Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M07722g1267124862820.0
YMR012W (CLU1)1277122138050.0
Scas_709.561281125833930.0
Kwal_26.81611229121629930.0
ABR050W1228121327580.0
KLLA0F25322g1269126323450.0
AFR274C532104741.5
Sklu_1773.3233116721.6
YKL035W (UGP1)499117732.0
CAGL0F05489g48765713.5
Sklu_2077.3108981714.6
Sklu_2077.2108981714.6
KLLA0D18645g862120705.8
CAGL0D00924g198078697.6
CAGL0L11550g1072126688.2
KLLA0E03377g28763679.7
KLLA0B05181g332108679.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M07722g
         (1248 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M07722g complement(774048..777851) similar to sp|Q03690 Sac...  2424   0.0  
YMR012W (CLU1) [3976] chr13 (291133..294966) Translation initiat...  1470   0.0  
Scas_709.56                                                          1311   0.0  
Kwal_26.8161                                                         1157   0.0  
ABR050W [641] [Homologous to ScYMR012W (CLU1) - SH] complement(4...  1066   0.0  
KLLA0F25322g complement(2356566..2360375) similar to sp|Q03690 S...   907   0.0  
AFR274C [3466] [Homologous to ScYFR051C (RET2) - SH] (926088..92...    33   1.5  
Sklu_1773.3 YNR057C, Contig c1773 4329-5030                            32   1.6  
YKL035W (UGP1) [3221] chr11 (369534..371033) UDP-glucose pyropho...    33   2.0  
CAGL0F05489g 553902..555365 similar to tr|Q03944 Saccharomyces c...    32   3.5  
Sklu_2077.3 YML002W, Contig c2077 1119-4388                            32   4.6  
Sklu_2077.2 YML003W, Contig c2077 1119-4388                            32   4.6  
KLLA0D18645g complement(1571106..1573694) similar to sp|P22543 S...    32   5.8  
CAGL0D00924g 108341..114283 similar to sp|P25386 Saccharomyces c...    31   7.6  
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...    31   8.2  
KLLA0E03377g 316716..317579 no similarity, hypothetical start          30   9.7  
KLLA0B05181g complement(468267..469265) similar to sp|P36517 Sac...    30   9.9  

>CAGL0M07722g complement(774048..777851) similar to sp|Q03690
            Saccharomyces cerevisiae YMR012w translation initiation
            factor eIF3, hypothetical start
          Length = 1267

 Score = 2424 bits (6282), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1197/1248 (95%), Positives = 1197/1248 (95%)

Query: 1    MSQPSDIVKVIVALPTLXXXXXXXXXXXXXELEEITLQFRKDSKLQNVLDFLSIAPATKY 60
            MSQPSDIVKVIVALPTL             ELEEITLQFRKDSKLQNVLDFLSIAPATKY
Sbjct: 1    MSQPSDIVKVIVALPTLSKKPQQGKKKKSKELEEITLQFRKDSKLQNVLDFLSIAPATKY 60

Query: 61   FTNYNLKNSTGDLLLSSEEKTLRELCSDKDEYKVALELKPYNQYQALKHVLTSRDFFGFA 120
            FTNYNLKNSTGDLLLSSEEKTLRELCSDKDEYKVALELKPYNQYQALKHVLTSRDFFGFA
Sbjct: 61   FTNYNLKNSTGDLLLSSEEKTLRELCSDKDEYKVALELKPYNQYQALKHVLTSRDFFGFA 120

Query: 121  SETEDGLSNVAVSTGSKFYKLPLKEIKEKSPENEDKDTENKKPTSMNVTDEEKVEFNHMV 180
            SETEDGLSNVAVSTGSKFYKLPLKEIKEKSPENEDKDTENKKPTSMNVTDEEKVEFNHMV
Sbjct: 121  SETEDGLSNVAVSTGSKFYKLPLKEIKEKSPENEDKDTENKKPTSMNVTDEEKVEFNHMV 180

Query: 181  HGXXXXXXXXXXXXXXXXMNTDTSVVTPCLRSINFSPYNPVPAFYRTKGHLFYLQIVTLE 240
            HG                MNTDTSVVTPCLRSINFSPYNPVPAFYRTKGHLFYLQIVTLE
Sbjct: 181  HGLFETLKKEKKVLLKDLMNTDTSVVTPCLRSINFSPYNPVPAFYRTKGHLFYLQIVTLE 240

Query: 241  GESLQVTAIPSGFYINKSTTSKFDPSPKENDGHVDTVHYTLYDLLASSSKNFVTHISSLE 300
            GESLQVTAIPSGFYINKSTTSKFDPSPKENDGHVDTVHYTLYDLLASSSKNFVTHISSLE
Sbjct: 241  GESLQVTAIPSGFYINKSTTSKFDPSPKENDGHVDTVHYTLYDLLASSSKNFVTHISSLE 300

Query: 301  KKFDDLESVTYVRPACTTLNKPWLIPAIPTNGPDYLRTQIDSFNFEPERNFNDEFQSIKE 360
            KKFDDLESVTYVRPACTTLNKPWLIPAIPTNGPDYLRTQIDSFNFEPERNFNDEFQSIKE
Sbjct: 301  KKFDDLESVTYVRPACTTLNKPWLIPAIPTNGPDYLRTQIDSFNFEPERNFNDEFQSIKE 360

Query: 361  IPTNTLQARIESERIFAKLTHEFTINATKGAMDILYGNGTAMNPDSPLEEQIFLKNNIFY 420
            IPTNTLQARIESERIFAKLTHEFTINATKGAMDILYGNGTAMNPDSPLEEQIFLKNNIFY
Sbjct: 361  IPTNTLQARIESERIFAKLTHEFTINATKGAMDILYGNGTAMNPDSPLEEQIFLKNNIFY 420

Query: 421  SFVGDLNQTYADKGGDEAAIASANQDXXXXXXXXXXXXPNIHHLLTTIVDFGGKRILAQT 480
            SFVGDLNQTYADKGGDEAAIASANQD            PNIHHLLTTIVDFGGKRILAQT
Sbjct: 421  SFVGDLNQTYADKGGDEAAIASANQDLRTLNMLTRLNLPNIHHLLTTIVDFGGKRILAQT 480

Query: 481  PVPGLLSPMGVKIXXXXXXXXXXVSELSSDICVKYGLDENEKKVVFNEEFDEILNDQFAK 540
            PVPGLLSPMGVKI          VSELSSDICVKYGLDENEKKVVFNEEFDEILNDQFAK
Sbjct: 481  PVPGLLSPMGVKITTNEETKEETVSELSSDICVKYGLDENEKKVVFNEEFDEILNDQFAK 540

Query: 541  SFHLKKHTIQGTELVFSSQSKGIVGSDKRHYILDLANTYPLDVEFAKENFDDVKEASKKY 600
            SFHLKKHTIQGTELVFSSQSKGIVGSDKRHYILDLANTYPLDVEFAKENFDDVKEASKKY
Sbjct: 541  SFHLKKHTIQGTELVFSSQSKGIVGSDKRHYILDLANTYPLDVEFAKENFDDVKEASKKY 600

Query: 601  PHRQTLIRPELVEKWWATKIENDKVELVKAYEENLYSYNPDAYQVPGVEDETVVEISKYL 660
            PHRQTLIRPELVEKWWATKIENDKVELVKAYEENLYSYNPDAYQVPGVEDETVVEISKYL
Sbjct: 601  PHRQTLIRPELVEKWWATKIENDKVELVKAYEENLYSYNPDAYQVPGVEDETVVEISKYL 660

Query: 661  NEEIIPNVVQDYLNGNIISPYNGEHLADTFHKNGVNMRYLGKFANLVKEELRKQEEAHEA 720
            NEEIIPNVVQDYLNGNIISPYNGEHLADTFHKNGVNMRYLGKFANLVKEELRKQEEAHEA
Sbjct: 661  NEEIIPNVVQDYLNGNIISPYNGEHLADTFHKNGVNMRYLGKFANLVKEELRKQEEAHEA 720

Query: 721  KLAQVIVDNKEYEEWEKSYLQKIETMIKERQAKINKLVQEGKEVPKELTEDLKLDDNEIK 780
            KLAQVIVDNKEYEEWEKSYLQKIETMIKERQAKINKLVQEGKEVPKELTEDLKLDDNEIK
Sbjct: 721  KLAQVIVDNKEYEEWEKSYLQKIETMIKERQAKINKLVQEGKEVPKELTEDLKLDDNEIK 780

Query: 781  KPSTEKPVVVSYDELVPLIKTAELEIISRSLKHILRKYSRSLPPIVIPALISFVFNLLFG 840
            KPSTEKPVVVSYDELVPLIKTAELEIISRSLKHILRKYSRSLPPIVIPALISFVFNLLFG
Sbjct: 781  KPSTEKPVVVSYDELVPLIKTAELEIISRSLKHILRKYSRSLPPIVIPALISFVFNLLFG 840

Query: 841  TTYNPAPAVESVDPLYPVDQYEFKNLTHDTLLKEIEQEAVVRYRYELEGDWFAEHELYPF 900
            TTYNPAPAVESVDPLYPVDQYEFKNLTHDTLLKEIEQEAVVRYRYELEGDWFAEHELYPF
Sbjct: 841  TTYNPAPAVESVDPLYPVDQYEFKNLTHDTLLKEIEQEAVVRYRYELEGDWFAEHELYPF 900

Query: 901  TLIRSICNKFGVQLLNKDYFFSTEQLEEYKQSLDKKSRAKYVAPLTTFSVSDLTVIPKIK 960
            TLIRSICNKFGVQLLNKDYFFSTEQLEEYKQSLDKKSRAKYVAPLTTFSVSDLTVIPKIK
Sbjct: 901  TLIRSICNKFGVQLLNKDYFFSTEQLEEYKQSLDKKSRAKYVAPLTTFSVSDLTVIPKIK 960

Query: 961  AIDYSSPISEELWSQGASIINENQKDGLTLLAQSIGFKEEVNSILHSSVAEKYLTLSTIY 1020
            AIDYSSPISEELWSQGASIINENQKDGLTLLAQSIGFKEEVNSILHSSVAEKYLTLSTIY
Sbjct: 961  AIDYSSPISEELWSQGASIINENQKDGLTLLAQSIGFKEEVNSILHSSVAEKYLTLSTIY 1020

Query: 1021 NKLGLNAEAIAFCRKSCAIYERVCGVDSFELLRALTNLATLEFANESPYNVALIYQRIIQ 1080
            NKLGLNAEAIAFCRKSCAIYERVCGVDSFELLRALTNLATLEFANESPYNVALIYQRIIQ
Sbjct: 1021 NKLGLNAEAIAFCRKSCAIYERVCGVDSFELLRALTNLATLEFANESPYNVALIYQRIIQ 1080

Query: 1081 TVSGYGLDKIHHPIFTNIFNYLEQLSLGVQDAKLAVEVLKSLGDFLVSIDGTESLPYAYI 1140
            TVSGYGLDKIHHPIFTNIFNYLEQLSLGVQDAKLAVEVLKSLGDFLVSIDGTESLPYAYI
Sbjct: 1081 TVSGYGLDKIHHPIFTNIFNYLEQLSLGVQDAKLAVEVLKSLGDFLVSIDGTESLPYAYI 1140

Query: 1141 KSKLGNLLAADNRFSDALNQIKVAERIFTKELGTNHGSTAQARQWVDGLTNLIKDVNQKK 1200
            KSKLGNLLAADNRFSDALNQIKVAERIFTKELGTNHGSTAQARQWVDGLTNLIKDVNQKK
Sbjct: 1141 KSKLGNLLAADNRFSDALNQIKVAERIFTKELGTNHGSTAQARQWVDGLTNLIKDVNQKK 1200

Query: 1201 QLQQDQTAASGLKQQPQKSKSGHNKKETTNPDLADKSVDELLSFIEGE 1248
            QLQQDQTAASGLKQQPQKSKSGHNKKETTNPDLADKSVDELLSFIEGE
Sbjct: 1201 QLQQDQTAASGLKQQPQKSKSGHNKKETTNPDLADKSVDELLSFIEGE 1248

>YMR012W (CLU1) [3976] chr13 (291133..294966) Translation initiation
            factor eIF3, p135 subunit [3834 bp, 1277 aa]
          Length = 1277

 Score = 1470 bits (3805), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 704/1221 (57%), Positives = 910/1221 (74%), Gaps = 10/1221 (0%)

Query: 34   EITLQFRKDSKLQNVLDFLSIAPATKYFTNYNLKNSTGDLLLSSEEKTLRELCSDKDEYK 93
            +I+ +  K+SK+Q VLD L++ P++KY TN  LK   GD  LS +E +++E+  +K E K
Sbjct: 42   DISFEIGKESKIQTVLDVLAMIPSSKYLTNVGLKTIEGDSQLS-DEMSIKEIVGEKSELK 100

Query: 94   VALELKPYNQYQALKHVLTSRDFFGFASETEDGLSNVAVSTGSKFYKLPLKEIKEKSPE- 152
            + L LKPY+  +ALKHV+T RDF GFA ET DGLS  A+STGS F  LPL  IKE+S + 
Sbjct: 101  LQLILKPYSAREALKHVITVRDFIGFAQETSDGLSEFAISTGSSFSSLPLGPIKERSKQE 160

Query: 153  --NEDKDTENKKPTSMNVTDEEKVEFNHMVHGXXXXXXXXXXXXXXXXMNTDTSVVTPCL 210
              +E  D E KK T  +VTDEEK++FN MVH                 + ++++++TPC+
Sbjct: 161  EKDEKSDPEEKKNTFKDVTDEEKLKFNEMVH---EVFSSFKNSSINKLLTSESNIITPCV 217

Query: 211  RSINFSPYNPVPAFYRTKGHLFYLQIVTLEGESLQVTAIPSGFYINKSTTSKFDPSPKEN 270
            RS++F+PYNPVP FYR+KGHLFYLQIVTLEGES  +TAIPSGFY+NKS ++KFDPSPKEN
Sbjct: 218  RSLSFAPYNPVPPFYRSKGHLFYLQIVTLEGESFYITAIPSGFYVNKSNSTKFDPSPKEN 277

Query: 271  ---DGHVDTVHYTLYDLLASSSKNFVTHISSLEKKFDDLESVTYVRPACTTLNKPWLIPA 327
               + H   ++Y+L+DL+AS SK F++H+ + EKK   L+S +YVRP+ T L+KPW + +
Sbjct: 278  TDENAHSSLIYYSLFDLIASRSKKFISHVQAFEKKLSALDSTSYVRPSNTFLHKPWFVSS 337

Query: 328  IPTNGPDYLRTQIDSFNFEPERNFNDEFQSIKEIPTNTLQARIESERIFAKLTHEFTINA 387
            +P N PDYLR Q  + +  PERNFNDEFQ+IK++ T+TLQ RIE ER+F+K+ HEF++ A
Sbjct: 338  LPPNNPDYLRLQTAALDTTPERNFNDEFQAIKDLTTSTLQDRIEMERLFSKVVHEFSVTA 397

Query: 388  TKGAMDILYGNGTAMNPDSPLEEQIFLKNNIFYSFVGDLNQTYADKGGDEAAIASANQDX 447
              GAM I Y +  AMNP+SP  +QIFLK+NIFYS+V D++  Y  KGGDEAAIA++NQD 
Sbjct: 398  ASGAMSIFYSDFVAMNPESPTRDQIFLKDNIFYSYVSDVSGNYEGKGGDEAAIAASNQDL 457

Query: 448  XXXXXXXXXXXPNIHHLLTTIVDFGGKRILAQTPVPGLLSPMGVKIXXXXXXXXXXVSEL 507
                         + +LLTT+V+F G+RILAQTPVPGLL+ MG KI            + 
Sbjct: 458  KTINILNRLHMHEVRYLLTTVVEFAGRRILAQTPVPGLLATMGNKIVKDANTGEEVTEDF 517

Query: 508  SSDICVKYGLDENEKKVVFNEEFDEILNDQFAKSFHLKKHTIQGTELVFSSQSKGIVGSD 567
             +DI VKYGLDE   K+V++ +FD +L  +F K+FHLKKH + GTEL FSSQSKGIVG D
Sbjct: 518  VNDINVKYGLDEGLGKIVYDADFDSVLEKKFVKAFHLKKHKVNGTELAFSSQSKGIVGFD 577

Query: 568  KRHYILDLANTYPLDVEFAKENFDDVKEASKKYPHRQTLIRPELVEKWWATKIENDKVEL 627
            KR YILDLANTYPLD+ FA++NFD+++E   +YPHRQTL+RPELVEKWW  K+E + VE 
Sbjct: 578  KRRYILDLANTYPLDINFARQNFDNIEETGNRYPHRQTLLRPELVEKWWNNKVEKEGVEF 637

Query: 628  VKAYEENLYSYNPDAYQVPGVEDETVVEISKYLNEEIIPNVVQDYLNGNIISPYNGEHLA 687
             KAYEENL+SYNPDAYQV G+ED  V E+S YL +E+IP+V+QDYL+GN+ +PYNGEHLA
Sbjct: 638  EKAYEENLFSYNPDAYQVEGIEDANVDEMSNYLQKEVIPSVIQDYLSGNLSTPYNGEHLA 697

Query: 688  DTFHKNGVNMRYLGKFANLVKEELRKQEEAHEAKLAQVIVDNKEYEEWEKSYLQKIETMI 747
            DT HKNG+NMRYLGK   L ++EL  Q   +E  L  V  DNKEYE+WEKSYLQKIE MI
Sbjct: 698  DTLHKNGINMRYLGKIIELSQKELDSQIVHYEQNLKAVEQDNKEYEDWEKSYLQKIENMI 757

Query: 748  KERQAKINKLVQEGKEVPKELTEDLKLDDNEIKKPSTEKPVVVSYDELVPLIKTAELEII 807
            KERQAKINKLVQEGKEVPKELTEDLKL+D EIKKP+  KPVVV+YDELVPLIK +ELEI+
Sbjct: 758  KERQAKINKLVQEGKEVPKELTEDLKLNDEEIKKPTDGKPVVVAYDELVPLIKISELEIV 817

Query: 808  SRSLKHILRKYSRSLPPIVIPALISFVFNLLFGTTYNPAPAVESVDPLYPVDQYEFKNLT 867
            SRSLKH+L+  S+ +P  ++P+L+++VFN+L G  YN  P  E VD  YPV++  F  LT
Sbjct: 818  SRSLKHVLKDLSKDVPVFLVPSLVAYVFNMLVGINYNADPKPEPVDEFYPVNKCSFAKLT 877

Query: 868  HDTLLKEIEQEAVVRYRYELEGDWFAEHELYPFTLIRSICNKFGVQLLNKDYFFSTEQLE 927
               LL+ + ++A +R+R++L  +W   +   PFTLIRS+  KFG+QLLNK+YFF+ EQLE
Sbjct: 878  RSELLEAVSKQAFLRFRHQLPSNWIEAYMENPFTLIRSVSYKFGIQLLNKEYFFTREQLE 937

Query: 928  EYKQSLDKKSRAKYVAPLTTFSVSDLTVIPKIKAIDYSSPISEELWSQGASIINENQKDG 987
             YKQSLDKK R K+V P TTFS+SDLT+IP++K  +Y+S +SEE W+QGAS+INE+++  
Sbjct: 938  SYKQSLDKKIRNKFVEPPTTFSLSDLTIIPRVKFSEYTSSVSEEFWAQGASMINEDKQSA 997

Query: 988  LTLLAQSIGFKEEVNSILHSSVAEKYLTLSTIYNKLGLNAEAIAFCRKSCAIYERVCGVD 1047
            LTLLAQSI   E+VN+ILH +VAEKYL+LS IYNKL L  EAIAFCRK+C IYERV G+D
Sbjct: 998  LTLLAQSITVLEDVNNILHPAVAEKYLSLSAIYNKLALYPEAIAFCRKACTIYERVSGID 1057

Query: 1048 SFELLRALTNLATLEFANESPYNVALIYQRIIQTVSGYGLDKIHHPIFTNIFNYLEQLSL 1107
            SFE++RALTNLA LEF+NESPYN  ++Y R+ + +  Y L KIHHP  T+IFN+LEQL+L
Sbjct: 1058 SFEMMRALTNLAILEFSNESPYNATVVYNRLAEILKVYELPKIHHPAPTSIFNHLEQLAL 1117

Query: 1108 GVQDAKLAVEVLKSLGDFLVSIDGTESLPYAYIKSKLGNLLAADNRFSDALNQIKVAERI 1167
            GVQD KLA+EVL  L  ++V ++G +SL Y Y +S+LGNL AA   F  AL  I V + I
Sbjct: 1118 GVQDTKLAIEVLGQLSSYVVELEGKDSLAYGYTESRLGNLFAALKDFHRALEHITVTQGI 1177

Query: 1168 FTKELGTNHGSTAQARQWVDGLTNLIKDVNQKKQLQQDQTAASGLKQQPQKSKSGHNKKE 1227
            FTK+LG NH  +AQ+RQWV+GL++LI D+ QKKQL QDQ + +G      K  +   KK+
Sbjct: 1178 FTKQLGMNHTHSAQSRQWVNGLSSLIMDLKQKKQLAQDQMSTTGSNSAGHKKTNHRQKKD 1237

Query: 1228 TTNPDLADKSVDELLSFIEGE 1248
               P+LA+KSVDELL+FIEG+
Sbjct: 1238 DVKPELANKSVDELLTFIEGD 1258

>Scas_709.56
          Length = 1281

 Score = 1311 bits (3393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 661/1258 (52%), Positives = 877/1258 (69%), Gaps = 33/1258 (2%)

Query: 8    VKVIVALPTLXXXXXXXXXXXXXELEEITLQFRKDSKLQNVLDFLSIAPATKYFTNYNLK 67
            +K+ + LPTL             +  E+  QF KD+K++ +++ L+    TKY TN  L+
Sbjct: 19   IKISIKLPTLAHSHHHHAKKSNNKKNELLFQFNKDAKVETIINVLAFTEQTKYLTNIQLR 78

Query: 68   NSTGDLLLSSEEKTLRELCSDK--DEYKVALELKPYNQYQALKHVLTSRDFFGFASETED 125
                D +L+ EE T+ ++ + K  D   +++E+KPY    +LKH+LT RDF GFASET D
Sbjct: 79   --WNDKILN-EEDTIFDVINGKVSDMVHLSIEVKPYTARDSLKHLLTVRDFIGFASETSD 135

Query: 126  GLSNVAVSTGSKFYKLPLKEIKEKSPENE---DKDTENK--KPTSMNVTDEEKVEFNHMV 180
            GLS  AVSTGSKF +LPL EI+  + E E   D+  E+K  K     V+DEEK  F  +V
Sbjct: 136  GLSEFAVSTGSKFTELPLGEIRVPTAEEEEQKDEAAEDKEVKKNVFKVSDEEKDNFAKVV 195

Query: 181  HGXXXXXXXXXXXXXXXXMNTDTSVVTPCLRSINFSPYNPVPAFYRTKGHLFYLQIVTLE 240
            H                 +  D++VVTPC+RS+  S YNPVP FY+++GHLFYLQ+VTLE
Sbjct: 196  H---EIFESSKKTTINQVLTADSNVVTPCVRSLTLSAYNPVPVFYKSQGHLFYLQVVTLE 252

Query: 241  GESLQVTAIPSGFYINKSTTSKFDPSPKENDGHVD--TVHYTLYDLLASSSKNFVTHISS 298
            GE+  VTA  SGFYINKST++KFDPS + ++ H +   + Y+LYDLLAS SK FV+H+ +
Sbjct: 253  GETFHVTATQSGFYINKSTSTKFDPSERLSEEHNNESKIFYSLYDLLASHSKKFVSHVET 312

Query: 299  LEKKFDDLESVTYVRPACTTLNKPWLIPAIPTNGPDYLRTQIDSFNFEPERNFNDEFQSI 358
             EKK   +ESV+YV+P  T L+KPWL+   PTN PD+ R Q+DS N   E NFND+FQ+I
Sbjct: 313  FEKKLAGMESVSYVKPVSTFLHKPWLVTP-PTNPPDFFRLQLDSQNVSVETNFNDQFQAI 371

Query: 359  KEIPTNTLQARIESERIFAKLTHEFTINATKGAMDILYGNGTAMNPDSPLEEQIFLKNNI 418
            +++PTN+L  RIE ER+  K+ HEF++ A KGAM I   N   +NP+SP  EQIFL  +I
Sbjct: 372  RDLPTNSLMERIEFERLQTKIIHEFSVEAIKGAMSIFNDNLPPLNPESPTNEQIFLSGHI 431

Query: 419  FYSFVGDLNQTYADKGGDE-AAIASANQDXXXXXXXXXXXXPNIHHLLTTIVDFGGKRIL 477
            FYSFV  +     D G +E AA A +N D             ++ ++LTTIVDF G+R+L
Sbjct: 432  FYSFVTSIK----DNGINEDAARAISNHDLKTINLLNRVNLNDVRYVLTTIVDFAGRRLL 487

Query: 478  AQTPVPGLLSPMGVKIXXXXXXXXXXVSELSSDICVKYGLDENEKKVVFNEEFDEILNDQ 537
            AQTPVPGLL  MG ++          + +L++D+ VKYGLDE E K++F+ +FD  L  +
Sbjct: 488  AQTPVPGLLDSMGTQVEKDPETGEETLKDLNNDVMVKYGLDEEEGKILFDADFDAALGKE 547

Query: 538  FAKSFHLKKHTI------QGTELVFSSQSKGIVGSDKRHYILDLANTYPLDVEFAKENFD 591
            FAK FHLKKH +      +  ++ FSS+S+GIVG DKR YILDLANTYPLD+ F KEN+D
Sbjct: 548  FAKIFHLKKHQVSNGKDGENVDIWFSSKSRGIVGFDKRKYILDLANTYPLDINFVKENYD 607

Query: 592  DVKEASKKYPHRQTLIRPELVEKWWATKIENDK-VELVKAYEENLYSYNPDAYQVPGVED 650
            +V + +K+YPHRQTL+RPELVEKWW  ++E +K + +  AY+ N++SYNPDA+ V GVED
Sbjct: 608  NVAD-TKRYPHRQTLMRPELVEKWWNAQVEKNKDLTMDAAYDGNMFSYNPDAFVVDGVED 666

Query: 651  ETVVEISKYLNEEIIPNVVQDYLNGNIISPYNGEHLADTFHKNGVNMRYLGKFANLVKEE 710
             TV EIS YL +E++P VV DY+  N+  PYNGEHL DT HKNG+N+RYLGKF  LV+ E
Sbjct: 667  PTVEEISTYLTKEVLPGVVADYIQNNVNIPYNGEHLVDTLHKNGINLRYLGKFIELVQTE 726

Query: 711  LRKQEEAHEAKLAQVIVDNKEYEEWEKSYLQKIETMIKERQAKINKLVQEGKEVPKELTE 770
            L KQ   H  KL  V   N EYE WEK YL KIE +I ERQAKINKL+QEGKEVPKELTE
Sbjct: 727  LSKQVAQHTEKLKTVAEGNIEYENWEKEYLVKIEKLIAERQAKINKLIQEGKEVPKELTE 786

Query: 771  DLKLDDNEIKKPSTEKPVVVSYDELVPLIKTAELEIISRSLKHILRKYSRSLPPIVIPAL 830
            DLKL+D+EI+KP+ E+P+VV+ DEL  LI  AELEII+RSLKH+LR YS+ LP +++P+L
Sbjct: 787  DLKLNDDEIRKPTDEQPIVVAKDELTTLINIAELEIITRSLKHVLRSYSKDLPVLMVPSL 846

Query: 831  ISFVFNLLFGTTYNPAPAVESVDPLYPVDQYEFKNLTHDTLLKEIEQEAVVRYRYELEGD 890
            I+FV NLLFG  YN +P  E +D  +P+  + F  LT  TLL+ I +E+ +R+RYEL  D
Sbjct: 847  IAFVLNLLFGEKYNDSPVAEEIDNFHPIKSFSFHKLTRTTLLEAISKESYLRFRYELPTD 906

Query: 891  WFAEHELYPFTLIRSICNKFGVQLLNKDYFFSTEQLEEYKQSLDKKSRAKYVAPLTTFSV 950
            W +++   PF  IRS+  K G+QL+NK YFF+TE  E +KQS DKK R K VAPL TFSV
Sbjct: 907  WISKYSESPFIAIRSLSYKIGIQLVNKQYFFTTESFETFKQSQDKKIRNKLVAPLNTFSV 966

Query: 951  SDLTVIPKIKAIDYSSPISEELWSQGASIINENQKDGLTLLAQSIGFKEEVNSILHSSVA 1010
             DLT+IP++K  ++SS + ++ W+QG   I E  KD LTL AQ+I   EEV+SILH SVA
Sbjct: 967  KDLTIIPRVKTSEFSSLVGQDFWTQGTLTIQEAPKDALTLFAQAITVMEEVSSILHPSVA 1026

Query: 1011 EKYLTLSTIYNKLGLNAEAIAFCRKSCAIYERVCGVDSFELLRALTNLATLEFANESPYN 1070
            EKYL++ST+YN+LGL +EA+AFCRK+C IYERVCGVDSFE+LRALTNLA LE +N+SPYN
Sbjct: 1027 EKYLSVSTVYNQLGLTSEAVAFCRKACKIYERVCGVDSFEMLRALTNLAMLETSNKSPYN 1086

Query: 1071 VALIYQRIIQTVSGYGLDKIHHPIFTNIFNYLEQLSLGVQDAKLAVEVLKSLGDFLVSID 1130
             A++Y+R+I+T+  + L  +HHP  T+I++ +EQLSLGV++ KL++ VLK L D +VS +
Sbjct: 1087 AAVVYKRLIETLQSFNLSTLHHPSMTSIYSNIEQLSLGVENIKLSMAVLKHLCDLIVSFE 1146

Query: 1131 GTESLPYAYIKSKLGNLLAADNRFSDALNQIKVAERIFTKELGTNHGSTAQARQWVDGLT 1190
            G ESL YA+ +S+LGNL      F  AL  I V E IF+KELGTNH +TAQ+RQW++GLT
Sbjct: 1147 GKESLAYAFTESRLGNLYVTVKDFRSALQHIAVTEPIFSKELGTNHVTTAQSRQWINGLT 1206

Query: 1191 NLIKDVNQKKQLQQDQTAASGLKQQPQKSKSGHNKKETTNPDLADKSVDELLSFIEGE 1248
            N++ D+  +KQL Q Q A +     P  +K   NKK+  N +LADKSVDELL+FIEG+
Sbjct: 1207 NVVNDM--QKQLNQTQAAVNAKSNAP--AKKHKNKKDEPNAELADKSVDELLNFIEGD 1260

>Kwal_26.8161
          Length = 1229

 Score = 1157 bits (2993), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 578/1216 (47%), Positives = 808/1216 (66%), Gaps = 21/1216 (1%)

Query: 33   EEITLQFRKDSKLQNVLDFLSIAPATKYFTNYNLKNSTGDLLLSSEEKTLRELCSDKDEY 92
            +E+ L   K S +Q V + L  +P+T+  TN    +    L   S E++L +L S+ D+ 
Sbjct: 20   QEVQLSLVKSSTVQIVGEVLQFSPSTRCLTNLEFYHRGKKL---SGEESLLDLASE-DKV 75

Query: 93   KVALELKPYNQYQALKHVLTSRDFFGFASETEDGLSNVAVSTGSKFYKLPLKEIKEKSPE 152
            K+ ++   Y    A++HV   RD  GF SET DG+S+ AVSTG +F  +PL+ ++  +P+
Sbjct: 76   KLDVKFMAYTARDAMRHVSMVRDTIGFTSETLDGISDFAVSTGVQFCDMPLRPVEHAAPQ 135

Query: 153  NEDKDTENKKPTSMNVTDEEKVEFNHMVHGXXXXXXXXXXXXXXXXMNTDTSVVTPCLRS 212
             EDK       T+  ++++EK +F   V                  + T + ++TPCLR+
Sbjct: 136  EEDKTAS----TAFKISEDEKNDFQRTVK-----DTLNQGKTVNEVLKTRSGIITPCLRA 186

Query: 213  INFSPYNPVPAFYRTKGHLFYLQIVTLEGESLQVTAIPSGFYINKSTTSKFDPSPKENDG 272
            +  S YNPVP FYRTKGHL YLQ  +LEGE   +TA   GFY+NKST +KFDPSP+++ G
Sbjct: 187  LALSGYNPVPPFYRTKGHLLYLQATSLEGEVFHITATSQGFYVNKSTANKFDPSPRDDAG 246

Query: 273  HVDTVHYTLYDLLASSSKNFVTHISSLEKKFDDLESVTYVRPACTTLNKPWLIPAIPTNG 332
                   +L DLL++ SK F  H+ +LE++    ++V + RP+ T L KPWLI  +PT+ 
Sbjct: 247  ---ATKVSLLDLLSTHSKKFKDHLKNLEQRVSSFDTVFHARPSTTFLGKPWLISTMPTSS 303

Query: 333  PDYLRTQIDSFNFEPERNFNDEFQSIKEIPTNTLQARIESERIFAKLTHEFTINATKGAM 392
             DY R Q+   +F  ERNFNDEFQ+IK++ ++  Q+ +++E++ AK+  EFT  A + AM
Sbjct: 304  GDYARLQLSEVDFNTERNFNDEFQAIKDMTSSDYQSIVDTEKLTAKVYQEFTETAVRDAM 363

Query: 393  DILYGNGTAMNPDSPLEEQIFLKNNIFYSFVGDLNQTYADKGGDEAAIASANQDXXXXXX 452
             I Y +  AMNP++P +EQIFLKNNIFYSFVGD+N  Y+  GGD AA A++NQD      
Sbjct: 364  SIFYADLVAMNPEAPTQEQIFLKNNIFYSFVGDVNGNYSKIGGDAAAFAASNQDLQTVKL 423

Query: 453  XXXXXXPNIHHLLTTIVDFGGKRILAQTPVPGLLSPMGVKIXXXXXXXXXXVSELSSDIC 512
                  P IH+LL TI+DF G+RILAQTPVPGLLS MG               +L SD+ 
Sbjct: 424  LHRVSLPEIHYLLCTIIDFAGRRILAQTPVPGLLSAMGTITKEDPKTGESVTEDLVSDVN 483

Query: 513  VKYGLDENEKKVVFNEEFDEILNDQFAKSFHLKKHTIQGTELVFSSQSKGIVGSDKRHYI 572
            + YG DE    V++N+EFD+ L + F+K FHL+KH     E+  SS SKGI+GSDKR YI
Sbjct: 484  IVYGQDEASGDVLYNQEFDDAL-ESFSKVFHLRKHKAGSVEIKTSSHSKGIIGSDKRKYI 542

Query: 573  LDLANTYPLDVEFAKENFDDVKEASKKYPHRQTLIRPELVEKWWATKIENDKVELVKAYE 632
            LDLAN+ PLDVEFA  N+D V E S++YPHRQTL+R ELV+KWWA K++  K++  KA+E
Sbjct: 543  LDLANSQPLDVEFATGNYDGVPE-SERYPHRQTLVRNELVDKWWANKLDESKLDFNKAFE 601

Query: 633  ENLYSYNPDAYQVPGVEDETVVEISKYLNEEIIPNVVQDYLNGNIISPYNGEHLADTFHK 692
            EN ++ NPDAY V GVED  V++ISKYLN +++P+VV +Y  GN+  PY+G+HL ++ HK
Sbjct: 602  ENKFAINPDAYVVEGVEDSLVMDISKYLNNDVLPSVVNEYAAGNLTVPYDGDHLTESLHK 661

Query: 693  NGVNMRYLGKFANLVKEELRKQEEAHEAKLAQVIVDNKEYEEWEKSYLQKIETMIKERQA 752
            NG+NMRYLGK  +L ++E   Q E H+ KLA V+  N+++E+WEK YL K+E  IKERQ 
Sbjct: 662  NGINMRYLGKLISLAEKEYESQIEQHKTKLAGVMAGNEDHEKWEKEYLAKVEKQIKERQE 721

Query: 753  KINKLVQEGKEVPKELTEDLKLDDNEIKKPSTEKPVVVSYDELVPLIKTAELEIISRSLK 812
            KINKLV EGKE+P+EL  DLKLD+N+I+KP+  + V+V+ D++  LIK ++LEI++RSLK
Sbjct: 722  KINKLVHEGKEIPEELKGDLKLDENDIRKPTKGEAVIVNKDQICCLIKVSQLEIVARSLK 781

Query: 813  HILRKYSRSLPPIVIPALISFVFNLLFGTTYNPAPAVESVDPLYPVDQYEFKNLTHDTLL 872
            HILR YS+ LP  ++P+++++ FNLLFGT+YN +P VE VD  +    + FK+L+   LL
Sbjct: 782  HILRDYSKGLPVSLVPSVVAYFFNLLFGTSYNSSPEVEIVDEFFLSTNFSFKDLSRGDLL 841

Query: 873  KEIEQEAVVRYRYELEGDWFAEHELYPFTLIRSICNKFGVQLLNKDYFFSTEQLEEYKQS 932
            K I+ +A  R+ Y+L  +   +    PF LIR++  +FG+QLLNK+YFF++E+ E +KQS
Sbjct: 842  KAIQGQAKRRFIYDLSEEALEDLCAKPFALIRAVSKRFGIQLLNKEYFFNSEEYETFKQS 901

Query: 933  LDKKSRAKYVAPLTTFSVSDLTVIPKIKAIDYSSPISEELWSQGASIINENQKDGLTLLA 992
             DKK+R+K   PL+TFS +D+TVIP IK  DY S   +  W+QGA+I+NE + DGL LL+
Sbjct: 902  QDKKTRSKLSKPLSTFSANDITVIPTIKDGDYRSLTGDNFWNQGAAILNEKEADGLVLLS 961

Query: 993  QSIGFKEEVNSILHSSVAEKYLTLSTIYNKLGLNAEAIAFCRKSCAIYERVCGVDSFELL 1052
            Q++  KEEVN  +H SVAE Y+ +STIY+ L    EAI FCR++C IYER CGVDSFE+L
Sbjct: 962  QALKIKEEVNGTVHQSVAESYMAMSTIYHTLKRIPEAITFCRRACGIYERTCGVDSFEVL 1021

Query: 1053 RALTNLATLEFANESPYNVALIYQRIIQTVSGYGLDKIHHPIFTNIFNYLEQLSLGVQDA 1112
            R LTNLA LE +N+SP N A++ QRI+ T++   L    HP   N +  L+Q SL  +DA
Sbjct: 1022 RCLTNLAVLELSNKSPSNAAVVLQRILCTMN--ALCVTIHPATINSYTMLQQASLACKDA 1079

Query: 1113 KLAVEVLKSLGDFLVSI-DGTESLPYAYIKSKLGNLLAADNRFSDALNQIKVAERIFTKE 1171
            +LA+EVLK L   ++ I DG  SL Y Y +S++G+L      ++ +L  I  A+ +FT+E
Sbjct: 1080 RLAIEVLKKLSSTILEIEDGQHSLAYGYNQSRIGDLYVTMKDYTSSLKAISEAKNVFTRE 1139

Query: 1172 LGTNHGSTAQARQWVDGLTNLIKDVNQKKQLQQDQTAASGLKQQPQKSKSGHNKKETTNP 1231
            LG N  +TAQ RQWV  L  L++   Q++ L Q QTAA+       + +      E   P
Sbjct: 1140 LGVNDETTAQCRQWVQALEGLLQSQKQQQTLNQQQTAANSAGTTRMRKQKNSKNDEKPRP 1199

Query: 1232 DLADKSVDELLSFIEG 1247
            DLA+KSVDELLSFIEG
Sbjct: 1200 DLANKSVDELLSFIEG 1215

>ABR050W [641] [Homologous to ScYMR012W (CLU1) - SH]
            complement(483635..487321) [3687 bp, 1228 aa]
          Length = 1228

 Score = 1066 bits (2758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/1213 (44%), Positives = 778/1213 (64%), Gaps = 34/1213 (2%)

Query: 41   KDSKLQNVLDFLSIAPATKYFTNYNLKNSTGDLLLSSEEKTLRELCSDKDEYKVALELKP 100
            + +++Q+++ FL+   A+KY+TNY L ++  ++    E++ + EL  ++    + L LKP
Sbjct: 28   RRARVQSIMYFLAFNAASKYYTNYELLHNGVEV---DEQQLISELAGNEQTVHLQLRLKP 84

Query: 101  YNQYQALKHVLTSRDFFGFASETEDGLSNVAVSTGSKFYKLPLKEIKEKSPENEDKDTEN 160
            YN  + ++H +T R++ GF  +++D ++++A+S  +KF +LPL +I   S + E  D   
Sbjct: 85   YNTGEVIRHFVTFREYIGFVGDSDDDITSLALSNVAKFRELPLTDIAAASGKTEVADDRQ 144

Query: 161  KKPTSMNVTDEEKVEFNHMVHGXXXXXXXXXXXXXXXXMNTDTSVVTPCLRSINFSPYNP 220
            K+     V+D EK  F   +                  +   +++  PCLRS+  S YNP
Sbjct: 145  KE--EFQVSDAEKAVFTKELDSILELRPSAQDV-----LKGGSALSKPCLRSLIISGYNP 197

Query: 221  VPAFYRTKGHLFYLQIVTLEGESLQVTAIPSGFYINKSTTSKFDPSPKENDGHVDTVHYT 280
            VPAF+RTKGHL YLQ VTLEGE+L +TA  SGFY+NKS+  KFDP+ K +      V  T
Sbjct: 198  VPAFFRTKGHLLYLQAVTLEGETLHITATVSGFYVNKSSAIKFDPTLKTDAA----VCLT 253

Query: 281  LYDLLASSSKNFVTHISSLEKKFDDLESVTYVRPACTTLNKPWLIPAIPTNGPDYLRTQI 340
            LY+LL   SK F +H+S LE      ESV YV+P    L+K W   ++P+N  D+   Q+
Sbjct: 254  LYELLTKHSKKFASHLSQLEAALKAHESVNYVKPISVFLHKTWFPSSLPSNSIDFTEYQL 313

Query: 341  DSFNFEPERNFNDEFQSIKEIPTNTLQARIESERIFAKLTHEFTINATKGAMDILYGNGT 400
            ++ NF+ ERNFNDEFQ++KE  +  + AR+E E++  ++ H+F + A+KG+M+I YGN  
Sbjct: 314  EALNFQTERNFNDEFQAVKETSSEDIVARLEKEKLLNRVIHDFNVAASKGSMEIFYGNMV 373

Query: 401  AMNPDSPLEEQIFLKNNIFYSFVGDLNQTYADKGGDEAAIASANQDXXXXXXXXXXXXPN 460
            AMNPD+P +E IFLKNNIFYSFV DL+  Y DKGGD AA A++NQD             +
Sbjct: 374  AMNPDAPRQEHIFLKNNIFYSFVSDLDGHYQDKGGDAAAHAASNQDLHIIKTLLQSNMRS 433

Query: 461  IHHLLTTIVDFGGKRILAQTPVPGLLSPMGVKIXXXXXXXXXXVSELSSDICVKYGLDEN 520
            + HLL  ++          +PVPG+L   G+K           + +  +DI V YG DE 
Sbjct: 434  VRHLLPAVLSSVVLESWHHSPVPGILDTAGMKFIKNEKGEEEAI-QAKNDITVCYGFDEA 492

Query: 521  EKKVVFNEEFDEILNDQFAKSFHLKKHTIQGTELVFSSQSKGIVGSDKRHYILDLANTYP 580
              KV+ + EF   L+D FAK FHLKKH + G EL  +S SKG+VG DKR+YILDLA+  P
Sbjct: 493  SNKVIADAEFGSSLDD-FAKVFHLKKHEVDGVELKVASTSKGVVGFDKRNYILDLADNNP 551

Query: 581  LDVEFAKENFDDVKEASKKYPHRQTLIRPELVEKWWATKIENDKVELVKAYEENLYSYNP 640
            LDV FA ENFD V +   +YPHRQTL+R ELVEKWW +K++    E+  AYEE  +SYNP
Sbjct: 552  LDVGFALENFDAVTDEKARYPHRQTLLRRELVEKWWFSKVDGTGSEMEAAYEEGKFSYNP 611

Query: 641  DAYQVPGVEDETVVEISKYLNEEIIPNVVQDYLNGNIISPYNGEHLADTFHKNGVNMRYL 700
            DAY++ G+EDETVVE+S YL +E++P +V++   G+I +P+NGEHL D  HKNG+N+RYL
Sbjct: 612  DAYKIEGIEDETVVELSDYLRKEVVPTLVKEVAEGSITAPFNGEHLVDIMHKNGINIRYL 671

Query: 701  GKFANLVKEELRKQEEAHEAKLAQVIVDNKEYEEWEKSYLQKIETMIKERQAKINKLVQE 760
            G+   L ++EL  Q    EA L QV  DNKE+ EWE +YL+ IE++IKERQ  I KL+ E
Sbjct: 672  GRVIELAEQELEAQRALREAHLQQVEADNKEFTEWEANYLKHIESLIKERQVTIQKLLAE 731

Query: 761  GKEVPKELTEDLKLDDNEIKKPSTEKPVVVSYDELVPLIKTAELEIISRSLKHILRKYSR 820
            GKEVP EL E+LKLDD EI+KP  ++ V V+ D+L  L+  A++EIISRS+KH+ RK+  
Sbjct: 732  GKEVPAELKEELKLDDKEIRKPHEKEGVAVNNDQLSVLLTLAQIEIISRSIKHVFRKHCH 791

Query: 821  SLPPIVIPALISFVFNLLFGTTYNPAPAVESVDPLYPVD----QYEFKNLTHDTLLKEIE 876
             LP ++IP  I+F  NLLFG  YN AP  E     +P D     + F  LT + LL EI 
Sbjct: 792  ELPAVIIPTFIAFALNLLFGYCYNKAPIAE-----FPTDGSDIDFAFTKLTREQLLSEIS 846

Query: 877  QEAVVRYRYELEGDWFAEHELYPFTLIRSICNKFGVQLLNKDYFFSTEQLEEYKQSLDKK 936
            ++AV+R+RY L   W + +E  PF L+R ICNKFG+QLLNK+YFF+ EQ + ++Q+ D +
Sbjct: 847  EQAVLRFRYTLPDGWESRYEHTPFALLRPICNKFGIQLLNKEYFFTREQYQNWRQAQDNQ 906

Query: 937  SRAKYVAPLTTFSVSDLTVIPKIKAIDYSSPISEELWSQGASIIN--ENQKDGLTLLAQS 994
             R+K V P++TFS++DL+V   I     ++ +S++ W+QGA +IN  + Q   L L +Q+
Sbjct: 907  IRSKLVEPVSTFSINDLSVRTIINVATLTTGVSDDCWAQGAYMINDEDKQATALGLFSQA 966

Query: 995  IGFKEEVNSILHSSVAEKYLTLSTIYNKLGLNAEAIAFCRKSCAIYERVCGVDSFELLRA 1054
            I F+EE +  +H +VAE YL LSTI++KL   +EA+A CRK+CAIYERVCG DSFE++R+
Sbjct: 967  IAFREETSGYVHPTVAESYLALSTIHSKLEKKSEAVALCRKACAIYERVCGFDSFEMIRS 1026

Query: 1055 LTNLATLEFANESPYNVALIYQRIIQTVSGYGLDKIHHPIFTNIFNYLEQLSLGVQDAKL 1114
            L NLA LE AN+SPYN AL  + I+  +S   +  ++HP   N ++ L  +   +Q++  
Sbjct: 1027 LNNLAMLEMANDSPYNAALCLKTIMSILS--VVIPVNHPATINSYSMLHSMCSSLQNSSA 1084

Query: 1115 AVEVLKSLGDFLVSIDGTESLPYAYIKSKLGNLLAADNRFSDALNQIKVAERIFTKELGT 1174
             ++VL  LGD +V IDG +SLPYA  +S+L NL A+   +  +L  I+    +F+KELG 
Sbjct: 1085 MIKVLNKLGDIIVEIDGHKSLPYAVNESRLANLYASVGEYKRSLACIESCYELFSKELGV 1144

Query: 1175 NHGSTAQARQWVDGLTNLIKDVNQKKQLQQDQTAASGLKQQPQKSKSGHNKKETTNPDLA 1234
            NH +T +   W+ G+ NLI+  +Q K L   + AA+  + + + +     +K+  + +L 
Sbjct: 1145 NHKTTVECNSWITGVENLIESTSQSKALAASKAAAAAKQGEKKPA-----QKQQQSAELR 1199

Query: 1235 DKSVDELLSFIEG 1247
            DKS+DEL++FI G
Sbjct: 1200 DKSIDELMNFING 1212

>KLLA0F25322g complement(2356566..2360375) similar to sp|Q03690
            Saccharomyces cerevisiae YMR012w CLU1 translation
            initiation factor eIF3 (p135 subunit) singleton,
            hypothetical start
          Length = 1269

 Score =  907 bits (2345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/1263 (39%), Positives = 755/1263 (59%), Gaps = 82/1263 (6%)

Query: 34   EITLQFRKDSKLQNVLDFLSIAPATKYFTNYNL-KNSTGDLLLSSEEKTLRELCSDKDEY 92
            +I  Q  K+S + ++  FLS   +TK++T+Y+L +NS     +  +E  L +L  +    
Sbjct: 23   DIKYQLGKESNVSHLRTFLSFEESTKFYTSYDLIENSR----VVDDEDVLGDLAGNGSSL 78

Query: 93   KVALELKPYNQYQALKHVLTSRDFFGFASETEDGLSNVAVSTGSKFYKLPLKEIKEKSPE 152
                + K YN   A++H++  R+  GF+SE EDG+S  A+S+GS+F  + L+   EKS  
Sbjct: 79   TFQFKPKAYNLVTAVQHIVGLRETLGFSSELEDGISEFAISSGSQFQDMSLEPNSEKSNG 138

Query: 153  NEDKDTENKKPTSMNVTDEEKVEFNHMVHGXXXXXXXXXXXXXXXXMNTDTSVVTPCLRS 212
            +E             ++D+EKV+F   +                  + T   +VTP L+S
Sbjct: 139  SE-----------TTISDQEKVKF---LQTCNELLESTNTDFNIASLKTGNLLVTPVLKS 184

Query: 213  INFSPYNPVPAFYRTKGHLFYLQIVTLEGESLQVTAIPSGFYINKSTTSKFDPSPKENDG 272
            ++FS YNPVPAFY+ KGHL YLQ  TLE E+  +T   SGFY+NKS++ KFDPSPK+   
Sbjct: 185  LHFSAYNPVPAFYKNKGHLLYLQASTLENETFHITTSISGFYVNKSSSVKFDPSPKDEF- 243

Query: 273  HVDTVHYTLYDLLASSSKNFVTHISSLEKKFDDLESVTYVRPACTTLNKPWLIPAIPTNG 332
                  + L DLL   SK F  H++SL  K    +S  YV+PA   L+KPWL+  +P+N 
Sbjct: 244  ---EPKFNLIDLLTQVSKKFHQHVTSLRNKLSSTDSAQYVKPASCFLSKPWLVSQLPSNN 300

Query: 333  PDYLRTQIDSFNFEPERNFNDEFQSIKEIPTNTLQARIESERIFAKLTHEFTINATKGAM 392
             D++RTQ++ FN + ERNF DEFQ+IK++  N+   R+++E+I A L HEF   A KGAM
Sbjct: 301  GDFMRTQLEHFNNDDERNFCDEFQAIKDLEINSSYDRLKNEKITAGLIHEFNSEAVKGAM 360

Query: 393  DILYGNGTAMNPDSPLEEQIFLKNNIFYSFVGDLNQTYADKGGDEAAIASANQDXXXXXX 452
             I     T ++P +  E  ++   ++ +SFV D++ TY+  GG+EAA A ANQD      
Sbjct: 361  AIFNNELTPIDPGTTGENAVYFHKSLIFSFVADVSGTYSSIGGNEAAYAVANQDLQIINS 420

Query: 453  XXXXXXPNIHHLLTTIVDFGGKRILAQTPVPGLLSPMGVKIXXXXXXXXXXVSE-LSSDI 511
                    I H LT I+D+ G R+L Q+PVPGLL+P+GV I          V+E + + I
Sbjct: 421  LNRLGLKGIRHCLTAIIDYAGHRLLVQSPVPGLLTPVGVNIIVDEEDKE--VAEPMETLI 478

Query: 512  CVKYGLDENEKKVVFNEEFDEILNDQFAKSFHLKKHTIQGTELVFSSQSKGIVGSDKRHY 571
             V YG D+    + F+E+F E +  +F+K+F+LK+H ++  +L  SS+SKGI G D+R Y
Sbjct: 479  SVNYGYDDFVATLKFDEKFHEKVC-EFSKNFYLKEHKVEEVDLRISSKSKGIFGVDQRAY 537

Query: 572  ILDLANTYPLDVEFAKENFDDVKEASKKYPHRQTLIRPELVEKWWATKIENDKVELVKAY 631
            ILDLANT P+D+EF K ++DDVKE   KYPHRQ L+R ELVE+W A KI      L +A 
Sbjct: 538  ILDLANTNPVDIEFVKAHYDDVKE--NKYPHRQVLLRRELVERWRAEKIAASGKTLQEAS 595

Query: 632  EENLYSYNPDAYQVPGVEDETVVEISKYLNEEIIPNVVQDYLNGNIISPYNGEHLADTFH 691
            E+  + YNPDAY + GVEDE V ++SK+LN+ ++   ++D L GN   PY+G+HL D FH
Sbjct: 596  EDVSFIYNPDAYVIDGVEDENVADMSKFLNDTVLTLFLEDILKGNSNIPYDGQHLTDLFH 655

Query: 692  KNGVNMRYLGKFANLVKEELRKQEEAHEAKLAQVIVDNKEYEEWEKSYLQKIETMIKERQ 751
             NGVNMRYLGK    VK +   Q++     L+++  +NKEY++WE  YL K+E +IKERQ
Sbjct: 656  TNGVNMRYLGKAIEFVKAKYEDQKQERAKYLSKIEQENKEYQDWETGYLVKVEKLIKERQ 715

Query: 752  AKINKLVQEGKEVPKELTEDLKLDDNEIKKPSTEKPVVVSYDELVPLIKTAELEIISRSL 811
             +INK VQ+GKEVP +L E ++LD  ++K+P   +   V  D+   LI   ELE+I+RS+
Sbjct: 716  EEINKYVQQGKEVPSKLKEQIQLDKADLKEPVRNEGCTVEVDQFEGLIAVCELEMIARSI 775

Query: 812  KHILRKYSRSL-PPIVIPALISFVFNLLFGTTYNPAPAVESVDPLYPVDQYEFKNLTHDT 870
            KHI R+ S+ L  P ++P L++F  NLLFG +YN +  VE++D L+ +++ EF   T + 
Sbjct: 776  KHIFRQQSKKLSSPTLVPHLVAFFLNLLFGKSYNESVTVENLDALFDINELEFAQYTREQ 835

Query: 871  LLKEIEQEAVVRYRYELEGDWF--AEHELYPFTLIRSICNKFGVQLLNKDYFFSTEQLEE 928
            L++E+  +A +R+RY+L  +WF   E     + LIR+I  KFG+QL+NK+YFF+ EQ E+
Sbjct: 836  LIEEVRVQAKLRFRYDLTSEWFDINEKRFSKYALIRAIAQKFGIQLINKEYFFTKEQYEK 895

Query: 929  YKQSLDKKSRAKYVAPLTTFSVSDLTVIPKIKAIDYSSPISEELWSQGASIIN------- 981
            +KQ+ DKK R+K V P  TFS++D ++ P IK  ++ S I+EELW QGAS++N       
Sbjct: 896  WKQAQDKKLRSKIVDPKQTFSINDFSLRPVIKGAEFQSLIAEELWIQGASLVNAVSVEEE 955

Query: 982  ------------------------------------ENQKDGLTLLAQSIGFKEEVNSIL 1005
                                                +   + LTLL QSI F+E++  ++
Sbjct: 956  EAEKKKEESKKAAADGEDAGSSGATSKEEEQAKERAKKMNEALTLLGQSIAFREDIFGLV 1015

Query: 1006 HSSVAEKYLTLSTIYNKLGLNAEAIAFCRKSCAIYERVCGVDSFELLRALTNLATLEFAN 1065
            H S+   YL LS +Y++LG  ++A+ FC K+  + ER  GVDSFE +R L+NLA LE+  
Sbjct: 1016 HPSLVSSYLLLSNMYSRLGQYSQAVTFCNKAALLSERCYGVDSFETVRILSNLAYLEYGQ 1075

Query: 1066 ESPYNVALIYQRIIQTVSGYGLDKIHHPIFTNIFNYLEQLSLGVQDAKLAVEVLKSLGDF 1125
             S YN AL+ +++ + +    L    H    N+FN L Q++   +D K+ +++L  L + 
Sbjct: 1076 GSIYNSALVLKKVHELLK--LLAPFVHSGRVNVFNLLFQIAASTEDKKVQIKILNKLSEL 1133

Query: 1126 LVSIDGT-ESLPYAYIKSKLGNLLAADNRFSDALNQIKVAERIFTKELGTNHGSTAQARQ 1184
            L+ I G+ E+LPY   +S++ NL  + +  S AL+ I+ A+ IF+KELG N  +T  ++Q
Sbjct: 1134 LLKITGSEETLPYGQNESRIANLYTSLDDMSHALSHIEKAKSIFSKELGLNDQTTLTSKQ 1193

Query: 1185 WVDGLTNLIKDVNQKKQLQQDQTAASGLKQQPQKSKSGHNKKETTNPDLADKSVDELLSF 1244
            W + +  +I    Q+K+L   Q A     +    S+    K  +++P L +KSVDELL F
Sbjct: 1194 WSETIKGIITKQQQEKKLASAQQAT----KPANISQKKGKKSSSSSPALTNKSVDELLQF 1249

Query: 1245 IEG 1247
            IEG
Sbjct: 1250 IEG 1252

>AFR274C [3466] [Homologous to ScYFR051C (RET2) - SH]
           (926088..927686) [1599 bp, 532 aa]
          Length = 532

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 47/104 (45%), Gaps = 17/104 (16%)

Query: 667 NVVQDYLNGNIISPYNGEHLA----DTFHKNGVNMRYLGKFANLV----KEELRKQE--- 715
           N++QD    N+ S     HL     D    N  ++  LG F  ++    KE L   +   
Sbjct: 76  NIIQDMDTLNLFSQTVNSHLKGFSEDEILDNAFDI--LGSFDEIISLGCKENLSLSQINT 133

Query: 716 ----EAHEAKLAQVIVDNKEYEEWEKSYLQKIETMIKERQAKIN 755
               E+HE KL ++I  NKE+E  E+   +  E   +ER+ K+ 
Sbjct: 134 FLSMESHEEKLQEIIERNKEFEAAEERKRRAREISQRERERKLG 177

>Sklu_1773.3 YNR057C, Contig c1773 4329-5030
          Length = 233

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 54/116 (46%), Gaps = 23/116 (19%)

Query: 735 WEKSYLQKIETMIKERQAKINKLVQ-EGK------------EVPKELTE----------D 771
           W  +Y + ++T I+  Q     ++Q  GK            E+ K L+           D
Sbjct: 40  WSANYWKPVQTGIESDQGDTKTVLQFSGKSSWSPTLFPPRYELLKPLSPYKAMEFEPQVD 99

Query: 772 LKLDDNEIKKPSTEKPVVVSYDELVPLIKTAELEIISRSLKHILRKYSRSLPPIVI 827
           +KL D +I + S E+P++V     + +  T +LEI +  +KH+++   R +  +V+
Sbjct: 100 IKLQDFQIPQNSDERPLIVEGAGGIYVPITKKLEITTDLIKHLIQSTKRPVKIVVV 155

>YKL035W (UGP1) [3221] chr11 (369534..371033) UDP-glucose
           pyrophosphorylase (UTP-glucose-1-P uridylyltransferase)
           (UGPase) [1500 bp, 499 aa]
          Length = 499

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 54/117 (46%), Gaps = 20/117 (17%)

Query: 545 KKHTIQGTELVFSSQSKGIVGSDKRHYILDLANTYPLDVEFAKENFDDVKEASKKYPHRQ 604
           KKHT   +   F S +  +  S  R+ +  LA++  LD + A+  F++  E    +    
Sbjct: 4   KKHTKTHSTYAFESNTNSVAASQMRNALNKLADSSKLD-DAARAKFEN--ELDSFF---- 56

Query: 605 TLIRPELVEKWWATKIENDKVELVKAYEENLYSYNPD---AYQVPGVEDETVVEISK 658
           TL R  LVEK   T +E DK++          S NPD    Y++   + E V  +SK
Sbjct: 57  TLFRRYLVEKSSRTTLEWDKIK----------SPNPDEVVKYEIISQQPENVSNLSK 103

>CAGL0F05489g 553902..555365 similar to tr|Q03944 Saccharomyces
           cerevisiae YDR200c or tr|Q06001 Saccharomyces cerevisiae
           YLR238w, hypothetical start
          Length = 487

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 696 NMRYLGKFANLVKEELRKQEEAHEAKLAQVIVDNKEYEEWEKSYLQKIETMIKERQAKIN 755
           N++YL K    +++ L    E H   + + +   K+ EE  +S+ Q+ +  IKE+Q  +N
Sbjct: 355 NVKYLAKLQESLRQSL---SETHNRVINERLDRRKKLEEGNESFKQERDKEIKEKQELLN 411

Query: 756 KLVQE 760
           KL  E
Sbjct: 412 KLKDE 416

>Sklu_2077.3 YML002W, Contig c2077 1119-4388
          Length = 1089

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 37/81 (45%), Gaps = 7/81 (8%)

Query: 228 KGHLFYLQIVTLEGESLQVTAIPSGFYINKSTTSKFDPSPKENDGHVDTVHYTLYDLLAS 287
           K HLFYLQ  +L+  +++   +       ++    F+ +  EN G + ++ +        
Sbjct: 385 KSHLFYLQNFSLDENTIKFGVVAYALSTLEAVLCYFEDA--ENSGKIRSLEFN-----CR 437

Query: 288 SSKNFVTHISSLEKKFDDLES 308
            +K F  H+S     FD L+S
Sbjct: 438 RNKQFWDHLSCKAVSFDSLKS 458

>Sklu_2077.2 YML003W, Contig c2077 1119-4388
          Length = 1089

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 37/81 (45%), Gaps = 7/81 (8%)

Query: 228 KGHLFYLQIVTLEGESLQVTAIPSGFYINKSTTSKFDPSPKENDGHVDTVHYTLYDLLAS 287
           K HLFYLQ  +L+  +++   +       ++    F+ +  EN G + ++ +        
Sbjct: 385 KSHLFYLQNFSLDENTIKFGVVAYALSTLEAVLCYFEDA--ENSGKIRSLEFN-----CR 437

Query: 288 SSKNFVTHISSLEKKFDDLES 308
            +K F  H+S     FD L+S
Sbjct: 438 RNKQFWDHLSCKAVSFDSLKS 458

>KLLA0D18645g complement(1571106..1573694) similar to sp|P22543
           Saccharomyces cerevisiae YLR240w VPS34
           phosphatidylinositol 3-kinase, start by similarity
          Length = 862

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 57/120 (47%), Gaps = 11/120 (9%)

Query: 592 DVKEASKKYPHRQTLIRPELVEKWWATKIEND-KVELVKAYEENLYSYNPDAYQVPGVED 650
           +V  A    P    L R E+ E     K EN+ K+ L K++E  L+ Y+PD Y    +E+
Sbjct: 220 EVSNAQVNIPTFHNLERNEIQEN--GNKSENEVKISLGKSHESTLFFYDPDQYNTDLIEE 277

Query: 651 E--TVVEISKYLNEE--IIPNV-VQDYLNGNIISPYNGEHLADTFHKNGVNMRYLGKFAN 705
           +   +   S+  + E  I P+   +D LN  I SP  G  L D  H+ G+  +Y    +N
Sbjct: 278 KFRRLERSSRETDTEKYIKPDAKKRDVLNAIIASP-PGTKLTD--HEKGLIWKYRYYLSN 334

>CAGL0D00924g 108341..114283 similar to sp|P25386 Saccharomyces
            cerevisiae YDL058w USO1 intracellular protein transport
            protein, start by similarity
          Length = 1980

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 41/78 (52%), Gaps = 9/78 (11%)

Query: 235  QIVTLEGESLQVTAIPSGFYINKSTTSKFDPSPKENDGHVDTVHYTLY------DLLASS 288
            +I TL+ E   +T + +     KST    +   +EN+ ++ +    L       DLL S 
Sbjct: 1078 EISTLKAE---ITQLKTSLNEEKSTRKALEKLKEENETYIQSAQDELLQLQKEVDLLKSE 1134

Query: 289  SKNFVTHISSLEKKFDDL 306
            +K+ + + SSL++K+D+L
Sbjct: 1135 NKDALDNNSSLKQKYDEL 1152

>CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces
           cerevisiae YHR102w NRK1 ser/thr protein kinase, start by
           similarity
          Length = 1072

 Score = 30.8 bits (68), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 55/126 (43%), Gaps = 14/126 (11%)

Query: 285 LASSSKNFVTHISSLEKK--FDDLESVTYVRPACTTLNKPWLIPAIPTN-GPDYLRTQID 341
           L+S S +    +S ++ K  FD L S  Y+      ++    + AIP + GPD+   Q+D
Sbjct: 322 LSSDSSDGKEELSEIDVKWDFDSLSSNDYI------IDNNIQMDAIPQDSGPDWPINQVD 375

Query: 342 SFNFE-PERNFNDEFQSIKEIPTNTLQARIESERIFAKLTHEFTINATKGAMDILYGN-- 398
            FNF  PE +    + +   I   T Q     +     + H  T+NA        +GN  
Sbjct: 376 HFNFAYPEEDQYYMYHTNNNI-QKTYQGTTIGKGNVGTIVHNSTLNAPISHTTTQFGNKA 434

Query: 399 -GTAMN 403
            GTA N
Sbjct: 435 TGTASN 440

>KLLA0E03377g 316716..317579 no similarity, hypothetical start
          Length = 287

 Score = 30.4 bits (67), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 32/63 (50%), Gaps = 12/63 (19%)

Query: 714 QEEAHEAKL----AQVIVDNKEYEEWEKSYLQKIETMIKERQAKINKLVQEGKEVPKELT 769
           Q EA   KL    AQVI   K+        L  IET ++ER+ + ++L Q  KEV   L 
Sbjct: 155 QLEAKSGKLESLDAQVIAKEKQ--------LAIIETKLQERKERFDELRQRAKEVQSSLQ 206

Query: 770 EDL 772
           +DL
Sbjct: 207 DDL 209

>KLLA0B05181g complement(468267..469265) similar to sp|P36517
           Saccharomyces cerevisiae YLR439w MRPL4 ribosomal
           protein, mitochondrial singleton, start by similarity
          Length = 332

 Score = 30.4 bits (67), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 46/108 (42%), Gaps = 20/108 (18%)

Query: 581 LDVEFAKENFDDVKEASKKYPHRQTLIRPELVEKWWATKIENDKVELVKAYEENLY--SY 638
            + E   E + D+ E  +    R   IR  L E+ WA KI N+K     A E+ ++  S+
Sbjct: 126 FNFEAQTEAYQDISEKIRTTMWR---IRHVLSERDWAFKIANEKF----AVEKQVFIESF 178

Query: 639 NPDAYQVPGVEDETVVE-----------ISKYLNEEIIPNVVQDYLNG 675
             D  + P  EDE + E           IS+Y++E  +     D L  
Sbjct: 179 EKDFLEAPANEDEEIFESLQRFQYAIYGISEYIDENKVDRTFVDGLKA 226

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.133    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 41,411,171
Number of extensions: 1925791
Number of successful extensions: 6829
Number of sequences better than 10.0: 100
Number of HSP's gapped: 7057
Number of HSP's successfully gapped: 109
Length of query: 1248
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1135
Effective length of database: 12,684,275
Effective search space: 14396652125
Effective search space used: 14396652125
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)