: 68  PMDSHVYKDTKNVIKDEYLIWEAVNKKHQS 97
           P   H+  D +  + D+Y+I EA NKK +S
Sbjct: 564 PSKRHINGDNEEDMDDDYVIKEASNKKIKS 593

>CAGL0J05764g join(548548..548559,548727..549068) highly similar
          to sp|P53905 Saccharomyces cerevisiae YNL147w LSM7
          Sm-like
          Length = 117

 Score = 25.8 bits (55), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 21/36 (58%)

Query: 5  LKQYLNKDIVVVTTAGEVMHVVLDGYDKYTNLVVKE 40
          L +Y +  + V    G ++  +L GYD+  NLV++E
Sbjct: 34 LGKYKDSKVSVKLMGGRIVTGILKGYDQLMNLVLEE 69

>AFR053C [3245] [Homologous to ScYNL147W (LSM7) - SH]
          (524978..525319,525374..525385) [354 bp, 117 aa]
          Length = 117

 Score = 25.8 bits (55), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 20/36 (55%)

Query: 5  LKQYLNKDIVVVTTAGEVMHVVLDGYDKYTNLVVKE 40
          L +Y +  + V    G ++  VL GYD+  NLV+ E
Sbjct: 33 LAKYQDTQVRVKLMGGRLVTGVLKGYDQLMNLVLDE 68

>AGR194W [4505] [Homologous to ScYPL093W (NOG1) - SH]
          complement(1118045..1119973) [1929 bp, 642 aa]
          Length = 642

 Score = 26.2 bits (56), Expect = 5.9,   Method: Composition-based stats.
 Identities = 13/39 (33%), Positives = 23/39 (58%)

Query: 11 KDIVVVTTAGEVMHVVLDGYDKYTNLVVKEGDKIRLLRG 49
          KDI  V T+ +++ +VL+   + T  V++ G KI  +R 
Sbjct: 6  KDIPTVPTSNDMLDIVLNRTQRKTPTVIRAGFKITRIRA 44

>Sklu_975.1 YBL086C, Contig c975 439-1764
          Length = 441

 Score = 25.8 bits (55), Expect = 7.1,   Method: Composition-based stats.
 Identities = 11/29 (37%), Positives = 19/29 (65%), Gaps = 4/29 (13%)

Query: 78  KNVIKDEYLI----WEAVNKKHQSTHKKR 102
           +N+ + EYL     WE +++KHQ+ HK +
Sbjct: 353 QNLDRREYLEKRSNWEMLSRKHQNIHKNK 381

>Scas_721.14
          Length = 646

 Score = 25.8 bits (55), Expect = 7.7,   Method: Composition-based stats.
 Identities = 13/39 (33%), Positives = 23/39 (58%)

Query: 11 KDIVVVTTAGEVMHVVLDGYDKYTNLVVKEGDKIRLLRG 49
          KDI  V+ A +++ +VL+   + T  V++ G KI  +R 
Sbjct: 6  KDIPTVSPANDLLDIVLNRTQRKTPTVIRPGFKITRIRA 44

>Sklu_2405.7 YPL093W, Contig c2405 13698-15644 reverse complement
          Length = 648

 Score = 25.8 bits (55), Expect = 8.7,   Method: Composition-based stats.
 Identities = 14/39 (35%), Positives = 22/39 (56%)

Query: 11 KDIVVVTTAGEVMHVVLDGYDKYTNLVVKEGDKIRLLRG 49
          KDI  V  A +++ +VL+   + T  VV+ G KI  +R 
Sbjct: 6  KDIPTVPPANDLLDIVLNRTQRKTPTVVRPGYKITRIRA 44

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.135    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,610,420
Number of extensions: 140237
Number of successful extensions: 422
Number of sequences better than 10.0: 36
Number of HSP's gapped: 412
Number of HSP's successfully gapped: 36
Length of query: 104
Length of database: 16,596,109
Length adjustment: 75
Effective length of query: 29
Effective length of database: 13,999,759
Effective search space: 405993011
Effective search space used: 405993011
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 54 (25.4 bits)