Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M07700g48748023590.0
Scas_709.555194068081e-102
YMR013C (SEC59)5194027726e-97
Sklu_2168.25004057063e-87
Kwal_26.81645004086872e-84
ABR051C4844076643e-81
KLLA0D11198g5153416342e-76
CAGL0H06259g133654730.89
YOR311C (HSD1)29074701.3
Kwal_47.19023165777673.9
CAGL0L04686g451168656.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M07700g
         (480 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M07700g <772282..773746 similar to sp|P20048 Saccharomyces ...   913   0.0  
Scas_709.55                                                           315   e-102
YMR013C (SEC59) [3977] chr13 complement(295178..296737) Dolichol...   301   6e-97
Sklu_2168.2 YMR013C, Contig c2168 1038-2540 reverse complement        276   3e-87
Kwal_26.8164                                                          269   2e-84
ABR051C [642] [Homologous to ScYMR013C (SEC59) - SH] (487498..48...   260   3e-81
KLLA0D11198g complement(954239..955786) some similarities with s...   248   2e-76
CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces c...    33   0.89 
YOR311C (HSD1) [5095] chr15 complement(899051..899923) Integral ...    32   1.3  
Kwal_47.19023                                                          30   3.9  
CAGL0L04686g 537206..538561 similar to sp|P53264 Saccharomyces c...    30   6.0  

>CAGL0M07700g <772282..773746 similar to sp|P20048 Saccharomyces
           cerevisiae YMR013c dolichol kinase, start by similarity
          Length = 487

 Score =  913 bits (2359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/480 (94%), Positives = 454/480 (94%)

Query: 1   LMTTTTIVNVEKSGVKLRRSKHGPRKGMEVIPQLWQLVMLSVPFMYCYDNVMELLCSSXX 60
           LMTTTTIVNVEKSGVKLRRSKHGPRKGMEVIPQLWQLVMLSVPFMYCYDNVMELLCSS  
Sbjct: 1   LMTTTTIVNVEKSGVKLRRSKHGPRKGMEVIPQLWQLVMLSVPFMYCYDNVMELLCSSVV 60

Query: 61  XXXXXXXXXXCFVLRRKLFDDFYRIYLPFLVSFTFCDRTLTELNMIMSTTAVIPSNYTPI 120
                     CFVLRRKLFDDFYRIYLPFLVSFTFCDRTLTELNMIMSTTAVIPSNYTPI
Sbjct: 61  VQMVIVVHLVCFVLRRKLFDDFYRIYLPFLVSFTFCDRTLTELNMIMSTTAVIPSNYTPI 120

Query: 121 HLVGLIFQAGLMKIGMHNYDYISGVKCLVANYLLVNWLEDIGQLKTLDQIDCNLFGILLT 180
           HLVGLIFQAGLMKIGMHNYDYISGVKCLVANYLLVNWLEDIGQLKTLDQIDCNLFGILLT
Sbjct: 121 HLVGLIFQAGLMKIGMHNYDYISGVKCLVANYLLVNWLEDIGQLKTLDQIDCNLFGILLT 180

Query: 181 DCLMINNATAPNYLLVLKGAMTSVMIIIVVNHFLTRLIPSLSNSIVLAGNFLVLFPILVN 240
           DCLMINNATAPNYLLVLKGAMTSVMIIIVVNHFLTRLIPSLSNSIVLAGNFLVLFPILVN
Sbjct: 181 DCLMINNATAPNYLLVLKGAMTSVMIIIVVNHFLTRLIPSLSNSIVLAGNFLVLFPILVN 240

Query: 241 HLIDFSNEKITSPALWLIDFILESEIRQYIMLSWXXXXXXXXXXXXXXKSKISLNTSRKI 300
           HLIDFSNEKITSPALWLIDFILESEIRQYIMLSW              KSKISLNTSRKI
Sbjct: 241 HLIDFSNEKITSPALWLIDFILESEIRQYIMLSWVIVLVVFIPLVILFKSKISLNTSRKI 300

Query: 301 WHFVIFLLIVEPFHLDPEFVKISLCGIIPCFLSVEYLRYLKIEPYGEHLDFFLRSFADYR 360
           WHFVIFLLIVEPFHLDPEFVKISLCGIIPCFLSVEYLRYLKIEPYGEHLDFFLRSFADYR
Sbjct: 301 WHFVIFLLIVEPFHLDPEFVKISLCGIIPCFLSVEYLRYLKIEPYGEHLDFFLRSFADYR 360

Query: 361 DQRGPLIVSYIYLITGITIPLLLFESPVGLVSLGVGDSLASIVGKKVGRMHWKGTNKTIE 420
           DQRGPLIVSYIYLITGITIPLLLFESPVGLVSLGVGDSLASIVGKKVGRMHWKGTNKTIE
Sbjct: 361 DQRGPLIVSYIYLITGITIPLLLFESPVGLVSLGVGDSLASIVGKKVGRMHWKGTNKTIE 420

Query: 421 GTVAFIVGTTFISWILQRYFNYFSTIDIFKILVICTTGGVLEGNSELNDNILIPLFMVSM 480
           GTVAFIVGTTFISWILQRYFNYFSTIDIFKILVICTTGGVLEGNSELNDNILIPLFMVSM
Sbjct: 421 GTVAFIVGTTFISWILQRYFNYFSTIDIFKILVICTTGGVLEGNSELNDNILIPLFMVSM 480

>Scas_709.55
          Length = 519

 Score =  315 bits (808), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 183/406 (45%), Positives = 264/406 (65%), Gaps = 12/406 (2%)

Query: 79  FDDFYRIYLPFLVSFTFCDRTLTELNMIMSTTAVIPSNYTPIHLVGLIFQAGLMKIGMHN 138
           F+  Y ++LPF+ SF F  + LT  N I++  A+    Y  I +  L F     +     
Sbjct: 112 FEIVYLLFLPFMTSFLF-KKELTIFNSILALNALDIPLYEKIPMQAL-FIGFSAESDAEL 169

Query: 139 YDYISGVKCLVANYLLVNWLEDIGQLKTLDQIDCNLFGILLTDCLMINNATAPNY-LLVL 197
           ++Y  G   ++ N+ +   L  IGQLK+LD IDCNLF I+LT+ L + +   P+    +L
Sbjct: 170 WEYGYG---MLLNFSICQTLMKIGQLKSLDVIDCNLFSIVLTNVLYMIDPELPSLSFQIL 226

Query: 198 KGAMTSVMIIIVVNHFLTRLIPSLSN-----SIVLAGNFLVLFPILVNHLIDFSNEKITS 252
           +G++ +  + + +N+ ++ L+  +       S+ L   F+++FPIL++ LI   +     
Sbjct: 227 RGSLIAFFVTVAINYIISSLLTKMKKNPHIKSLSLFSIFVIVFPILMDQLIQLESID-ER 285

Query: 253 PALWLIDFILESEIRQYIMLSWXXXXXXXXXXXXXXKSKISLNTSRKIWHFVIFLLIVEP 312
           P++WL+ ++L S  R+ I+L W              KS  SLNTSRKIWHF+I LLI  P
Sbjct: 286 PSMWLLQYVLGSSARKSILLVWLSFLLILIPNVLIFKSNFSLNTSRKIWHFLILLLITMP 345

Query: 313 FHLDPEFVKISLCGIIPCFLSVEYLRYLKIEPYGEHLDFFLRSFADYRDQRGPLIVSYIY 372
           F +DP FVKI+L G I  FLSVEYLR+L++EP+G ++D  LRSFAD+RD +GP+I+SYIY
Sbjct: 346 FQMDPLFVKIALSGTIVLFLSVEYLRFLQLEPFGAYIDSKLRSFADFRDDKGPIIISYIY 405

Query: 373 LITGITIPLLLFESPVGLVSLGVGDSLASIVGKKVGRMHWKGTNKTIEGTVAFIVGTTFI 432
           LI GI+ PLL+ +SPVGL+SLGVGDSLASI+G K GR HW GT KTIEGT++FI+GT+ +
Sbjct: 406 LIIGISTPLLINDSPVGLISLGVGDSLASIIGGKWGRYHWPGTRKTIEGTLSFIIGTSIV 465

Query: 433 SWILQRYFNYFSTIDIFKILVICTTGGVLEGNSELNDNILIPLFMV 478
           ++IL+ Y  YF+ I    +L +CT  G+LEGNSELNDNILIP +M+
Sbjct: 466 AYILKYYMEYFADITFSNLLWVCTISGILEGNSELNDNILIPTYMM 511

>YMR013C (SEC59) [3977] chr13 complement(295178..296737) Dolichol
           kinase, mutants accumulate incompletely glycosylated
           protein precursors in ER [1560 bp, 519 aa]
          Length = 519

 Score =  301 bits (772), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 177/402 (44%), Positives = 252/402 (62%), Gaps = 9/402 (2%)

Query: 79  FDDFYRIYLPFLVSFTFCDRTLTELNMIMSTTAVIPSNYTPIHLVGLIFQAGLMKIGMHN 138
           FD  Y +YLPF+VS  F D + T +N I+   +V+ S      LV +I Q  L+      
Sbjct: 117 FDTIYSLYLPFMVSLLF-DTSSTVINTIL-ILSVLNSYRWRTQLVVIILQLCLIFFNFEA 174

Query: 139 YDYISGVKCLVANYLLVNWLEDIGQLKTLDQIDCNLFGILLTDCLMINNATAPNYLLVLK 198
            D +  +  +V N LL   L+ IGQLK+LD ID NLF ILLT+ L ++ A   ++  +LK
Sbjct: 175 GDRLKNIISIVINSLLSLILKYIGQLKSLDNIDSNLFSILLTNILYVSEAGTVHFR-ILK 233

Query: 199 GAMTSVMIIIVVNHFLTRLIPSLSNSIVLAGNFLVLFPILVNHLIDFSNEKITSPALWLI 258
           G + ++  II +N+ L +++       +L+ +F +  P+  N  I   + +  +P LWL+
Sbjct: 234 GIILALTTIISINYVLKKVMHF--KPFMLSISFAIGLPLFANTFIHLEDGE--NPLLWLV 289

Query: 259 DFILESEIRQYIMLSWXXXXXXXXXXXXXXKSKISLNTSRKIWHFVIFLLIVEPFHLDPE 318
            +ILES IRQ I+ +W              K  +SLNTSRK+WHF+IFLLI+  F +D  
Sbjct: 290 KYILESTIRQKILFAWSSILILSIPSILIEKDSLSLNTSRKLWHFIIFLLIIPSFQMDSN 349

Query: 319 FVKISLCGIIPCFLSVEYLRYLKIEPYGEHLDFFLRSFADYRDQRGPLIVSYIYLITGIT 378
           FVKI+L G IP FLS+EY+R+  + P G  ++  LR FAD RD  GPLI+SY+YL+ GI+
Sbjct: 350 FVKIALSGTIPVFLSIEYIRFQNLPPLGSAIELQLRRFADDRDHSGPLIISYLYLLFGIS 409

Query: 379 IPLLLFESPVGLVSLGVGDSLASIVGKKVGRMHWKGTNKTIEGTVAFIVGTTFISWILQR 438
            PLL+  SP+GL+ LG+GDSLASI+GK+ GR+ WKGT KT+EGT+AFIV +  +  +L R
Sbjct: 410 TPLLMNNSPMGLIGLGIGDSLASIIGKRYGRIRWKGTQKTLEGTLAFIVTSFIVCLVLLR 469

Query: 439 YFNY--FSTIDIFKILVICTTGGVLEGNSELNDNILIPLFMV 478
           +     F+ +   ++L +CT  GVLEGNS LNDNILIP FM+
Sbjct: 470 FDKAAIFNHLTTLQLLTLCTLSGVLEGNSVLNDNILIPAFMM 511

>Sklu_2168.2 YMR013C, Contig c2168 1038-2540 reverse complement
          Length = 500

 Score =  276 bits (706), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 175/405 (43%), Positives = 247/405 (60%), Gaps = 16/405 (3%)

Query: 79  FDDFYRIYLPFLVSFTFCDRTLTELNMIMSTTAVIPSNYTPIHLVGLIFQAGLMKIGMHN 138
           F+  Y +YLPF++S  F  R      +++++     S   P+HL  L  Q   + I    
Sbjct: 100 FNVIYLLYLPFMLSLLFARRL-----VLVNSAMAFNSTDIPVHL-KLPLQLVFVLINEEY 153

Query: 139 Y-DYISGVKCLVANYLLVNWLEDIGQLKTLDQIDCNLFGILLTDCL-MINNATAPNYLLV 196
           Y D  + +K +  N  L   LE I  LK+LD +DCNLF ILLT+ L +I++ T   +  +
Sbjct: 154 YTDRSTNMKAIAINVALCYVLEKISDLKSLDHVDCNLFSILLTNVLYLIDSPTV--HFQI 211

Query: 197 LKGAMTSVMIIIVVNHFLT---RLIPSLSNSIVLAGNFLVLFPILVNHLIDFSNEKITSP 253
           L+  +   ++ + VN+ L+   R   +   S++L  +F ++FP+ V  ++    +K   P
Sbjct: 212 LQKVLYGFIVAVSVNYALSFPLRYASTYLRSLILFSSFSLIFPLTVTRILTIDRKK---P 268

Query: 254 ALWLIDFILESEIRQYIMLSWXXXXXXXXXXXXXXKSKISLNTSRKIWHFVIFLLIVEPF 313
             WL ++I  S+ R  I+  W              KS  SLNTSRKIWHF+I  L++ P 
Sbjct: 269 LTWLYEYIFSSDTRIKIIFIWLLCLLVLIPNVMIFKSNFSLNTSRKIWHFLILFLLIPPL 328

Query: 314 HLDPEFVKISLCGIIPCFLSVEYLRYLKIEPYGEHLDFFLRSFADYRDQRGPLIVSYIYL 373
            LDPEFVK+SL G +  FL VEYLRYLK+EP G+ LD  LRSF+D+RD RGP+I+SYIYL
Sbjct: 329 QLDPEFVKVSLSGTVVLFLVVEYLRYLKLEPVGKFLDEKLRSFSDFRDDRGPIIISYIYL 388

Query: 374 ITGITIPLLLFESPVGLVSLGVGDSLASIVGKKVGRMHWKGTNKTIEGTVAFIVGTTFIS 433
           I G++ P+L+  S VG++SLGVGDSLASIVG K GR+ W GTNKT+EGT+ FI+ T+ +S
Sbjct: 389 IIGVSAPILINGSLVGVISLGVGDSLASIVGGKWGRIKWPGTNKTVEGTLVFILATSAVS 448

Query: 434 WILQRYFNYFSTIDIFKILVICTTGGVLEGNSELNDNILIPLFMV 478
              Q  +N FS I    +++ C   G+LEGNS LNDNILIP FM+
Sbjct: 449 LFCQHRYNSFSPISNGNVVLTCIVSGILEGNSVLNDNILIPPFML 493

>Kwal_26.8164
          Length = 500

 Score =  269 bits (687), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 169/408 (41%), Positives = 246/408 (60%), Gaps = 24/408 (5%)

Query: 79  FDDFYRIYLPFLVSFTFCDRTLTELNMIMSTTAVIPSNYT-----PIHLVGLIFQAGLMK 133
           F+  Y +Y+P L+S  F  R LT +NM ++      +++      P+  + ++       
Sbjct: 100 FNVLYLLYIPSLLSLLFA-RDLTVVNMALAFNC---TDHPLILRLPLQAIFVLMNNDFGD 155

Query: 134 IGMHNYDYISGVKCLVANYLLVNWLEDIGQLKTLDQIDCNLFGILLTDCLMINNATAPNY 193
               N   I G+ CL+  +L+    E IGQLK+ D+++ NLF I LT+ L +  +++ ++
Sbjct: 156 KRSKNLKAI-GINCLI-EFLI----ERIGQLKSFDRVESNLFSICLTNVLYLLESSSLHF 209

Query: 194 LLVLKGAMTSVMIIIVVNHFL----TRLIPSLSNSIVLAGNFLVLFPILVNHLIDFSNEK 249
             VL+  +   +  +  N  L    +R  P L ++I L+ +F V+FP+ + +  +   + 
Sbjct: 210 Q-VLRHVLLGFLAAVAFNFPLLIITSRFNPYLRSAI-LSTSFFVVFPLTILYTFEVEGQ- 266

Query: 250 ITSPALWLIDFILESEIRQYIMLSWXXXXXXXXXXXXXXKSKISLNTSRKIWHFVIFLLI 309
             +PA+WL D+I  ++IR  I+  W              KS  SLNTSRKIWHF+I  LI
Sbjct: 267 --NPAIWLFDYITSNDIRVRIIAGWLSCLVILVPNIMIFKSNFSLNTSRKIWHFLILALI 324

Query: 310 VEPFHLDPEFVKISLCGIIPCFLSVEYLRYLKIEPYGEHLDFFLRSFADYRDQRGPLIVS 369
             PF  DP+FVKISL G I  FL+VEYLR+LK+ PYGE LD  LRSFAD+RD+RGP+I+S
Sbjct: 325 AVPFRYDPDFVKISLAGTIVLFLAVEYLRFLKLAPYGELLDSKLRSFADFRDERGPIIIS 384

Query: 370 YIYLITGITIPLLLFESPVGLVSLGVGDSLASIVGKKVGRMHWKGTNKTIEGTVAFIVGT 429
           YIYLI G+  P+L+  S VG++SLGVGDSLASIVG + GR  W GT+KT+EGT AFI+ T
Sbjct: 385 YIYLIIGVATPILINGSLVGVISLGVGDSLASIVGYRWGRHQWPGTSKTLEGTFAFILST 444

Query: 430 TFISWILQRYFNYFSTIDIFKILVICTTGGVLEGNSELNDNILIPLFM 477
           +  S   + +   F  I   ++++ C   G+LEGNS LNDNILIP +M
Sbjct: 445 SICSLCFKLFLGAFQEITSAQVILACILSGILEGNSVLNDNILIPAYM 492

>ABR051C [642] [Homologous to ScYMR013C (SEC59) - SH]
           (487498..488952) [1455 bp, 484 aa]
          Length = 484

 Score =  260 bits (664), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 144/407 (35%), Positives = 226/407 (55%), Gaps = 11/407 (2%)

Query: 75  RRKLFDDFYRIYLPFLVSFTFCDRTLTELNMIMSTTAV-IPSNYTPIHLVGLIFQAGLMK 133
           R   F+  Y +YLP +VS  F  R L  +N  M+   + +P     +  + +++   L  
Sbjct: 75  RVPAFNAVYVVYLPVMVSLLF-RRELVPVNCAMALGGMQMPVVLRVLQQLTILY---LQP 130

Query: 134 IGMHNYDYISGVKCLVANYLLVNWLEDIGQLKTLDQIDCNLFGILLTDCLMINNATAPNY 193
                     G        ++  W     +L++LD +DC L  ILLT+ L +    +   
Sbjct: 131 AARGRGFPGRGGVGGAPGGVVGRW-RGWSELRSLDMVDCGLLSILLTNVLFVIGGESSVQ 189

Query: 194 LLVLKGAMTSVMIIIVVNHFLTRLIPSLSN---SIVLAGNFLVLFPILVNHLIDFSNEKI 250
             +L+  +   ++ +  N+   R     +    + VL   F ++FP ++   +D  +   
Sbjct: 190 FQILRACLYGFLVAVGANYVFVRAYGRRNQYVRTAVLLAVFALVFPSVILAFLDLDDTD- 248

Query: 251 TSPALWLIDFILESEIRQYIMLSWXXXXXXXXXXXXXXKSKISLNTSRKIWHFVIFLLIV 310
            +  +WLI +I  S +R  IM  W              KS +SLNTSRKIWHF +  L+V
Sbjct: 249 -NALVWLIKYIFSSALRMQIMAGWLVFLGVLIPSVFVMKSHLSLNTSRKIWHFALLPLLV 307

Query: 311 EPFHLDPEFVKISLCGIIPCFLSVEYLRYLKIEPYGEHLDFFLRSFADYRDQRGPLIVSY 370
               ++PEF  +++ G +  FL VEY RY+ + P+G++++  LR+F D+RD++GP+IVSY
Sbjct: 308 CQMAVEPEFTTVAIAGTVVVFLIVEYFRYMNLYPFGDYINAQLRTFTDFRDEQGPIIVSY 367

Query: 371 IYLITGITIPLLLFESPVGLVSLGVGDSLASIVGKKVGRMHWKGTNKTIEGTVAFIVGTT 430
           +YLI G++ PLL+  S VG++SLGVGDSLASI+G++ G+ HW GTNKT+EGT+AFIV + 
Sbjct: 368 LYLILGVSFPLLINRSLVGVISLGVGDSLASIIGRRYGKYHWPGTNKTVEGTLAFIVASA 427

Query: 431 FISWILQRYFNYFSTIDIFKILVICTTGGVLEGNSELNDNILIPLFM 477
            +  + Q+ F  F  +    I++ C   G+LEGNS+LNDNILIP FM
Sbjct: 428 ALCLVCQQAFLAFEGVATRNIILACVVSGILEGNSDLNDNILIPSFM 474

>KLLA0D11198g complement(954239..955786) some similarities with
           sp|P20048 Saccharomyces cerevisiae YMR013c SEC59
           dolichol kinase singleton, hypothetical start
          Length = 515

 Score =  248 bits (634), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 144/341 (42%), Positives = 207/341 (60%), Gaps = 13/341 (3%)

Query: 145 VKCLVANYLLVNWLEDIGQLKTLDQIDCNLFGILLTDCLMINNATAPNYLLVLKGAMTSV 204
           VK LV NY  +  L    +LK+LD+ +C++F +L TD L +  + +  Y  V +   TS 
Sbjct: 173 VKALVLNYFFIFGLYKTSKLKSLDKTECHMFALLCTDILALVESDSI-YFQVFQVCFTSF 231

Query: 205 MIIIVVNHFLTRLIPSLSNSIVLAGNFLVLFPILVNHLIDFSNEKITS-------PALWL 257
           ++++ V   ++  + S+  +  +    L+L P++V   + FS    T+       P  WL
Sbjct: 232 IVLVTVTSAVSYGLESVGATRWIRT--LLLLPMIV---VGFSYYIQTNLIINNVPPFTWL 286

Query: 258 IDFILESEIRQYIMLSWXXXXXXXXXXXXXXKSKISLNTSRKIWHFVIFLLIVEPFHLDP 317
           ID+I  S IR  IM  W              KS  SLNTSRK+WHF I  L++    +D 
Sbjct: 287 IDYIGSSMIRLKIMGIWLGSALLLLPSVFALKSNWSLNTSRKVWHFAILPLLIPAIMMDS 346

Query: 318 EFVKISLCGIIPCFLSVEYLRYLKIEPYGEHLDFFLRSFADYRDQRGPLIVSYIYLITGI 377
            FVKI+L G +  FL VEY+R+L I P G +LD  LRSFAD+RD++GP+I+SY+Y I GI
Sbjct: 347 NFVKIALAGTVNLFLIVEYIRFLHIYPVGHYLDKHLRSFADFRDEKGPIIISYLYFIIGI 406

Query: 378 TIPLLLFESPVGLVSLGVGDSLASIVGKKVGRMHWKGTNKTIEGTVAFIVGTTFISWILQ 437
           ++P L+  S +G++SLGVGDSLASI+GKK GR  W  T KT EGT AFI  T   + I++
Sbjct: 407 SLPFLINGSIIGIISLGVGDSLASIIGKKFGRNRWPNTCKTFEGTFAFIAATGITTVIMK 466

Query: 438 RYFNYFSTIDIFKILVICTTGGVLEGNSELNDNILIPLFMV 478
            YFN+F+ +    ++++C   G+LEGNS LNDN+LIP FM+
Sbjct: 467 VYFNFFTEVSFMNLVLVCFLAGILEGNSTLNDNLLIPTFML 507

>CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces
           cerevisiae YAL017w FUN31, start by similarity
          Length = 1336

 Score = 32.7 bits (73), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 29/54 (53%)

Query: 110 TAVIPSNYTPIHLVGLIFQAGLMKIGMHNYDYISGVKCLVANYLLVNWLEDIGQ 163
           +A I  N   + + G+ +QAGL  +  HNY  IS  K +V N    ++ + +G+
Sbjct: 739 SATILENEMKLKIHGIPYQAGLFVVDSHNYQMISFNKSIVKNMFGYHFSDMVGK 792

>YOR311C (HSD1) [5095] chr15 complement(899051..899923) Integral ER
           membrane protein that affects sensitivity to nickel
           chloride and nalidixic acid [873 bp, 290 aa]
          Length = 290

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 4/74 (5%)

Query: 371 IYLITGITIPLLLFESPVGLVSL---GVGDSLASIVGKKVGRMHWK-GTNKTIEGTVAFI 426
           ++ I G+      F   V L+SL      D+ A+ +G+K G +  K   NK++ G++A  
Sbjct: 148 LWYILGLIFSFNFFSKDVTLISLFLLSWSDTAAATIGRKYGHLTPKVARNKSLAGSIAAF 207

Query: 427 VGTTFISWILQRYF 440
                  W+   YF
Sbjct: 208 TVGVITCWVFYGYF 221

>Kwal_47.19023
          Length = 1657

 Score = 30.4 bits (67), Expect = 3.9,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 113 IPSNYTPIHLVGLIFQAGLMKIGMHNYDYISGVK-CLV-ANYLLVNWLED-IGQLKTLDQ 169
           I S+Y    +  L  +AGL +  + NY  I  +K C+V +N L ++WL    GQL     
Sbjct: 608 IFSHYDKPTIASLSEKAGLFQRALENYTDIKDIKRCIVHSNALPIDWLVSYFGQLNVEQS 667

Query: 170 IDCNLFGILLTDCLMIN 186
           + C     LL D L  N
Sbjct: 668 VAC--LKALLDDNLKAN 682

>CAGL0L04686g 537206..538561 similar to sp|P53264 Saccharomyces
           cerevisiae YGR110w, hypothetical start
          Length = 451

 Score = 29.6 bits (65), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 34/168 (20%), Positives = 70/168 (41%), Gaps = 31/168 (18%)

Query: 308 LIVEPFHLDPEFVKISLCGIIPCFLSVEYLRYLKIEPYGEHLDFFLRSFADYRDQRGPLI 367
           L++EP ++DP               + +  R + +  YG  L F+L+++     +  PL+
Sbjct: 119 LVIEPANVDP---------------NKKRKRLIFVHGYGAGLGFYLKNY-----EHLPLL 158

Query: 368 VSYIYLITGITIPLLLFESPVGLVSLGVGDSLASIVGKKVGRM----HWKGTNKTIEGTV 423
               + I  I +P   F S +        D  + +    + R+      +G +K+    +
Sbjct: 159 DD-SWSIHAIDLPGYGFSSRMDFPFQFPRDDTSVVCDWFISRLRTLFEKRGFDKSDNIVM 217

Query: 424 AFIVGTTFISWILQRYFNYFSTIDIFKILVICTTGGVLEGNSELNDNI 471
           A  +G   +++ L +Y       D  K +V+C+  G+      +N+NI
Sbjct: 218 AHSMGAYLMAFYLNKY------PDSVKKMVMCSPAGISRSQYSINNNI 259

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.329    0.145    0.444 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,470,006
Number of extensions: 589174
Number of successful extensions: 1547
Number of sequences better than 10.0: 13
Number of HSP's gapped: 1563
Number of HSP's successfully gapped: 13
Length of query: 480
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 375
Effective length of database: 12,961,219
Effective search space: 4860457125
Effective search space used: 4860457125
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 63 (28.9 bits)