Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M07656g53552727220.0
YMR015C (ERG5)53849623350.0
Sklu_2168.454049623140.0
Scas_709.5352349623020.0
KLLA0D11242g53449522350.0
ABR053C51547220120.0
Kwal_26.817233633615450.0
KLLA0E03553g5273722074e-17
YHR007C (ERG11)5302051825e-14
ADR162W5291871791e-13
CAGL0E04334g5333681781e-13
Kwal_47.183235362171737e-13
Sklu_2436.115321921728e-13
Scas_699.205384171622e-11
YDR402C (DIT2)489165987e-04
KLLA0C19206g511233950.002
KLLA0C06743g513237900.007
Kwal_47.18804508165830.049
KLLA0D11638g391150760.35
Scas_584.536746740.46
CAGL0M01408g104881692.7
AFR020W65664665.2
AFR661W117925666.0
YHR076W (PTC7)37446656.4
Sklu_1987.252367648.2
AAR028W37679648.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M07656g
         (527 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M07656g 765772..767379 highly similar to sp|P54781 Saccharo...  1053   0.0  
YMR015C (ERG5) [3979] chr13 complement(300868..302484) Cytochrom...   904   0.0  
Sklu_2168.4 YMR015C, Contig c2168 6356-7978 reverse complement        895   0.0  
Scas_709.53                                                           891   0.0  
KLLA0D11242g complement(959973..961577) highly similar to sp|P54...   865   0.0  
ABR053C [644] [Homologous to ScYMR015C (ERG5) - SH] (492258..493...   779   0.0  
Kwal_26.8172                                                          599   0.0  
KLLA0E03553g 329904..331487 highly similar to sp|P10614 Saccharo...    84   4e-17
YHR007C (ERG11) [2293] chr8 complement(120085..121677) Cytochrom...    75   5e-14
ADR162W [1904] [Homologous to ScYHR007C (ERG11) - SH] complement...    74   1e-13
CAGL0E04334g complement(415351..416952) highly similar to sp|P10...    73   1e-13
Kwal_47.18323                                                          71   7e-13
Sklu_2436.11 YHR007C, Contig c2436 26015-27613 reverse complement      71   8e-13
Scas_699.20                                                            67   2e-11
YDR402C (DIT2) [1228] chr4 complement(1272222..1273691) Cytochro...    42   7e-04
KLLA0C19206g 1711813..1713348 weakly similar to sp|O48923 Glycin...    41   0.002
KLLA0C06743g complement(590585..592126) similar to sp|P21595 Sac...    39   0.007
Kwal_47.18804                                                          37   0.049
KLLA0D11638g 995087..996262 similar to ca|CA4405|IPF8773 Candida...    34   0.35 
Scas_584.5                                                             33   0.46 
CAGL0M01408g complement(159500..162646) similar to tr|Q06680 Sac...    31   2.7  
AFR020W [3212] [Homologous to ScYBL015W (ACH1) - SH] complement(...    30   5.2  
AFR661W [3854] [Homologous to ScYGL140C - NSH] complement(164245...    30   6.0  
YHR076W (PTC7) [2365] chr8 (251102..252226) Protein phosphatase ...    30   6.4  
Sklu_1987.2 YBL015W, Contig c1987 2738-4309                            29   8.2  
AAR028W [214] [Homologous to ScYGR112W (SHY1) - SH] complement(3...    29   8.9  

>CAGL0M07656g 765772..767379 highly similar to sp|P54781
           Saccharomyces cerevisiae YMR015c C-22 sterol desaturase,
           start by similarity
          Length = 535

 Score = 1053 bits (2722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/527 (96%), Positives = 510/527 (96%)

Query: 1   MASVVDQVHMSMNXXXXXXXXXXXXXXXXXPSLLDKLQGMSYLQMFVTLICGVLVWDQVS 60
           MASVVDQVHMSMN                 PSLLDKLQGMSYLQMFVTLICGVLVWDQVS
Sbjct: 1   MASVVDQVHMSMNATAHAAGAASAGAVMAAPSLLDKLQGMSYLQMFVTLICGVLVWDQVS 60

Query: 61  YQMKKGNIAGPRFKVYPIIGPFLESLDPKFEEYKAKWDSGPLSCVSIFHKFVIIASTRDL 120
           YQMKKGNIAGPRFKVYPIIGPFLESLDPKFEEYKAKWDSGPLSCVSIFHKFVIIASTRDL
Sbjct: 61  YQMKKGNIAGPRFKVYPIIGPFLESLDPKFEEYKAKWDSGPLSCVSIFHKFVIIASTRDL 120

Query: 121 ARKVLQAPKYVKPCVVDVAVKILRPSNWVFLDGKAHTDYRKSLNGLFTKTALAQYLPPLE 180
           ARKVLQAPKYVKPCVVDVAVKILRPSNWVFLDGKAHTDYRKSLNGLFTKTALAQYLPPLE
Sbjct: 121 ARKVLQAPKYVKPCVVDVAVKILRPSNWVFLDGKAHTDYRKSLNGLFTKTALAQYLPPLE 180

Query: 181 ELMDKYIEKFVELSKENNYEPQIFFHEMREILCALSLRSFCGDYISEDQIRKIADDYYLV 240
           ELMDKYIEKFVELSKENNYEPQIFFHEMREILCALSLRSFCGDYISEDQIRKIADDYYLV
Sbjct: 181 ELMDKYIEKFVELSKENNYEPQIFFHEMREILCALSLRSFCGDYISEDQIRKIADDYYLV 240

Query: 241 TAALELVNFPIILPFTKTWYGKRTADMAMKIFESCAQRAKDHIAAGGKPICVMDNWCKLM 300
           TAALELVNFPIILPFTKTWYGKRTADMAMKIFESCAQRAKDHIAAGGKPICVMDNWCKLM
Sbjct: 241 TAALELVNFPIILPFTKTWYGKRTADMAMKIFESCAQRAKDHIAAGGKPICVMDNWCKLM 300

Query: 301 HDAKNRTDDDSRLLHREFTNREISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIR 360
           HDAKNRTDDDSRLLHREFTNREISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIR
Sbjct: 301 HDAKNRTDDDSRLLHREFTNREISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIR 360

Query: 361 EEQLRVREGDINKRLDIDLVDKMEYTHMVVKETLRYRPPVLMVPYVVKNKFPVVPDYQAP 420
           EEQLRVREGDINKRLDIDLVDKMEYTHMVVKETLRYRPPVLMVPYVVKNKFPVVPDYQAP
Sbjct: 361 EEQLRVREGDINKRLDIDLVDKMEYTHMVVKETLRYRPPVLMVPYVVKNKFPVVPDYQAP 420

Query: 421 KGSMLIATLYPALHDPEVYENPDDFIPERWVEGSPANEAKKNWLVFGCGPHVCLGQTYVM 480
           KGSMLIATLYPALHDPEVYENPDDFIPERWVEGSPANEAKKNWLVFGCGPHVCLGQTYVM
Sbjct: 421 KGSMLIATLYPALHDPEVYENPDDFIPERWVEGSPANEAKKNWLVFGCGPHVCLGQTYVM 480

Query: 481 ITMTALIGKFALFTDFKHKVTPLSEKIKVFATIFPKDDLLLSFKKRD 527
           ITMTALIGKFALFTDFKHKVTPLSEKIKVFATIFPKDDLLLSFKKRD
Sbjct: 481 ITMTALIGKFALFTDFKHKVTPLSEKIKVFATIFPKDDLLLSFKKRD 527

>YMR015C (ERG5) [3979] chr13 complement(300868..302484) Cytochrome
           P450, delta 22(23) sterol desaturase, catalyzes an
           intermediate pathway step in the biosynthesis of
           ergosterol [1617 bp, 538 aa]
          Length = 538

 Score =  904 bits (2335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/496 (84%), Positives = 464/496 (93%)

Query: 32  SLLDKLQGMSYLQMFVTLICGVLVWDQVSYQMKKGNIAGPRFKVYPIIGPFLESLDPKFE 91
           S+LD L+ MSYL++F TLIC +LVWDQV+YQ+KKG+IAGP+FK +PIIGPFLESLDPKFE
Sbjct: 35  SILDTLKSMSYLKIFATLICILLVWDQVAYQIKKGSIAGPKFKFWPIIGPFLESLDPKFE 94

Query: 92  EYKAKWDSGPLSCVSIFHKFVIIASTRDLARKVLQAPKYVKPCVVDVAVKILRPSNWVFL 151
           EYKAKW SGPLSCVSIFHKFV+IASTRDLARK+LQ+ K+VKPCVVDVAVKILRP NWVFL
Sbjct: 95  EYKAKWASGPLSCVSIFHKFVVIASTRDLARKILQSSKFVKPCVVDVAVKILRPCNWVFL 154

Query: 152 DGKAHTDYRKSLNGLFTKTALAQYLPPLEELMDKYIEKFVELSKENNYEPQIFFHEMREI 211
           DGKAHTDYRKSLNGLFTK ALAQYLP LE++MDKY++KFV LSKENNYEPQ+FFHEMREI
Sbjct: 155 DGKAHTDYRKSLNGLFTKQALAQYLPSLEQIMDKYMDKFVRLSKENNYEPQVFFHEMREI 214

Query: 212 LCALSLRSFCGDYISEDQIRKIADDYYLVTAALELVNFPIILPFTKTWYGKRTADMAMKI 271
           LCALSL SFCG+YI+EDQ+RKIADDYYLVTAALELVNFPII+P+TKTWYGK+TADMAMKI
Sbjct: 215 LCALSLNSFCGNYITEDQVRKIADDYYLVTAALELVNFPIIIPYTKTWYGKKTADMAMKI 274

Query: 272 FESCAQRAKDHIAAGGKPICVMDNWCKLMHDAKNRTDDDSRLLHREFTNREISEAVFTFL 331
           FE+CAQ AKDHIAAGGKP+CVMD WCKLMHDAKN  DDDSR+ HREFTN+EISEAVFTFL
Sbjct: 275 FENCAQMAKDHIAAGGKPVCVMDAWCKLMHDAKNSNDDDSRIYHREFTNKEISEAVFTFL 334

Query: 332 FASQDASSSLACWLFQIVADRPDVLAKIREEQLRVREGDINKRLDIDLVDKMEYTHMVVK 391
           FASQDASSSLACWLFQIVADRPDVLAKIREEQL VR  D++  L++DL++KM+YT+MV+K
Sbjct: 335 FASQDASSSLACWLFQIVADRPDVLAKIREEQLAVRNNDMSTELNLDLIEKMKYTNMVIK 394

Query: 392 ETLRYRPPVLMVPYVVKNKFPVVPDYQAPKGSMLIATLYPALHDPEVYENPDDFIPERWV 451
           ETLRYRPPVLMVPYVVK  FPV P+Y APKG+MLI TLYPALHDPEVYENPD+FIPERWV
Sbjct: 395 ETLRYRPPVLMVPYVVKKNFPVSPNYTAPKGAMLIPTLYPALHDPEVYENPDEFIPERWV 454

Query: 452 EGSPANEAKKNWLVFGCGPHVCLGQTYVMITMTALIGKFALFTDFKHKVTPLSEKIKVFA 511
           EGS A+EAKKNWLVFGCGPHVCLGQTYVMIT  AL+GKFAL+TDF H VTPLSEKIKVFA
Sbjct: 455 EGSKASEAKKNWLVFGCGPHVCLGQTYVMITFAALLGKFALYTDFHHTVTPLSEKIKVFA 514

Query: 512 TIFPKDDLLLSFKKRD 527
           TIFPKDDLLL+FKKRD
Sbjct: 515 TIFPKDDLLLTFKKRD 530

>Sklu_2168.4 YMR015C, Contig c2168 6356-7978 reverse complement
          Length = 540

 Score =  895 bits (2314), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/496 (83%), Positives = 464/496 (93%)

Query: 32  SLLDKLQGMSYLQMFVTLICGVLVWDQVSYQMKKGNIAGPRFKVYPIIGPFLESLDPKFE 91
           +++D +Q +SY ++FVT+IC  LVWDQVSYQ+KKG+IAGP++KV+P+IGPFLESLDPKFE
Sbjct: 37  NVIDSVQSISYWKLFVTIICVGLVWDQVSYQIKKGSIAGPKWKVWPVIGPFLESLDPKFE 96

Query: 92  EYKAKWDSGPLSCVSIFHKFVIIASTRDLARKVLQAPKYVKPCVVDVAVKILRPSNWVFL 151
           EYKAKWDSGPLSCVSIFHKFV+IASTRDLARK+LQ+PK+VKPCVVDVA+KILRPSNWVFL
Sbjct: 97  EYKAKWDSGPLSCVSIFHKFVVIASTRDLARKILQSPKFVKPCVVDVAIKILRPSNWVFL 156

Query: 152 DGKAHTDYRKSLNGLFTKTALAQYLPPLEELMDKYIEKFVELSKENNYEPQIFFHEMREI 211
           DGK H DYRKSLNGLFTK+ALAQYLP  E +M+KY+EKFVELSKEN YEPQ+FFHEMREI
Sbjct: 157 DGKQHVDYRKSLNGLFTKSALAQYLPSQENVMNKYLEKFVELSKENKYEPQVFFHEMREI 216

Query: 212 LCALSLRSFCGDYISEDQIRKIADDYYLVTAALELVNFPIILPFTKTWYGKRTADMAMKI 271
           +CALSL++FCGDYI+EDQIRK+ADDYYLVTAALELVNFPIILPFTKTWYGK+TADM MKI
Sbjct: 217 MCALSLKAFCGDYITEDQIRKVADDYYLVTAALELVNFPIILPFTKTWYGKKTADMTMKI 276

Query: 272 FESCAQRAKDHIAAGGKPICVMDNWCKLMHDAKNRTDDDSRLLHREFTNREISEAVFTFL 331
           FE CAQ AKDHIA+GG   CVMD WCKLMHDAKN+ D DSRLLHREF+N+EISEA+FTFL
Sbjct: 277 FEQCAQMAKDHIASGGPTTCVMDAWCKLMHDAKNQNDADSRLLHREFSNKEISEAIFTFL 336

Query: 332 FASQDASSSLACWLFQIVADRPDVLAKIREEQLRVREGDINKRLDIDLVDKMEYTHMVVK 391
           FASQDASSSLACWLFQIVADRPDVL KIREEQL+VRE D  K L +DL+++M+YT+MVVK
Sbjct: 337 FASQDASSSLACWLFQIVADRPDVLEKIREEQLKVRENDPTKALSLDLIEEMKYTNMVVK 396

Query: 392 ETLRYRPPVLMVPYVVKNKFPVVPDYQAPKGSMLIATLYPALHDPEVYENPDDFIPERWV 451
           E+LRYRPPVLMVPYVVK KFP+ P+Y APKGSMLI TLYPALHDPEVYENPD+FIPERWV
Sbjct: 397 ESLRYRPPVLMVPYVVKQKFPIAPNYSAPKGSMLIPTLYPALHDPEVYENPDEFIPERWV 456

Query: 452 EGSPANEAKKNWLVFGCGPHVCLGQTYVMITMTALIGKFALFTDFKHKVTPLSEKIKVFA 511
           EGSPAN+AK+NWLVFG GPHVCLGQTYVM+T TALIGKFA++TDF+HKVTPLSEKIKVFA
Sbjct: 457 EGSPANQAKRNWLVFGSGPHVCLGQTYVMMTFTALIGKFAMYTDFEHKVTPLSEKIKVFA 516

Query: 512 TIFPKDDLLLSFKKRD 527
           TIFPKDDLLLSFKKRD
Sbjct: 517 TIFPKDDLLLSFKKRD 532

>Scas_709.53
          Length = 523

 Score =  891 bits (2302), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/496 (81%), Positives = 464/496 (93%)

Query: 32  SLLDKLQGMSYLQMFVTLICGVLVWDQVSYQMKKGNIAGPRFKVYPIIGPFLESLDPKFE 91
           +L+  +Q +SY ++FVT IC VLVWDQ+SYQ+KKG+IAGPRFK++PIIGPFLESLDPKFE
Sbjct: 20  TLISTIQQLSYWKIFVTFICIVLVWDQISYQIKKGSIAGPRFKIWPIIGPFLESLDPKFE 79

Query: 92  EYKAKWDSGPLSCVSIFHKFVIIASTRDLARKVLQAPKYVKPCVVDVAVKILRPSNWVFL 151
           EYKAKWDSG LSCVSIFHKFVII+STRD++RK+ Q+ K+VKPCVVDVA+KILRP+NWVFL
Sbjct: 80  EYKAKWDSGALSCVSIFHKFVIISSTRDISRKIFQSSKFVKPCVVDVAIKILRPTNWVFL 139

Query: 152 DGKAHTDYRKSLNGLFTKTALAQYLPPLEELMDKYIEKFVELSKENNYEPQIFFHEMREI 211
           DGKAH DYRKSLNGLFTKTALAQYLP  E++MDKY++KF+E+SKENNYEPQ+FFHEMREI
Sbjct: 140 DGKAHIDYRKSLNGLFTKTALAQYLPSQEQVMDKYLQKFIEISKENNYEPQVFFHEMREI 199

Query: 212 LCALSLRSFCGDYISEDQIRKIADDYYLVTAALELVNFPIILPFTKTWYGKRTADMAMKI 271
           LCALSLR+FCG+YI+EDQIRKIADDYYLVTAALELVNFPII+PFTKTWYGKRTAD AMKI
Sbjct: 200 LCALSLRAFCGEYITEDQIRKIADDYYLVTAALELVNFPIIIPFTKTWYGKRTADAAMKI 259

Query: 272 FESCAQRAKDHIAAGGKPICVMDNWCKLMHDAKNRTDDDSRLLHREFTNREISEAVFTFL 331
           FE CAQ +KD+IA GGKPICVMD WCKLMHDAK + D+DSR+LHREF+N+EISEA+FTFL
Sbjct: 260 FEQCAQMSKDYIAKGGKPICVMDAWCKLMHDAKTKNDEDSRILHREFSNKEISEAIFTFL 319

Query: 332 FASQDASSSLACWLFQIVADRPDVLAKIREEQLRVREGDINKRLDIDLVDKMEYTHMVVK 391
           FASQDASSSLACWLFQIVADRPD+L KIR+EQ+ VR  D++  L+I+L+DKM+YT+MV+K
Sbjct: 320 FASQDASSSLACWLFQIVADRPDILEKIRKEQMEVRNNDMSTELNIELIDKMKYTNMVIK 379

Query: 392 ETLRYRPPVLMVPYVVKNKFPVVPDYQAPKGSMLIATLYPALHDPEVYENPDDFIPERWV 451
           ETLRYRPPVLMVPYVVK KFPV P+Y APKGSMLI TLYP+LHDPEVYENPD+FIPERW 
Sbjct: 380 ETLRYRPPVLMVPYVVKEKFPVTPNYTAPKGSMLIPTLYPSLHDPEVYENPDEFIPERWE 439

Query: 452 EGSPANEAKKNWLVFGCGPHVCLGQTYVMITMTALIGKFALFTDFKHKVTPLSEKIKVFA 511
           EGSPA+EAKKNWLVFGCGPHVCLGQTYVMIT  AL+GKFAL+TDF+HK+TPLSEKIKVFA
Sbjct: 440 EGSPASEAKKNWLVFGCGPHVCLGQTYVMITFAALLGKFALYTDFEHKITPLSEKIKVFA 499

Query: 512 TIFPKDDLLLSFKKRD 527
           TIFPKDDLL++FKKRD
Sbjct: 500 TIFPKDDLLMTFKKRD 515

>KLLA0D11242g complement(959973..961577) highly similar to sp|P54781
           Saccharomyces cerevisiae YMR015c ERG5 C-22 sterol
           desaturase, start by similarity
          Length = 534

 Score =  865 bits (2235), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/495 (80%), Positives = 452/495 (91%)

Query: 33  LLDKLQGMSYLQMFVTLICGVLVWDQVSYQMKKGNIAGPRFKVYPIIGPFLESLDPKFEE 92
           L++ +Q MSY ++F TL+  V+VWDQVSYQ++KGNIAGP++KV+P+IGPFLES DPKFEE
Sbjct: 32  LVETVQQMSYFKLFCTLVAIVIVWDQVSYQIQKGNIAGPKWKVWPVIGPFLESFDPKFEE 91

Query: 93  YKAKWDSGPLSCVSIFHKFVIIASTRDLARKVLQAPKYVKPCVVDVAVKILRPSNWVFLD 152
           Y AKW+SGPLSCVSIFHKFV+IASTRDLARK+ Q+P+YVKPCVVDVAVKILRPSNWVFLD
Sbjct: 92  YLAKWNSGPLSCVSIFHKFVVIASTRDLARKIFQSPQYVKPCVVDVAVKILRPSNWVFLD 151

Query: 153 GKAHTDYRKSLNGLFTKTALAQYLPPLEELMDKYIEKFVELSKENNYEPQIFFHEMREIL 212
           GK H DYRKSLNGLFTK ALA+Y+P  E LMDKYIEKF+ELSKEN YE ++FFH+MREI+
Sbjct: 152 GKEHVDYRKSLNGLFTKQALAKYMPSQELLMDKYIEKFIELSKENKYEARVFFHDMREIM 211

Query: 213 CALSLRSFCGDYISEDQIRKIADDYYLVTAALELVNFPIILPFTKTWYGKRTADMAMKIF 272
           CALSL++FCGDYI+EDQIRK+ADDYYLVTAALELVNFPII+P+TKTWYGK+TADM MKIF
Sbjct: 212 CALSLKAFCGDYITEDQIRKVADDYYLVTAALELVNFPIIIPYTKTWYGKKTADMTMKIF 271

Query: 273 ESCAQRAKDHIAAGGKPICVMDNWCKLMHDAKNRTDDDSRLLHREFTNREISEAVFTFLF 332
           E CAQ AKDHIAAGG+  CV+D WC LMH+AKN+ D DS+L HREFTNRE+SEA+FTFLF
Sbjct: 272 EQCAQMAKDHIAAGGESTCVLDAWCSLMHEAKNKDDADSKLYHREFTNREMSEAIFTFLF 331

Query: 333 ASQDASSSLACWLFQIVADRPDVLAKIREEQLRVREGDINKRLDIDLVDKMEYTHMVVKE 392
           ASQDASSSLACW+FQI+ADRPDV+A IREEQLRVR  D N +L +DL+D+M+YT+MVVKE
Sbjct: 332 ASQDASSSLACWIFQIIADRPDVMANIREEQLRVRNNDPNVKLSMDLIDEMKYTNMVVKE 391

Query: 393 TLRYRPPVLMVPYVVKNKFPVVPDYQAPKGSMLIATLYPALHDPEVYENPDDFIPERWVE 452
           TLRYRPPV+MVPY VK  FPVVP Y APKGSMLI TLYPALHDPEVYE+PD+FIPERWVE
Sbjct: 392 TLRYRPPVIMVPYYVKKSFPVVPTYSAPKGSMLIPTLYPALHDPEVYEDPDEFIPERWVE 451

Query: 453 GSPANEAKKNWLVFGCGPHVCLGQTYVMITMTALIGKFALFTDFKHKVTPLSEKIKVFAT 512
           GS AN+AKKNWLVFGCGPHVCLGQTYVM T T LIGKFA+F+D++HKVTPLSEKIKVFAT
Sbjct: 452 GSAANQAKKNWLVFGCGPHVCLGQTYVMQTFTGLIGKFAMFSDWEHKVTPLSEKIKVFAT 511

Query: 513 IFPKDDLLLSFKKRD 527
           IFPKDDLLLSFKKRD
Sbjct: 512 IFPKDDLLLSFKKRD 526

>ABR053C [644] [Homologous to ScYMR015C (ERG5) - SH]
           (492258..493805) [1548 bp, 515 aa]
          Length = 515

 Score =  779 bits (2012), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/472 (77%), Positives = 416/472 (88%), Gaps = 1/472 (0%)

Query: 57  DQVSYQMKKGNIAGPRFKVYPIIGPFLESLDPKFEEYKAKWDSGPLSCVSIFHKFVIIAS 116
           DQ +Y+  KG IAGP +K++P+IGPFLESLDPKFE Y+AKW SGPLSCVSIFHKFV+IAS
Sbjct: 36  DQAAYRRNKGRIAGPAWKMWPLIGPFLESLDPKFEVYQAKWASGPLSCVSIFHKFVVIAS 95

Query: 117 TRDLARKVLQAPKYVKPCVVDVAVKILRPSNWVFLDGKAHTDYRKSLNGLFTKTALAQYL 176
           TRDL RK+LQ+PKYVKPC+VDVA KILRP+NWVFLDG+AH DYR+SLNGLFT+ ALA+YL
Sbjct: 96  TRDLTRKILQSPKYVKPCLVDVAKKILRPTNWVFLDGQAHLDYRRSLNGLFTRDALARYL 155

Query: 177 PPLEELMDKYIEKFVELSKENNYEPQIFFHEMREILCALSLRSFCGDYISEDQIRKIADD 236
           P  E ++D+Y+ KFV  S+E +YE ++FFHEMRE+LCALSL++FCG YI++DQ+RKIADD
Sbjct: 156 PSQEAVIDRYMAKFVAFSRETDYEHRVFFHEMREMLCALSLKAFCGSYITDDQVRKIADD 215

Query: 237 YYLVTAALELVNFPIILPFTKTWYGKRTADMAMKIFESCAQRAKDHIAAGGKPICVMDNW 296
           YYLVTAALELVNFP+ILPFTKTWYGKRTADMAMKIFE CAQ AK HIAAGG+P CV+D W
Sbjct: 216 YYLVTAALELVNFPLILPFTKTWYGKRTADMAMKIFERCAQEAKQHIAAGGEPTCVVDAW 275

Query: 297 CKLMHDAKNRTDDDSRLLHREFTNREISEAVFTFLFASQDASSSLACWLFQIVADRPDVL 356
           CKLM DAK + D DSRLLHR+FTNRE+SEA+FTFLFASQDASSSLACWLFQIVADRPDVL
Sbjct: 276 CKLMLDAKAKDDADSRLLHRKFTNREMSEALFTFLFASQDASSSLACWLFQIVADRPDVL 335

Query: 357 AKIREEQLRVREGDINKRLDIDLVDKMEYTHMVVKETLRYRPPVLMVPYVVKNKFPVVPD 416
           AKIREEQL VR  D +  L ++L+D+M+YTHM VKE LRYRPPVLMVPY V   F V  D
Sbjct: 336 AKIREEQLAVRRNDPSVPLSLELIDQMKYTHMAVKECLRYRPPVLMVPYQVHEAFAVSAD 395

Query: 417 YQAPKGSMLIATLYPALHDPEVYENPDDFIPERW-VEGSPANEAKKNWLVFGCGPHVCLG 475
           Y APKGSML+AT+YPALHDP VYENPDD+IPERW  E SPAN+AKKNWLVFG GPHVCLG
Sbjct: 396 YTAPKGSMLVATMYPALHDPAVYENPDDYIPERWDGEQSPANQAKKNWLVFGSGPHVCLG 455

Query: 476 QTYVMITMTALIGKFALFTDFKHKVTPLSEKIKVFATIFPKDDLLLSFKKRD 527
           Q YV +T TALIGKFALFT+F HKVT LSEKIKVFATIFP+DDLL+SFKKRD
Sbjct: 456 QKYVFMTFTALIGKFALFTEFDHKVTSLSEKIKVFATIFPQDDLLMSFKKRD 507

>Kwal_26.8172
          Length = 336

 Score =  599 bits (1545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/336 (81%), Positives = 312/336 (92%)

Query: 187 IEKFVELSKENNYEPQIFFHEMREILCALSLRSFCGDYISEDQIRKIADDYYLVTAALEL 246
           +EKFV  S E N+EPQ++FHE+REI+CALSL++FCGDYI+E QIRK+ADDYYLVTAALEL
Sbjct: 1   MEKFVTYSAEKNFEPQVYFHELREIMCALSLKAFCGDYITESQIRKVADDYYLVTAALEL 60

Query: 247 VNFPIILPFTKTWYGKRTADMAMKIFESCAQRAKDHIAAGGKPICVMDNWCKLMHDAKNR 306
           VNFPIILPFTKTWYG+RTADM MKIFE CAQ AKDHIAAGGKP CVMD WC+LMH+AKN+
Sbjct: 61  VNFPIILPFTKTWYGQRTADMTMKIFEKCAQMAKDHIAAGGKPKCVMDAWCELMHNAKNK 120

Query: 307 TDDDSRLLHREFTNREISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIREEQLRV 366
            D+DSRL HREFTNREISEAVFTFLFASQDASSSLACWLFQIVADRPDV+ KIREEQLRV
Sbjct: 121 NDEDSRLFHREFTNREISEAVFTFLFASQDASSSLACWLFQIVADRPDVMQKIREEQLRV 180

Query: 367 REGDINKRLDIDLVDKMEYTHMVVKETLRYRPPVLMVPYVVKNKFPVVPDYQAPKGSMLI 426
           R  D +K L +DL+D+M+YT+MVVKETLRYRPPV+MVPYVVKNKFP+ P+Y APKG+MLI
Sbjct: 181 RNNDPSKPLSLDLIDEMKYTYMVVKETLRYRPPVIMVPYVVKNKFPIAPNYTAPKGAMLI 240

Query: 427 ATLYPALHDPEVYENPDDFIPERWVEGSPANEAKKNWLVFGCGPHVCLGQTYVMITMTAL 486
            TLYPALHDPEVY++P++FIPERWVEGSPANEAKKNWLVFG G HVCLGQTYVM+T TAL
Sbjct: 241 PTLYPALHDPEVYDDPEEFIPERWVEGSPANEAKKNWLVFGSGSHVCLGQTYVMMTFTAL 300

Query: 487 IGKFALFTDFKHKVTPLSEKIKVFATIFPKDDLLLS 522
           IGKFA++T+++HKVTPLSEKIKVFATIFPKDDLLL+
Sbjct: 301 IGKFAMYTNWEHKVTPLSEKIKVFATIFPKDDLLLT 336

>KLLA0E03553g 329904..331487 highly similar to sp|P10614
           Saccharomyces cerevisiae YHR007c ERG11 cytochrome P450
           lanosterol 14a-demethylase, start by similarity
          Length = 527

 Score = 84.3 bits (207), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 91/372 (24%), Positives = 158/372 (42%), Gaps = 46/372 (12%)

Query: 146 SNWVFLDGKAH--TDYRKSLNGLFTKTALAQYLPPLEELMDKYI--EKFVELSKENNYEP 201
            N V  D   H   D +K + G  T  A  +Y+P + E + KY    K   + ++++ + 
Sbjct: 136 GNGVIYDCPNHRLMDQKKFVKGALTTDAFRKYVPLIAEEVQKYFLTSKNFSIGEKDHGKI 195

Query: 202 QIFFHEMREILCALSLRSFCGDYISEDQIRKIADDYYLVTAALELVNFPIILPFTKTWYG 261
            +   +  E+    + RS  G  + E    K+  D+  + + L+    P+   F+     
Sbjct: 196 NVMVTQ-PEMTIFTASRSLLGSEMRE----KLNTDFAYLYSDLDKGFTPLNFVFSHLPLD 250

Query: 262 K-RTADMAMKIFESC----AQRAKDHIAAGGKPICVMDNWCKLMHDAKNRTDDDSRLLHR 316
             R  D A ++  S      ++ +D        I   D    LM   KN T  D      
Sbjct: 251 NYRKRDNAQRVISSTYLSLIKKRRD-----TNDIQDRDLIDSLM---KNSTYKDGV---- 298

Query: 317 EFTNREISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIREEQLRVREGDINKRLD 376
           + T++EI+  +   L   Q  S++ + W+   +A+RPD+  K+ EEQ++V +    K L 
Sbjct: 299 KMTDQEIANLLIGVLMGGQHTSAATSAWVILHLAERPDIQEKLYEEQMKVLDNG-TKELT 357

Query: 377 IDLVDKMEYTHMVVKETLRYRPPVLMVPYVVKNKFPV-VPDYQAPKG-SMLIATLYPALH 434
            DL+ +M   +  +KETLR   P+  +   V N  PV    Y  PKG  +L++  Y  L 
Sbjct: 358 FDLLQEMPLLNQTIKETLRLHHPLHSLFRKVMNDMPVPNSSYVVPKGHHVLVSPGYCHLQ 417

Query: 435 DPEVYENPDDFIPERWVE----------------GSPANEAKKNWLVFGCGPHVCLGQTY 478
           D + + N  +F P RW                  GS +      +L FG G H C+G+ +
Sbjct: 418 D-KYFPNASEFNPNRWDNDAASSYASNEKVDYGFGSISKGVSSPYLPFGGGRHRCIGEHF 476

Query: 479 VMITMTALIGKF 490
             + +  ++  +
Sbjct: 477 AYMQLGTILSNY 488

>YHR007C (ERG11) [2293] chr8 complement(120085..121677) Cytochrome
           P450 (lanosterol 14alpha-demethylase), essential for
           biosynthesis of ergosterol [1593 bp, 530 aa]
          Length = 530

 Score = 74.7 bits (182), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 57/205 (27%), Positives = 93/205 (45%), Gaps = 24/205 (11%)

Query: 304 KNRTDDDSRLLHREFTNREISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIREEQ 363
           KN T  D      + T++EI+  +   L   Q  S++ + W+   +A+RPDV  ++ EEQ
Sbjct: 289 KNSTYKDGV----KMTDQEIANLLIGVLMGGQHTSAATSAWILLHLAERPDVQQELYEEQ 344

Query: 364 LRVREGDINKRLDIDLVDKMEYTHMVVKETLRYRPPV-LMVPYVVKNKFPVVPDYQAPKG 422
           +RV +G   K L  DL+ +M   +  +KETLR   P+  +   V+K+       Y  P G
Sbjct: 345 MRVLDGG-KKELTYDLLQEMPLLNQTIKETLRMHHPLHSLFRKVMKDMHVPNTSYVIPAG 403

Query: 423 -SMLIATLYPALHDPEVYENPDDFIPERWVE----------------GSPANEAKKNWLV 465
             +L++  Y  L D E + N   F   RW +                G+ +      +L 
Sbjct: 404 YHVLVSPGYTHLRD-EYFPNAHQFNIHRWNKDSASSYSVGEEVDYGFGAISKGVSSPYLP 462

Query: 466 FGCGPHVCLGQTYVMITMTALIGKF 490
           FG G H C+G+ +    +  L+  F
Sbjct: 463 FGGGRHRCIGEHFAYCQLGVLMSIF 487

>ADR162W [1904] [Homologous to ScYHR007C (ERG11) - SH]
           complement(987458..989047) [1590 bp, 529 aa]
          Length = 529

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 86/187 (45%), Gaps = 18/187 (9%)

Query: 317 EFTNREISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIREEQLRVREGDINKRLD 376
           + T+++I+  +   L   Q  S++ + W+   +A+RPD+  ++ EEQ+RV +G   K L 
Sbjct: 296 KMTDQQIANLLIGVLMGGQHTSAATSAWVLLHLAERPDIQEELYEEQMRVLDGGA-KELT 354

Query: 377 IDLVDKMEYTHMVVKETLRYRPPVLMVPYVVKNKFPV-VPDYQAPKGSMLIATLYPALHD 435
            +L+ +M   + V+KETLR   P+  +   V    PV    Y  PK   ++A+       
Sbjct: 355 YELLQEMPLLNQVIKETLRMHHPLHSLFRKVTRDMPVPNTSYVIPKDHYVLASPGFCHLS 414

Query: 436 PEVYENPDDFIPERWVE----------------GSPANEAKKNWLVFGCGPHVCLGQTYV 479
            E + N  +F P RW                  G+ +      +L FG G H C+G+ + 
Sbjct: 415 EEYFPNAKEFNPHRWDNDAASSVSTGEKVDYGFGAISKGVSSPYLPFGGGRHRCIGEGFA 474

Query: 480 MITMTAL 486
            + +  +
Sbjct: 475 YMQLGTI 481

>CAGL0E04334g complement(415351..416952) highly similar to sp|P10614
           Saccharomyces cerevisiae YHR007c ERG11, start by
           similarity
          Length = 533

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 83/368 (22%), Positives = 147/368 (39%), Gaps = 67/368 (18%)

Query: 160 RKSLNGLFTKTALAQYLPPLEELMDKYIEKFVELS-KENNYEPQIFFHEMREILCALSLR 218
           +K + G  TK A  +Y+P + E + KY          ENN           E+    + R
Sbjct: 152 KKFVKGALTKEAFVRYVPLIAEEIYKYFRNSKNFKINENNSGIVDVMVSQPEMTIFTASR 211

Query: 219 SFCGDYISEDQIRKIADDYYLVTAALELVNFPIILPFTKTWYGKRTADMAMKIFESCAQR 278
           S  G  + +    K+  D+  + + L+    PI   F          ++ ++ +     R
Sbjct: 212 SLLGKEMRD----KLDTDFAYLYSDLDKGFTPINFVF---------PNLPLEHY-----R 253

Query: 279 AKDHIAAGGKPICVMDNWCKLMHDAKNRTDDDSRLLHREF------------TNREISEA 326
            +DH         +   +  L+ + + + D  +R L  E             T++EI+  
Sbjct: 254 KRDHAQQ-----AISGTYMSLIKERREKNDIQNRDLIDELMKNSTYKDGTKMTDQEIANL 308

Query: 327 VFTFLFASQDASSSLACWLFQIVADRPDVLAKIREEQLRVREGDINKRLDIDLVDKMEYT 386
           +   L   Q  S++ + W    +A+RPDV  ++ +EQ+RV   D  K L  D +  M   
Sbjct: 309 LIGVLMGGQHTSAATSAWCLLHLAERPDVQEELYQEQMRVLNND-TKELTYDDLQNMPLL 367

Query: 387 HMVVKETLRYRPPV------LMVPYVVKNKFPVVP-DYQAPKGSMLIATLYPALHDPEVY 439
           + ++KETLR   P+      +M    + N   VVP DY      +L++  Y  L + E +
Sbjct: 368 NQMIKETLRLHHPLHSLFRKVMRDVAIPNTSYVVPRDYH-----VLVSPGYTHLQE-EFF 421

Query: 440 ENPDDFIPERWVEGSPANEAKKN-----------------WLVFGCGPHVCLGQTYVMIT 482
             P++F   RW   + ++ A                    +L FG G H C+G+ +    
Sbjct: 422 PKPNEFNIHRWDGDAASSSAAGGDEVDYGFGAISKGVSSPYLPFGGGRHRCIGELFAYCQ 481

Query: 483 MTALIGKF 490
           +  L+  F
Sbjct: 482 LGVLMSIF 489

>Kwal_47.18323
          Length = 536

 Score = 71.2 bits (173), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 56/217 (25%), Positives = 95/217 (43%), Gaps = 26/217 (11%)

Query: 304 KNRTDDDSRLLHREFTNREISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIREEQ 363
           KN T  D      + T++EI+  +   L   Q  S++ + W+   +A+RPD+  ++  EQ
Sbjct: 294 KNSTYKDGT----KMTDQEIANLLIGVLMGGQHTSAATSAWMLLHLAERPDLQEELYAEQ 349

Query: 364 LRVREGDINKRLDIDLVDKMEYTHMVVKETLRYRPPVLMVPYVVKNKFPV-VPDYQAPKG 422
           + V +    K L  +L+ +M   +  +KETLR   P+  +   V+   PV    Y  P+G
Sbjct: 350 MEVLDNG-KKELTYELLQQMPLLNQTIKETLRMHHPLHSIFRRVERDLPVPKTQYVVPRG 408

Query: 423 S-MLIATLYPALHDPEVYENPDDFIPERWVE----------------GSPANEAKKNWLV 465
             +L++  Y  L D E +   + F P RW                  G+ +      +L 
Sbjct: 409 HFVLVSPGYCHLQD-EYFPKANTFDPHRWNNDYKSSYATGEEVDYGFGAISKGVSSPYLP 467

Query: 466 FGCGPHVCLGQTYVMITMTALIGKFALFTDFKHKVTP 502
           FG G H C+G+ +    +  L+  +      K K TP
Sbjct: 468 FGGGRHRCIGEHFAYCQLGVLMSVY--IRTVKWKFTP 502

>Sklu_2436.11 YHR007C, Contig c2436 26015-27613 reverse complement
          Length = 532

 Score = 70.9 bits (172), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 87/192 (45%), Gaps = 20/192 (10%)

Query: 317 EFTNREISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIREEQLRVREGDINKRLD 376
           + T++EI+  +   L   Q  S++ + WL   +A++P++  ++  EQ+RV +    K L 
Sbjct: 299 KMTDQEIANLLIGVLMGGQHTSAATSAWLLLHLAEKPELQEELYAEQMRVLDNG-KKELT 357

Query: 377 IDLVDKMEYTHMVVKETLRYRPPVLMVPYVVKNKFPV-VPDYQAPKG-SMLIATLYPALH 434
            DL+ +M   +  +KETLR   P+  +   V    PV    Y  PKG  +L++  Y  L 
Sbjct: 358 YDLLQEMPLLNQTIKETLRMHHPLHSIFRKVMRDLPVPNTSYVVPKGHHVLVSPGYAHLR 417

Query: 435 DPEVYENPDDFIPERWVE----------------GSPANEAKKNWLVFGCGPHVCLGQTY 478
           D E + +   F P RW                  GS +      +L FG G H C+G+ +
Sbjct: 418 D-EYFPHAATFDPHRWDNDAASSYSSSEQVDYGFGSVSKGVSSPYLPFGGGRHRCVGEHF 476

Query: 479 VMITMTALIGKF 490
               +  ++  +
Sbjct: 477 AYCQLGTIMSVY 488

>Scas_699.20
          Length = 538

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 94/417 (22%), Positives = 159/417 (38%), Gaps = 72/417 (17%)

Query: 109 HKFVIIASTRDL----ARKVLQAPKYVKPCVVDVAVKILRPSNWVFLDGKAHTDYRKSLN 164
           H+F+  A   D+    A   L  P + K  + D +   L              D +K + 
Sbjct: 115 HEFIFNAKLADVSAEDAYSHLTTPVFGKGVIYDCSNSRL-------------MDQKKFVK 161

Query: 165 GLFTKTALAQYLPPLEELMDKYIEKFVELSKENNYEPQI-FFHEMREILCALSLRSFCGD 223
           G  +K A  +Y+P  +E + KY +           + +I       E+    + R+  G 
Sbjct: 162 GALSKEAFKRYVPLFKEEILKYFKDSNNFKFNQREKGEIDVMVTQPEMTIFTASRTLLGK 221

Query: 224 YISEDQIRKIADDYYLVTAALELVNFPI-ILPFTKTWYGKRTADMAMKIFESC------A 276
            + +      A  Y  +      +NF    LPF +  Y KR  D A +   S        
Sbjct: 222 EMRDKLDTDFAYLYSDLDKGFTPINFVFPNLPFLEH-YKKR--DNAQRTIASTYLSLIKK 278

Query: 277 QRAKDHIAAGGKPICVMDNWCKLMHDAKNRTDDDSRLLHREFTNREISEAVFTFLFASQD 336
           +RA + I        +M          KN T  D      + T+ EI+  +   L   Q 
Sbjct: 279 RRANNDIQDRDLIDTLM----------KNSTYKDGV----KMTDPEIANLLIGVLMGGQH 324

Query: 337 ASSSLACWLFQIVADRPDVLAKIREEQLRVREGDINKRLDIDLVDKMEYTHMVVKETLRY 396
            S++ + W    +A+RPDV  ++ +EQ+RV +    K +  DL+++M   + ++KETLR 
Sbjct: 325 TSAATSAWCLLHLAERPDVQEELYQEQMRVLDNG-KKEITYDLLEQMPLLNQMIKETLRL 383

Query: 397 RPPVLMVPYVVKNKFPVVPDYQAPKGSMLIATLYPALHDPEVYENPDDFIPE-------R 449
             P+    + +  K  V+ D Q P  S +I   Y  L  P      + + P+       R
Sbjct: 384 HHPL----HSLFRK--VIRDMQVPNTSYVIPKDYFVLVSPGYTHLQEHYFPQAHSFNIHR 437

Query: 450 WVE----------------GSPANEAKKNWLVFGCGPHVCLGQTYVMITMTALIGKF 490
           W                  G+        +L FG G H C+G+ Y    +  ++ +F
Sbjct: 438 WDNDAESSYVVGEEVDYGFGAITKGVTSPYLPFGGGRHRCIGEHYAYCQLGVIMAEF 494

>YDR402C (DIT2) [1228] chr4 complement(1272222..1273691) Cytochrome
           P450 56, second enzyme in the pathway for biosynthesis
           of dityrosine in the outer layer of the spore wall [1470
           bp, 489 aa]
          Length = 489

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 71/165 (43%), Gaps = 19/165 (11%)

Query: 355 VLAKIREEQLRVREGDINKRLDIDLVDKMEYTHMVVKETLRYRPPV-LMVPYVVKNKFPV 413
           +LAK   E       ++N   D   +  +   +  + E +R  PP+  ++         +
Sbjct: 308 LLAKYSNEWQEKLRKEVNGITDPKGLADLPLLNAFLFEVVRMYPPLSTIINRCTTKTCKL 367

Query: 414 VPDYQAPKGSMLIATLYPALHDPEVY-ENPDDFIPERWVEGSPANEAKKNWLV------- 465
             +   PKG  +    +   HDP+ +    DDF PERW  GS     +KNW +       
Sbjct: 368 GAEIVIPKGVYVGYNNFGTSHDPKTWGTTADDFKPERW--GSDIETIRKNWRMAKNRCAV 425

Query: 466 --FGCGPHVCLGQ----TYVMITMTALIGKF--ALFTDFKHKVTP 502
             F  G   CLG+    T + I++  ++ +F  +L  +++ K+TP
Sbjct: 426 TGFHGGRRACLGEKLALTEMRISLAEMLKQFRWSLDPEWEEKLTP 470

>KLLA0C19206g 1711813..1713348 weakly similar to sp|O48923 Glycine
           max Cytochrome P450 71D10 (EC 1.14.-.-), hypothetical
           start
          Length = 511

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 96/233 (41%), Gaps = 41/233 (17%)

Query: 321 REISEAVFTF----------LFASQDASSSLACWLFQIVADRPDVLAKIREEQLRVRE-- 368
           R +    FTF          LFA+ + +S++  W    +    +   ++R E L+V+E  
Sbjct: 287 RHVESGKFTFNNWIQTIDEILFANIEVTSTVMAWALVEMGSNIEEQNRLRCEILKVKEQS 346

Query: 369 --GDINKRLD-----IDLVDKMEYTHMVVKETLRYRPPVLMVPYVVKNKFPVVPDYQAPK 421
              D NK  D     + L D   Y    V ETLR  P +      + ++   +   +   
Sbjct: 347 SKDDFNKETDPMQRYMKLTDT--YLQYCVWETLRMHPLLWFSFPEISSETLFIDGIRISP 404

Query: 422 GSMLIATLYPALHDPEVYENPDD--------FIPERWVEGSPANEAKKNWLVFGCGPHVC 473
            + ++   Y   ++  ++ NP D        F P R+ E     +A  + + FG G   C
Sbjct: 405 NTPIVVDQYQINYNSPIW-NPSDKPKDFGKKFAPSRF-ENITLRDALYSQVTFGAGSRKC 462

Query: 474 LGQTYVMITMTALIGKFALFTDFKHKVTPLSEKIKVFATIFPKDDLLLSFKKR 526
           LG+ +  +    LI     +   K+KVT L+EK++     F KD  ++  K +
Sbjct: 463 LGRNFAEL----LIKSELAYILSKYKVT-LTEKVE-----FSKDTFVVQPKTK 505

>KLLA0C06743g complement(590585..592126) similar to sp|P21595
           Saccharomyces cerevisiae YDR402c DIT2 cytochrome P450 56
           singleton, start by similarity
          Length = 513

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 58/237 (24%), Positives = 97/237 (40%), Gaps = 30/237 (12%)

Query: 298 KLMHDAK-NRTDDDSRLLHREF-----TNREISEAVFTFLFASQDASSSLACWLFQIVAD 351
            L+H+ K  +T++ +  L RE+     T+ ++ + +   L A  +    L   LF ++A 
Sbjct: 257 NLIHNYKFEQTNNAAAGLIREWKLQGITDEQLKDNLVIILVAGHENPQLLLSTLFYLLAK 316

Query: 352 RPDVLAKIREEQLRVREGDINKRLDIDLVDKMEYTHMVVKETLRYRPPV-LMVPYVVKNK 410
             +    IREE L V   +       D+++  + T  +  E LR  PP+  ++      K
Sbjct: 317 HQNWQYAIREELLSVDRNE-------DILNSFKLTAFIY-EALRMFPPLGQIINRRTTRK 368

Query: 411 FPVVPDYQAPKGSMLIATLYPALHDPEVY-ENPDDFIPERWVEGSPANEAKKNW------ 463
             + P     K       +Y       V+ E    FIPERW E S  NE   NW      
Sbjct: 369 CQLGPGIIIDKDVYCGYNVYGTGTATSVWGETAKQFIPERWGENS--NELANNWKKHKYD 426

Query: 464 ---LVFGCGPHVCLGQTYVMITMTALIGKFALFTDFKHKVTP-LSEKIKVFATIFPK 516
                F  G   CLG+   ++ M  ++  + +  +F  ++ P   EK+     I PK
Sbjct: 427 ASMSAFHGGRRSCLGEKLALMEMKYVL--YYVLMNFHIELHPQWKEKMTPAGPICPK 481

>Kwal_47.18804
          Length = 508

 Score = 36.6 bits (83), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 66/165 (40%), Gaps = 21/165 (12%)

Query: 355 VLAKIREEQLRVREGDINKRLDIDLVDKMEYTHMVVKETLRYRPPV-LMVPYVVKNKFPV 413
           +  K R+ Q  VRE    +   I+ ++ +   +  + E +R  PP+  ++      K  +
Sbjct: 329 MFGKNRKWQDLVREEV--QGCGIENLNDLPLLNSFIFECIRMYPPLSQIINRCTTKKCVL 386

Query: 414 VPDYQAPKGSMLIATLYPALHDPEVY-ENPDDFIPERWVEGSPANEAKKNW--------- 463
             D   P+   L   +Y        + +N D FIPERW  G+   E  K W         
Sbjct: 387 GTDIVLPENVYLGYNVYSTGRYKSAWGDNADCFIPERW--GNNIEEITKEWRHRKNTCAM 444

Query: 464 LVFGCGPHVCLGQTY----VMITMTALIGKF--ALFTDFKHKVTP 502
             F  G   CLG+      V I M A++  F   L   +  KVTP
Sbjct: 445 AAFHGGRRACLGEKLALMEVRIAMAAVLKNFEWTLAASWVDKVTP 489

>KLLA0D11638g 995087..996262 similar to ca|CA4405|IPF8773 Candida
           albicans putative cytochrome P450 (by homology),
           hypothetical start
          Length = 391

 Score = 33.9 bits (76), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 59/150 (39%), Gaps = 26/150 (17%)

Query: 376 DIDLVDKMEYTHMVVKETLRYRPPV-LMVPYVVKNKFP----VVPDYQA-----PKGSML 425
           D+  +D+M   H +V+E  R    +    P  V  + P     + D        P G+++
Sbjct: 188 DLQRLDQMPILHSIVQEACRLHSAIPGSEPRYVPQEGPKFEATLRDKHGTRVEIPPGTIV 247

Query: 426 IATLYPALHDPEV--YENPDDFIPERWVEGSPANEAKKNW-----------LVFGCGPHV 472
               + +LH  E     NP  F P RW+      E ++ +             FG G  +
Sbjct: 248 SCQPW-SLHLLETPFGANPRQFNPARWLRDETTGETEQEYEKRLTKMNNSMFTFGQGNRM 306

Query: 473 CLGQTYVMITMTALIGKFALFTDFKHKVTP 502
           CLG    ++ M   I +  L++ +   ++P
Sbjct: 307 CLGMNLALMEMKYCIAQ--LYSRYTTDISP 334

>Scas_584.5
          Length = 367

 Score = 33.1 bits (74), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 1/46 (2%)

Query: 166 LFTKTALAQYLPPLEELMDKYIEKFVELSKENNYEPQIFFHEMREI 211
           LF K   AQ    L+ + +K+++K V LSK+ NY P +F  E+ ++
Sbjct: 302 LFLKDESAQIQKNLQNVTEKFVKKVVALSKDPNY-PSLFSQELSKL 346

>CAGL0M01408g complement(159500..162646) similar to tr|Q06680
           Saccharomyces cerevisiae YDR325w YCG1 Yeast Condensin G,
           start by similarity
          Length = 1048

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 39/81 (48%), Gaps = 3/81 (3%)

Query: 63  MKKGNIAGPRFKVYPIIGPFLESLDPKFEEYKAKWDSGPLSCVSIFHKFVIIASTRDLAR 122
           +KK  + G R  +  ++  F+ SLD + E  KA+    P +  S F KFV     R++ R
Sbjct: 70  LKKTEVVGDR--IIKLVASFIASLDKEIELAKAQGKPLPNNAESAFTKFV-DHFIRNILR 126

Query: 123 KVLQAPKYVKPCVVDVAVKIL 143
            +    K V+  VV +   I+
Sbjct: 127 GIESKDKNVRFRVVQLLAVIM 147

>AFR020W [3212] [Homologous to ScYBL015W (ACH1) - SH]
           complement(472535..474505) [1971 bp, 656 aa]
          Length = 656

 Score = 30.0 bits (66), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 34/64 (53%)

Query: 296 WCKLMHDAKNRTDDDSRLLHREFTNREISEAVFTFLFASQDASSSLACWLFQIVADRPDV 355
           W +++ D+     ++  L     T+  ++EA F   FA+ D  SS  C   Q+V++ P++
Sbjct: 433 WTEVLQDSFLDLFENGSLEFATATSIRLTEAGFEKFFANWDEYSSKLCLRSQVVSNSPEM 492

Query: 356 LAKI 359
           + ++
Sbjct: 493 IRRL 496

>AFR661W [3854] [Homologous to ScYGL140C - NSH]
           complement(1642457..1645996) [3540 bp, 1179 aa]
          Length = 1179

 Score = 30.0 bits (66), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 17/25 (68%)

Query: 238 YLVTAALELVNFPIILPFTKTWYGK 262
           + VT AL L +FP+ +P T+ WY K
Sbjct: 626 FQVTIALTLASFPMYIPATREWYMK 650

>YHR076W (PTC7) [2365] chr8 (251102..252226) Protein phosphatase
           type 2C, localizes to mitochondria and may be involved
           in utilization of nonfermentable carbon sources under
           oxygen-limiting conditions [1125 bp, 374 aa]
          Length = 374

 Score = 29.6 bits (65), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 166 LFTKTALAQYLPPLEELMDKYIEKFVELSKENNYEPQIFFHEMREI 211
           LF K   A+    L+ L  K+++  V LSK+ NY P +F  E+ ++
Sbjct: 309 LFLKDNAARTNDELQLLSQKFVDNVVSLSKDPNY-PSVFAQEISKL 353

>Sklu_1987.2 YBL015W, Contig c1987 2738-4309
          Length = 523

 Score = 29.3 bits (64), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 14/67 (20%), Positives = 36/67 (53%)

Query: 293 MDNWCKLMHDAKNRTDDDSRLLHREFTNREISEAVFTFLFASQDASSSLACWLFQIVADR 352
           ++ W +++ D+     ++  L +   T+  ++EA F   F + D+ S   C   Q+V++ 
Sbjct: 297 LNVWTEVLQDSFLDLFENGSLDYATATSIRLTEAGFERFFENWDSFSKKLCLRSQVVSNN 356

Query: 353 PDVLAKI 359
           P+++ ++
Sbjct: 357 PEIIRRL 363

>AAR028W [214] [Homologous to ScYGR112W (SHY1) - SH]
           complement(391187..392317) [1131 bp, 376 aa]
          Length = 376

 Score = 29.3 bits (64), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 328 FTFLFASQDASSSLACWLFQIVADRPDVLAKIREEQLRVREGDINKRLDIDLVDKMEYTH 387
            T + A    S  L  W  + +  + +++AK  E+QL  R   + ++   ++ ++ EY  
Sbjct: 63  LTLMCAIPVVSFYLGMWQLRRLKWKTELIAKC-EDQLTYRPVPLPQKFTPEMCEQWEYRR 121

Query: 388 MVVKETLRYRPPVLMVPYV 406
           +VVK   R+   + + P V
Sbjct: 122 VVVKGAFRHEEEIFVGPRV 140

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.139    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,022,441
Number of extensions: 738762
Number of successful extensions: 1787
Number of sequences better than 10.0: 34
Number of HSP's gapped: 1805
Number of HSP's successfully gapped: 34
Length of query: 527
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 421
Effective length of database: 12,926,601
Effective search space: 5442099021
Effective search space used: 5442099021
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 64 (29.3 bits)