Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M07678g47346616940.0
Scas_709.544704855351e-62
Sklu_2168.34793033681e-38
Kwal_26.81704933023551e-36
KLLA0D11220g4772272773e-26
YMR014W (BUD22)5192252446e-22
ABR052W5092362322e-20
KLLA0F14509g85160692.0
Scas_679.2549160639.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M07678g
         (466 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M07678g complement(767857..769278) similar to sp|Q04347 Sac...   657   0.0  
Scas_709.54                                                           210   1e-62
Sklu_2168.3 YMR014W, Contig c2168 4667-6106                           146   1e-38
Kwal_26.8170                                                          141   1e-36
KLLA0D11220g 958249..959682 weakly similar to sp|Q04347 Saccharo...   111   3e-26
YMR014W (BUD22) [3978] chr13 (298867..300426) Protein with possi...    99   6e-22
ABR052W [643] [Homologous to ScYMR014W (BUD22) - SH] complement(...    94   2e-20
KLLA0F14509g complement(1345334..1347889) weakly similar to sp|P...    31   2.0  
Scas_679.25                                                            29   9.1  

>CAGL0M07678g complement(767857..769278) similar to sp|Q04347
           Saccharomyces cerevisiae YMR014w, hypothetical start
          Length = 473

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/466 (72%), Positives = 337/466 (72%)

Query: 1   MSKENLLLKLDRLEYQWHYLQETHEKFEPRFPFTQRFFXXXXXXXXXXXXXILESSDKEK 60
           MSKENLLLKLDRLEYQWHYLQETHEKFEPRFPFTQRFF             ILESSDKEK
Sbjct: 1   MSKENLLLKLDRLEYQWHYLQETHEKFEPRFPFTQRFFNAKGKKNNKKVTKILESSDKEK 60

Query: 61  VRSDLKEVRVEILNRKIHNVEKHVNNYLFKTIKSIVSNDKSVFQPVLEAVEAKYGAGDAG 120
           VRSDLKEVRVEILNRKIHNVEKHVNNYLFKTIKSIVSNDKSVFQPVLEAVEAKYGAGDAG
Sbjct: 61  VRSDLKEVRVEILNRKIHNVEKHVNNYLFKTIKSIVSNDKSVFQPVLEAVEAKYGAGDAG 120

Query: 121 LHDFCEIVTKSKAIKFIISKLQKSSANIASANEEVSDKRIPKWAADHEYVKMWTDKNNKY 180
           LHDFCEIVTKSKAIKFIISKLQKSSANIASANEEVSDKRIPKWAADHEYVKMWTDKNNKY
Sbjct: 121 LHDFCEIVTKSKAIKFIISKLQKSSANIASANEEVSDKRIPKWAADHEYVKMWTDKNNKY 180

Query: 181 NPSKVWNEDVTKIKSCDALISRVMNGKKYKQMMDQFDDSLDLFLNINXXXXXXXXXXXXX 240
           NPSKVWNEDVTKIKSCDALISRVMNGKKYKQMMDQFDDSLDLFLNIN             
Sbjct: 181 NPSKVWNEDVTKIKSCDALISRVMNGKKYKQMMDQFDDSLDLFLNINKQKRLQKQQEKKK 240

Query: 241 XXXXXXXXXXXXNEDASGDDFGYSDNDDPRYNENIDEDELLKQYDGMLVGXXXXXXXXXX 300
                       NEDASGDDFGYSDNDDPRYNENIDEDELLKQYDGMLVG          
Sbjct: 241 STKTSSKQHEEENEDASGDDFGYSDNDDPRYNENIDEDELLKQYDGMLVGSDDESDEEED 300

Query: 301 XXXXXXXXXXXXXRIGXXXXXXXXXXXXXXXXXXXMVGYVSGGSDEEIEVDDIAKEQIEI 360
                        RIG                   MVGYVSGGSDEEIEVDDIAKEQIEI
Sbjct: 301 SAKSSASEDETSERIGKQEPVPKLKKKEKAKLPELMVGYVSGGSDEEIEVDDIAKEQIEI 360

Query: 361 KPQKKNRRGQRARRKIWEQKYGSKAKHVQXXXXXXXXXXXXXQXXXXXXXXXXXXXXXQN 420
           KPQKKNRRGQRARRKIWEQKYGSKAKHVQ             Q               QN
Sbjct: 361 KPQKKNRRGQRARRKIWEQKYGSKAKHVQREIEKEMEKKRKRQAEYEERVAKRAARAEQN 420

Query: 421 EEYQXXXXXXXXXXXXXXXXXXXXXDHPSWVAKKMAEDKEKNAKFA 466
           EEYQ                     DHPSWVAKKMAEDKEKNAKFA
Sbjct: 421 EEYQAKKAEIKREKEEHRKKLEKIEDHPSWVAKKMAEDKEKNAKFA 466

>Scas_709.54
          Length = 470

 Score =  210 bits (535), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 157/485 (32%), Positives = 216/485 (44%), Gaps = 41/485 (8%)

Query: 1   MSKENLLLKLDRLEYQWHYLQETHEKFEPRFPFTQRFFXXXXXXXXXXXXXILESSDKEK 60
           M K+NLL KLD LEYQ HYL  T + FEPR   T++F+             +L     E 
Sbjct: 1   MPKDNLLFKLDNLEYQQHYLNNTLDSFEPRLNQTRKFYNAKGRKTIKKVEKLLNEIKIED 60

Query: 61  VRSDLKEVRVEILNRKIHNVEKHVNNYLFKTIKSIVSNDKSVF-----QPVLEAVEAKYG 115
           V   L E+++EI ++KIH    H  N L K +  ++ N+ S       +  LEA++ +YG
Sbjct: 61  VERQLNEIKLEIFDKKIH----HFENNLTKNLIKLLENENSKLIKNFDKTTLEAIKNQYG 116

Query: 116 AGDAGLHDFCEIVTKSKAIKFIISKLQKSSANIASANEEVSDKRIPKWAADHEYVKMWTD 175
                +  F +++  SK+IK    K+   S  I            P+W   H Y +++ D
Sbjct: 117 -----IPQFAKLLCLSKSIKLTTGKIVPKSKKIEDT---------PQWFVKHNYWEIYQD 162

Query: 176 KNNKYNPSKVWNEDVTKIKSCDALISRVMNGKKYKQMMDQFDDSLDLFLNINXXXXXXXX 235
           KNN++NPS++WNE + KIK  DAL+S +MN KK K ++  F++ +D+FL IN        
Sbjct: 163 KNNEFNPSRIWNEVIMKIKKSDALVSLIMNDKKVKDIIQSFENGMDVFLGINKGKKLQRE 222

Query: 236 XXXXXXXXXXXXXXXXXNEDASGDDFGYSDNDDPRYNENI-------DEDELLKQYDGML 288
                             +DAS DD      + P             DEDE+L QY+GML
Sbjct: 223 KNGLNKASSSNNEVEMQEDDASEDD---ELTERPALRRETRDEDQEIDEDEILNQYEGML 279

Query: 289 VGX--XXXXXXXXXXXXXXXXXXXXXXRIGXXXXXXXXXXXXXXXXXXXMVGYVSGG--S 344
                                                            M GY SGG  S
Sbjct: 280 AASDDEEGEEASGLDKTINYNEVTDEEPSDDEDSESEEPSRKKPKLPELMGGYYSGGESS 339

Query: 345 DEEIEVDDIAKEQIEIKPQKKNRRGQRARRKIWEQKYGSKAKHVQXXXXXXXXXXXXXQX 404
           D+E E D IA+EQ+  KPQ+KNRRGQRARRKIWE+KYGS+AKHVQ             Q 
Sbjct: 340 DDEKE-DKIAREQMSNKPQRKNRRGQRARRKIWEKKYGSQAKHVQREVEKEFEERKQRQI 398

Query: 405 XXXXXXXXXXXXXXQNEEY---QXXXXXXXXXXXXXXXXXXXXXDHPSWVAKKMAEDKEK 461
                           ++                          +HPSWVAK++AE+KEK
Sbjct: 399 AYEERAAKRAAKEEAFQKMVREHELERESKQGQSKWPKVKEPQAEHPSWVAKRVAEEKEK 458

Query: 462 NAKFA 466
           NAKF+
Sbjct: 459 NAKFS 463

>Sklu_2168.3 YMR014W, Contig c2168 4667-6106
          Length = 479

 Score =  146 bits (368), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 92/303 (30%), Positives = 149/303 (49%), Gaps = 34/303 (11%)

Query: 1   MSKENLLLKLDRLEYQWHYLQETHEKFEPRFPFTQRFFXXXXXXXXXXXXXILESSDKEK 60
           M KENL+ KLD LEYQ+HYL  T + F+PR   T + F             +L  +  + 
Sbjct: 1   MPKENLIFKLDNLEYQYHYLNNTLDDFKPRLSSTNKLFHAKGKKTSKKISKLLSDATLDS 60

Query: 61  VRSDLKEVRVEILNRKIHNVEKHVNNYLFKTIKSIV----------SNDKSVFQPVLEAV 110
           V   L ++R   L +K+++++K + +YL K ++              NDK   +  LE +
Sbjct: 61  VSQQLDDLRQSFLEKKVYHLQKRLESYLEKALQQQYDALPKKAEQKENDKKNLK-ALEDI 119

Query: 111 EAKYGAGDAGLHDFCEIVTKSKAIKFIISKLQKSSANIASANEEVSDKRIPKWAADHEYV 170
           ++     D     F +++ KSK ++ +ISK+  +         +   +  P+W    + +
Sbjct: 120 KS-----DFTFTKFSQLIAKSKIVRLVISKITPT---------KTLKENPPQWFESSDIL 165

Query: 171 KMWTDKNNKYNPSKVWNEDVTKIKSCDALISRVMNGKKYKQMMDQFDDSLDLFLNINXXX 230
            ++ DK ++ NPS VWN+ V KI+ C+ L+S +MN KKYK+++D FD  +D+FL IN   
Sbjct: 166 HVYRDKEDECNPSNVWNKVVMKIEGCEKLLSVMMNSKKYKELIDSFDRGMDVFLGINREK 225

Query: 231 XXXXXXXXXXXXXXXXXXXXXXNEDASGDDF---GYSDNDDPRYNENIDEDELLKQYDGM 287
                                  +D SG+DF   G SD +D       DE+ L++QY GM
Sbjct: 226 KLQNKKVEANKKSSNAL------DDDSGEDFTDDGVSDREDDAEFSTADEEALVQQYKGM 279

Query: 288 LVG 290
           L G
Sbjct: 280 LAG 282

 Score = 95.1 bits (235), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 54/130 (41%), Positives = 64/130 (49%)

Query: 336 MVGYVSGGSDEEIEVDDIAKEQIEIKPQKKNRRGQRARRKIWEQKYGSKAKHVQXXXXXX 395
           M GY SGGSD+EIE D IAKEQ+  +P++KNRRGQRAR+KIWE+KYG  AKHVQ      
Sbjct: 342 MAGYFSGGSDDEIEDDRIAKEQLSNEPKRKNRRGQRARQKIWEKKYGKNAKHVQRQHEKD 401

Query: 396 XXXXXXXQXXXXXXXXXXXXXXXQNEEYQXXXXXXXXXXXXXXXXXXXXXDHPSWVAKKM 455
                  Q               +  E                        HPSW AKK 
Sbjct: 402 KEEREKRQVEYEERVAKRAANSVRLAEEAREKAQRLEERKRQQEEKRNDPIHPSWQAKKQ 461

Query: 456 AEDKEKNAKF 465
           AE++ KN KF
Sbjct: 462 AEERLKNVKF 471

>Kwal_26.8170
          Length = 493

 Score =  141 bits (355), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 95/302 (31%), Positives = 151/302 (50%), Gaps = 26/302 (8%)

Query: 1   MSKENLLLKLDRLEYQWHYLQETHEKFEPRFPFTQRFFXXXXXXXXXXXXXILESSDKEK 60
           M KENL+ KLD LEYQ+H+L  + + F+PR   T + F             +L  S+  +
Sbjct: 1   MPKENLIFKLDNLEYQYHHLNNSLDGFQPRLSGTAKTFNAKGKKASKRIQKLLYESNLTE 60

Query: 61  VRSDLKEVRVEILNRKIHNVEKHVNNYLFKTIK----SIV--SNDKSVFQ-PVLEAVEAK 113
           V   L  +R EI+ +K +++E  + + L K ++    S++  SN+K+  +   L  +E  
Sbjct: 61  VSRALDSLRREIVEKKAYHLENKLASLLEKNLQQQYSSLLKNSNEKNKDRLKTLATLEKS 120

Query: 114 YGAGDAGLHDFCEIVTKSKAIKFIISKLQKSSANIASANEEVSDKRIPKWAADHEYVKMW 173
           Y      +  F +++ K +  K ++ KL  + A              P+W  D+EYV ++
Sbjct: 121 YT-----IPGFSKLIAKYRTCKLLVPKLLFTKALREDP---------PQWLKDNEYVTIF 166

Query: 174 TDKNNKYNPSKVWNEDVTKIKSCDALISRVMNGKKYKQMMDQFDDSLDLFLNINXXXXXX 233
            DKNN +NP KVWNE +   + C+ L+S  MN KK K+++  FD ++DLF+N        
Sbjct: 167 NDKNNTHNPGKVWNEVIVATEGCERLLSLTMNDKKIKELLSGFDSAMDLFMNKKKEREAS 226

Query: 234 XXXXXXXXXXXXX--XXXXXXNEDASGD-DFG--YSDNDDPRYNENIDEDELLKQYDGML 288
                                +ED +GD DF    S+ +D   +  IDEDE+LKQY+GML
Sbjct: 227 QNNTNEQSKPSRAVPETDERSSEDENGDNDFASSSSEGEDADGSALIDEDEILKQYEGML 286

Query: 289 VG 290
           V 
Sbjct: 287 VA 288

 Score = 88.2 bits (217), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 66/130 (50%), Gaps = 3/130 (2%)

Query: 336 MVGYVSGGSDEEIEVDDIAKEQIEIKPQKKNRRGQRARRKIWEQKYGSKAKHVQXXXXXX 395
           M GY SGGSD+EI  D++A +Q   +P++KNRRGQRAR+KIWE+KYG  AKHVQ      
Sbjct: 360 MTGYYSGGSDDEISEDEVAAKQASNEPKRKNRRGQRARQKIWEKKYGHNAKHVQ---RQV 416

Query: 396 XXXXXXXQXXXXXXXXXXXXXXXQNEEYQXXXXXXXXXXXXXXXXXXXXXDHPSWVAKKM 455
                  +               + ++ +                      HPSW AKKM
Sbjct: 417 EAEKSERERKKQEYEARVAKRAARAQDREATTRKRPSDPKTWEAPAKDAPIHPSWEAKKM 476

Query: 456 AEDKEKNAKF 465
           AE+K+K AKF
Sbjct: 477 AEEKQKGAKF 486

>KLLA0D11220g 958249..959682 weakly similar to sp|Q04347
           Saccharomyces cerevisiae YMR014w singleton, start by
           similarity
          Length = 477

 Score =  111 bits (277), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 66/227 (29%), Positives = 120/227 (52%), Gaps = 34/227 (14%)

Query: 1   MSKENLLLKLDRLEYQWHYLQETHEKFEPRFPFTQRFFXXXXXXXXXXXXXILESSDKEK 60
           M K+NL+ KLD LEYQ HY+    E+F+PRF  T +FF             +LE++DK+K
Sbjct: 1   MGKDNLIFKLDNLEYQIHYMNNEAEQFQPRFKQTLQFFNSKSRKTNKKVTKLLEAADKQK 60

Query: 61  VRSDLKEVRVEILNRKIHNVEKHVNNYLFKTIKSIVSNDKSVFQPVL--EAVEAKYGAGD 118
           +  ++  +R++IL++KIH+V + +  +  K              P++  E   AK GA  
Sbjct: 61  INGEISSLRLKILDQKIHHVLQRLQTHWIKN-------------PLILREPEVAKIGA-- 105

Query: 119 AGLHDFCEIVTKSKAIKFIISKLQKSSANIASANEEVSDKRIPKWAADHEYVKMWTDKNN 178
                F + ++ SK +K  +S +               +K  P+W  +HE+ ++  DK N
Sbjct: 106 ---EQFIKYMSYSKLVKLTMSLM-------------GGNKTCPEWFREHEFYQISNDKTN 149

Query: 179 KYNPSKVWNEDVTKIKSCDALISRVMNGKKYKQMMDQFDDSLDLFLN 225
           + NPS+++N   +K K  ++L+S+++N K  K ++  +++ + + LN
Sbjct: 150 ELNPSRIYNGVFSKNK-LNSLVSKLLNNKNVKDLIQTYENGIHVILN 195

 Score = 83.6 bits (205), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 54/139 (38%), Positives = 67/139 (48%), Gaps = 11/139 (7%)

Query: 336 MVGYVSGGSDEEIEVDD-IAKEQIEIKPQKKNRRGQRARRKIWEQKYGSKAKHVQXXXXX 394
           M GY+SG  DEE ++DD +A++QI   P KKNRRGQRAR+KIWE+KYGS+AKHVQ     
Sbjct: 333 MNGYISG--DEEEDLDDKVARKQIAAVPVKKNRRGQRARQKIWEKKYGSQAKHVQRQLEK 390

Query: 395 XXXXXXXXQXXXXXXXXXXXXXXXQNEEYQXXXXXXXXXXXXXXXXXXXXXD-------- 446
                   Q               Q  E Q                              
Sbjct: 391 EHKERETRQQEYEQRQAKREAKAAQLAEQQRKRVSQYNSQSSTSNIPPPPQPVITADKPI 450

Query: 447 HPSWVAKKMAEDKEKNAKF 465
           HPSW AK++AE+K+KN KF
Sbjct: 451 HPSWEAKRIAEEKQKNVKF 469

>YMR014W (BUD22) [3978] chr13 (298867..300426) Protein with possible
           role in bud site polarity, has possible coiled-coil
           domain [1560 bp, 519 aa]
          Length = 519

 Score = 98.6 bits (244), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 63/225 (28%), Positives = 111/225 (49%), Gaps = 15/225 (6%)

Query: 7   LLKLDRLEYQWHYLQETHEKFEPRFPFTQRFFXXXXXXXXXXXXXILESSDKEKVRSDLK 66
           + KLD+LEYQ+HYL ++ +KFEPR+P T + +             +L S + + +  +L 
Sbjct: 9   IYKLDQLEYQYHYLTKSLQKFEPRYPKTAKLYNCIGKKNKKKIEKLLNSLELKTLDKELD 68

Query: 67  EVRVEILNRKIHNVEKHVNNYLFKTIKSIVSNDKSVFQ-------PVLEAVEAKYGAGDA 119
           E   ++LN KIH  E H++  + + I+ I   + S  +       P ++    K  A   
Sbjct: 69  ESYSKLLNNKIHYYETHLSKCIKEQIQKISKKNSSKVKDAQKNKSPSIDI--EKMLATQL 126

Query: 120 GLHDFCEIVTKSKAIKFIISKLQKSSANIASANEEVSDKRIPKWAADHEYVKMWTDKNNK 179
            L D    +T+ + IK +  ++++ S  I        D     W  +++Y     DK +K
Sbjct: 127 SLDDLALFMTRFRLIKILHQRIKQKSKKIE------GDTNNKTWLNNNDYSGYINDKTSK 180

Query: 180 YNPSKVWNEDVTKIKSCDALISRVMNGKKYKQMMDQFDDSLDLFL 224
           +NPS +WNE +TK+ SC+ L + +   K  + + + FD S+ L  
Sbjct: 181 WNPSNIWNEVITKLPSCEKLNALIGQSKIVQNLTESFDLSICLIF 225

 Score = 74.3 bits (181), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 49/150 (32%), Positives = 63/150 (42%), Gaps = 20/150 (13%)

Query: 336 MVGYVSGGSDEE-----------------IEVDDIAKEQIEIKPQKKNRRGQRARRKIWE 378
           M GY SG   EE                    D  A+EQ+  +P++KNRRGQRARRKIWE
Sbjct: 362 MAGYYSGNDTEEESDEDNKNVKGKKKKRDTAEDRTAREQMSNEPKRKNRRGQRARRKIWE 421

Query: 379 QKYGSKAKHVQXXXXXXXXXXXXXQXXXXXXXXXXXXXXXQNE---EYQXXXXXXXXXXX 435
           +KYGS+AKHVQ             Q                 E     +           
Sbjct: 422 KKYGSQAKHVQRELEKEMEDRKQRQIEYEARVAKREAKAASLEASRSREREDRRTETNNK 481

Query: 436 XXXXXXXXXXDHPSWVAKKMAEDKEKNAKF 465
                     +HPSW+AK++AE+K + AKF
Sbjct: 482 KEKESASTGEEHPSWIAKRLAEEKLQKAKF 511

>ABR052W [643] [Homologous to ScYMR014W (BUD22) - SH]
           complement(490427..491956) [1530 bp, 509 aa]
          Length = 509

 Score = 94.0 bits (232), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 57/236 (24%), Positives = 111/236 (47%), Gaps = 25/236 (10%)

Query: 1   MSKENLLLKLDRLEYQWHYLQETHEKFEPRFPFTQRFFXXXXXXXXXXXXXILESSDKEK 60
           ++K NL+ KLD  EYQ+H L  T  +F PR   T +++             +L     + 
Sbjct: 3   LNKPNLVYKLDHAEYQYHLLNNTVAEFHPRLGATAKYYNPQGKKAAQRVEKLLAGLTADG 62

Query: 61  VRSDLKEVRVEILNRKIHNVEKHVNNYLFKTIKSIVS----NDK------SVFQPVLEAV 110
           +   +  ++ E+L+ K+H+VE  +++ L K +++  +    N K      S  Q VLE V
Sbjct: 63  LLQQISSLKAELLDHKVHHVESKLSHLLVKQLENQATVLRKNPKKDEQRNSKLQ-VLEGV 121

Query: 111 EAKYGAGDAGLHDFCEIVTKSKAIKFIISKLQKSSANIASANEEVSDKRIPKWAADHEYV 170
           +        G   F  ++ +SK +K ++ K+  + A              P W  +H  +
Sbjct: 122 QR-----GPGFEQFVRLIVRSKVVKIVLGKICPTKA---------LKNDPPAWFQNHRIL 167

Query: 171 KMWTDKNNKYNPSKVWNEDVTKIKSCDALISRVMNGKKYKQMMDQFDDSLDLFLNI 226
           + + +K ++ NP +VW E V  +   + L+S++++ K  + ++   + S+DL L  
Sbjct: 168 QQFGNKEDECNPGRVWKEVVQAVAGGEQLVSQLLSTKAARDLLAALEASVDLVLGT 223

 Score = 67.4 bits (163), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 59/136 (43%), Gaps = 6/136 (4%)

Query: 336 MVGYVSGGSDEEIEVDDIAKEQIEIKPQK-KNRRGQRARRKIWEQKYGSKAKHVQXXXXX 394
           M GY SG  D + E  D+A +   ++P K KNRRGQRAR+KIWE+KYG  AKH+Q     
Sbjct: 366 MAGYYSGDDDSDAEEHDLAGKAEPLEPPKRKNRRGQRARQKIWEKKYGRNAKHIQQQFEK 425

Query: 395 XXXXXXXXQXXXXXXXXXXXXXXXQNEEYQXXXXXXXXXXXXXXXXXXXXXD-----HPS 449
                   Q               +    +                           HPS
Sbjct: 426 EREERARKQREYEERAAKRPAKEAELARTRPAFKDSAIRAAEPGAAKSAAKPVAQELHPS 485

Query: 450 WVAKKMAEDKEKNAKF 465
           W AKK++++K+K AKF
Sbjct: 486 WEAKKLSQEKQKAAKF 501

>KLLA0F14509g complement(1345334..1347889) weakly similar to
           sp|P38966 Saccharomyces cerevisiae YDR089w singleton,
           start by similarity
          Length = 851

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 3/60 (5%)

Query: 107 LEAVEAKYGAGDAGL---HDFCEIVTKSKAIKFIISKLQKSSANIASANEEVSDKRIPKW 163
            E+VE  +GAG+A L   HD  + +     I+F  S  Q ++ NI+    E    RI  W
Sbjct: 578 FESVEEMFGAGNALLKKTHDRYQSLLNPPTIEFSQSSSQNTAVNISPTVTEREKPRIRYW 637

>Scas_679.25
          Length = 491

 Score = 28.9 bits (63), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 126 EIVTKSKAIKFIISKLQKSSANIASANEEVSDKRIPKWAADHEYVKMWTDKNNKYNPSKV 185
           EI++K K +K  +   QK +  I S +   SDK   +W    E++++W    +++N +KV
Sbjct: 423 EIISKLKFMKLRVK--QKWNDGIHSRHSHKSDKYKKRWDLGVEWIRLWQKGYSEHNDTKV 480

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.131    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,128,817
Number of extensions: 439793
Number of successful extensions: 1739
Number of sequences better than 10.0: 28
Number of HSP's gapped: 1718
Number of HSP's successfully gapped: 40
Length of query: 466
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 361
Effective length of database: 12,961,219
Effective search space: 4679000059
Effective search space used: 4679000059
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 63 (28.9 bits)