Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M07612g58157227510.0
YMR020W (FMS1)50858411371e-150
Scas_709.5055258211101e-146
Kwal_26.821450257810581e-138
Sklu_2411.949757910131e-132
ABR057W5205798271e-104
KLLA0E07744g5335858181e-102
CAGL0K01925g44847930.004
AFR183C44647910.006
CAGL0D05940g48954910.006
AAL141C49754910.006
YGR175C (ERG1)49654880.014
Scas_710.1245447870.017
Sklu_2225.544747870.017
YER136W (GDI1)45147860.021
Kwal_14.206444746860.022
KLLA0F09185g44547860.022
Kwal_33.1504549654860.026
Scas_620.1049249840.036
KLLA0F15224g50054790.14
CAGL0L01089g215237800.15
YDL171C (GLT1)214539790.22
KLLA0E19723g214137780.24
YFL018C (LPD1)49946770.25
ADR290W219537780.30
AFR367W50371760.39
Kwal_33.14854216337750.52
KLLA0F16753g48750730.90
KLLA0F02860g43347730.93
ACR122C67634721.3
KLLA0A08492g37382701.7
Kwal_27.1008849875701.8
Kwal_47.1797249844702.0
Scas_678.468027702.1
KLLA0D11154g49344702.2
AFR512W49637692.9
YEL047C47069683.3
CAGL0L01177g46547674.6
YMR299C31248664.7
YPL017C49938675.0
KLLA0E14806g40037665.2
CAGL0I01320g50084666.6
Scas_589.13131174659.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M07612g
         (572 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M07612g complement(760610..762355) similar to sp|P50264 Sac...  1064   0.0  
YMR020W (FMS1) [3984] chr13 (315376..316902) Protein involved in...   442   e-150
Scas_709.50                                                           432   e-146
Kwal_26.8214                                                          412   e-138
Sklu_2411.9 YMR020W, Contig c2411 17037-18530 reverse complement      394   e-132
ABR057W [648] [Homologous to ScYMR020W (FMS1) - SH] complement(5...   323   e-104
KLLA0E07744g complement(696382..697983) similar to sp|P50264 Sac...   319   e-102
CAGL0K01925g 170068..171414 highly similar to sp|P39958 Saccharo...    40   0.004
AFR183C [3375] [Homologous to ScYER136W (GDI1) - SH] (770855..77...    40   0.006
CAGL0D05940g 566095..567564 highly similar to sp|P32476 Saccharo...    40   0.006
AAL141C [46] [Homologous to ScYGR175C (ERG1) - SH] (101503..1029...    40   0.006
YGR175C (ERG1) [2128] chr7 complement(846936..848426) Squalene m...    39   0.014
Scas_710.12                                                            38   0.017
Sklu_2225.5 YER136W, Contig c2225 5036-6379 reverse complement         38   0.017
YER136W (GDI1) [1565] chr5 (439612..440967) GDP dissociation inh...    38   0.021
Kwal_14.2064                                                           38   0.022
KLLA0F09185g 854314..855651 gi|15290262|gb|AAK94894.1 Kluyveromy...    38   0.022
Kwal_33.15045                                                          38   0.026
Scas_620.10                                                            37   0.036
KLLA0F15224g 1403958..1405460 highly similar to sp|P32476 Saccha...    35   0.14 
CAGL0L01089g complement(121900..128358) highly similar to sp|Q12...    35   0.15 
YDL171C (GLT1) [700] chr4 complement(149204..155641) Glutamate s...    35   0.22 
KLLA0E19723g 1743508..1749933 highly similar to sp|Q12680 Saccha...    35   0.24 
YFL018C (LPD1) [1664] chr6 complement(101622..103121) Dihydrolip...    34   0.25 
ADR290W [2031] [Homologous to ScYDL171C (GLT1) - SH] complement(...    35   0.30 
AFR367W [3559] [Homologous to ScYEL047C - SH; ScYJR051W (OSM1) -...    34   0.39 
Kwal_33.14854                                                          33   0.52 
KLLA0F16753g complement(1541959..1543422) similar to sp|P21375 S...    33   0.90 
KLLA0F02860g 267100..268401 weakly similar to sp|Q9UTM9 Schizosa...    33   0.93 
ACR122C [1169] [Homologous to NOHBY] (565397..567427) [2031 bp, ...    32   1.3  
KLLA0A08492g 751047..752168 weakly similar to sp|Q99042 Trigonop...    32   1.7  
Kwal_27.10088                                                          32   1.8  
Kwal_47.17972                                                          32   2.0  
Scas_678.4                                                             32   2.1  
KLLA0D11154g 952049..953530 highly similar to sp|P09624 Saccharo...    32   2.2  
AFR512W [3704] [Homologous to ScYFL018C (LPD1) - SH; ScYPL017C -...    31   2.9  
YEL047C (YEL047C) [1381] chr5 complement(65385..66797) Cytoplasm...    31   3.3  
CAGL0L01177g complement(134729..136126) highly similar to sp|P32...    30   4.6  
YMR299C (YMR299C) [4253] chr13 complement(864411..865349) Protei...    30   4.7  
YPL017C (YPL017C) [5420] chr16 complement(518730..520229) Member...    30   5.0  
KLLA0E14806g 1322461..1323663 similar to ca|CA0218|IPF15294 Cand...    30   5.2  
CAGL0I01320g complement(107768..109270) similar to sp|P21375 Sac...    30   6.6  
Scas_589.13                                                            30   9.7  

>CAGL0M07612g complement(760610..762355) similar to sp|P50264
           Saccharomyces cerevisiae YMR020w FMS1 suppressor of
           fenpropimorph resistance mutation FEN2, hypothetical
           start
          Length = 581

 Score = 1064 bits (2751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/572 (90%), Positives = 517/572 (90%)

Query: 1   MDRTYDVVVVGAGIAGLKAASVLTQSGKSCLVIESRDRIGGRLCTVTGYNGARYDLGASW 60
           MDRTYDVVVVGAGIAGLKAASVLTQSGKSCLVIESRDRIGGRLCTVTGYNGARYDLGASW
Sbjct: 1   MDRTYDVVVVGAGIAGLKAASVLTQSGKSCLVIESRDRIGGRLCTVTGYNGARYDLGASW 60

Query: 61  HHDTLTNRLFAEEVQLAAVDGADSTPQMFXXXXXXXXXXXXXXXXXXXXXXXXXXVYAPF 120
           HHDTLTNRLFAEEVQLAAVDGADSTPQMF                          VYAPF
Sbjct: 61  HHDTLTNRLFAEEVQLAAVDGADSTPQMFSGGATHCSASSASSASSASTGGNSAGVYAPF 120

Query: 121 VFDDDDPLIVDKIRGSLGDVTIRLIADEIEKFIELYFHSEYTAELSDDNDSQHSHEGFPR 180
           VFDDDDPLIVDKIRGSLGDVTIRLIADEIEKFIELYFHSEYTAELSDDNDSQHSHEGFPR
Sbjct: 121 VFDDDDPLIVDKIRGSLGDVTIRLIADEIEKFIELYFHSEYTAELSDDNDSQHSHEGFPR 180

Query: 181 ADMPLFDMLLMYLQQRAPFLTDDQMWYGIQYARYMELWHGVSWYQLSSRDSFFGHQGRNA 240
           ADMPLFDMLLMYLQQRAPFLTDDQMWYGIQYARYMELWHGVSWYQLSSRDSFFGHQGRNA
Sbjct: 181 ADMPLFDMLLMYLQQRAPFLTDDQMWYGIQYARYMELWHGVSWYQLSSRDSFFGHQGRNA 240

Query: 241 FVMNYDTIYNRIHGQIRTELGTVQLNSTVTKIENAGAHTTVSYTTSSASGAEDTXXXXXX 300
           FVMNYDTIYNRIHGQIRTELGTVQLNSTVTKIENAGAHTTVSYTTSSASGAEDT      
Sbjct: 241 FVMNYDTIYNRIHGQIRTELGTVQLNSTVTKIENAGAHTTVSYTTSSASGAEDTQHGQHG 300

Query: 301 XXXXXXTVQCSYVIVTIPQSLLSEGAVEFKPPLVPQISAALQKMHFGSLGKVVFEFEECC 360
                 TVQCSYVIVTIPQSLLSEGAVEFKPPLVPQISAALQKMHFGSLGKVVFEFEECC
Sbjct: 301 AAGQQHTVQCSYVIVTIPQSLLSEGAVEFKPPLVPQISAALQKMHFGSLGKVVFEFEECC 360

Query: 361 WDLXXXXXXXXXXXXXXXXXEFTALLRKESREKNYTAQRLQALVQDVKQLLGDDAVRHDC 420
           WDL                 EFTALLRKESREKNYTAQRLQALVQDVKQLLGDDAVRHDC
Sbjct: 361 WDLHTAKIVAVAHAAADTRAEFTALLRKESREKNYTAQRLQALVQDVKQLLGDDAVRHDC 420

Query: 421 WNQPLLFVNMAKTTGVPSLMMLMAPPLTHYIESLHDSHQVYEFFKPVLSQIMSVCNAPGH 480
           WNQPLLFVNMAKTTGVPSLMMLMAPPLTHYIESLHDSHQVYEFFKPVLSQIMSVCNAPGH
Sbjct: 421 WNQPLLFVNMAKTTGVPSLMMLMAPPLTHYIESLHDSHQVYEFFKPVLSQIMSVCNAPGH 480

Query: 481 IINGLDIAGGVAGDDANVSDKGPILRNVIVTDWTNDPYSKGAYSACYAGDDALDMFLAMS 540
           IINGLDIAGGVAGDDANVSDKGPILRNVIVTDWTNDPYSKGAYSACYAGDDALDMFLAMS
Sbjct: 481 IINGLDIAGGVAGDDANVSDKGPILRNVIVTDWTNDPYSKGAYSACYAGDDALDMFLAMS 540

Query: 541 NGQSSRVRFAGEHTILDGAGCAYGAWESGERE 572
           NGQSSRVRFAGEHTILDGAGCAYGAWESGERE
Sbjct: 541 NGQSSRVRFAGEHTILDGAGCAYGAWESGERE 572

>YMR020W (FMS1) [3984] chr13 (315376..316902) Protein involved in
           the biosynthesis of pantothenic acid, has similarity to
           Candida albicans corticosteroid-binding protein CBP1
           [1527 bp, 508 aa]
          Length = 508

 Score =  442 bits (1137), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 247/584 (42%), Positives = 338/584 (57%), Gaps = 113/584 (19%)

Query: 7   VVVVGAGIAGLKAASVLTQSG-KSCLVIESRDRIGGRLCTVTGYNGARYDLGASWHHDTL 65
           V+++GAGIAGLKAAS L Q+G + CLV+E+RDR+GGRL TVTGY G +YD+GASWHHDTL
Sbjct: 11  VIIIGAGIAGLKAASTLHQNGIQDCLVLEARDRVGGRLQTVTGYQGRKYDIGASWHHDTL 70

Query: 66  TNRLFAEEVQLAAVDGADSTPQMFXXXXXXXXXXXXXXXXXXXXXXXXXXVYAPFVFDDD 125
           TN LF EE QL+  DG                                      FVFDDD
Sbjct: 71  TNPLFLEEAQLSLNDGR-----------------------------------TRFVFDDD 95

Query: 126 DPLIVDKIRGSL---GDVTIRLIADEIEKFIELYFHSEYTAELSDDNDSQHSHEGFPRAD 182
           + + +D+ RG +    ++ + ++ +E+ KF EL FH                H G   +D
Sbjct: 96  NFIYIDEERGRVDHDKELLLEIVDNEMSKFAELEFHQ---------------HLGV--SD 138

Query: 183 MPLFDMLLMYLQQRAPFLTDDQMWYGIQYARYMELWHGVSWYQLSSRDSFFGHQGRNAFV 242
              F +++ YL QR  FLT+DQ+ Y  Q  RY+ELWHG+ W  LS++D++FGHQGRNAF 
Sbjct: 139 CSFFQLVMKYLLQRRQFLTNDQIRYLPQLCRYLELWHGLDWKLLSAKDTYFGHQGRNAFA 198

Query: 243 MNYDTIYNRIHGQIRTELGTVQLNSTVTKI-ENAGAHTTVSYTTSSASGAEDTXXXXXXX 301
           +NYD++  RI          ++L+  V  I      + TV+    +   A+         
Sbjct: 199 LNYDSVVQRIAQSFPQNW--LKLSCEVKSITREPSKNVTVNCEDGTVYNAD--------- 247

Query: 302 XXXXXTVQCSYVIVTIPQSLLS---------EGAVEFKPPLVPQISAALQKMHFGSLGKV 352
                     YVI+T+PQS+L+          G +EF+PPL P I  A  K+HFG+LGKV
Sbjct: 248 ----------YVIITVPQSVLNLSVQPEKNLRGRIEFQPPLKPVIQDAFDKIHFGALGKV 297

Query: 353 VFEFEECCWDLXXXXXXXXXXXXXXXXXEFTALLRKESREKNYTAQRLQALVQDVKQLLG 412
           +FEFEECCW                   EF  ++R         A+ L  L   +++   
Sbjct: 298 IFEFEECCW----SNESSKIVTLANSTNEFVEIVR--------NAENLDELDSMLER--- 342

Query: 413 DDAVRHD---CWNQPLLFVNMAKTTGVPSLMMLMAPPLTHYIESLH-DSHQVYEFFKPVL 468
           +D+ +H    CW+QPL FVN++K+TGV S MMLM  PLT++IES+  D  +++ FF+PVL
Sbjct: 343 EDSQKHTSVTCWSQPLFFVNLSKSTGVASFMMLMQAPLTNHIESIREDKERLFSFFQPVL 402

Query: 469 SQIMSVCNAPGHIINGLDIAGGVAGDDANVSDKGPILRNVIVTDWTNDPYSKGAYSACYA 528
           ++IM  C     +I+G+     +A  +AN     P+LRN+IV++WT DPYS+GAYSAC+ 
Sbjct: 403 NKIMK-CLDSEDVIDGMRPIENIA--NAN----KPVLRNIIVSNWTRDPYSRGAYSACFP 455

Query: 529 GDDALDMFLAMSNGQSSRVRFAGEHTILDGAGCAYGAWESGERE 572
           GDD +DM +AMSNGQ SR+RFAGEHTI+DGAGCAYGAWESG RE
Sbjct: 456 GDDPVDMVVAMSNGQDSRIRFAGEHTIMDGAGCAYGAWESGRRE 499

>Scas_709.50
          Length = 552

 Score =  432 bits (1110), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 239/582 (41%), Positives = 327/582 (56%), Gaps = 110/582 (18%)

Query: 7   VVVVGAGIAGLKAASVLTQSG-KSCLVIESRDRIGGRLCTVTGYNGARYDLGASWHHDTL 65
           V+++GAGIAGLKAAS L  +G K+CLVIE+RDRIGGRL TV GY G +YDLGA WHHDTL
Sbjct: 54  VIIIGAGIAGLKAASTLYANGIKNCLVIEARDRIGGRLLTVKGYKGDKYDLGAGWHHDTL 113

Query: 66  TNRLFAEEVQLAAVDGADSTPQMFXXXXXXXXXXXXXXXXXXXXXXXXXXVYAPFVFDDD 125
            N LF EE +    D                                       FVF+D 
Sbjct: 114 MNPLFLEEAEAMKKDSKKR-----------------------------------FVFEDS 138

Query: 126 DPLIVDKIRGSLG---DVTIRLIADEIEKFIELYFHSEYTAELSDDNDSQHSHEGFPRAD 182
             + +D  RG +    D+++  +  EI+KF  L F+     +                 D
Sbjct: 139 QFIYIDDQRGRIDHDPDMSLEFVDAEIDKFTGLEFYQSLDVK-----------------D 181

Query: 183 MPLFDMLLMYLQQRAPFLTDDQMWYGIQYARYMELWHGVSWYQLSSRDSFFGHQGRNAFV 242
              + ++L YL QR  FLTDDQ+ +  Q ARY+ELWHG SW +LS++D++F HQGRNA V
Sbjct: 182 CSFYHIILKYLLQRRDFLTDDQIKFSAQIARYLELWHGASWDKLSAKDTYFDHQGRNALV 241

Query: 243 MNYDTIYNRIHGQIRTELGTVQLNSTVTKIENAGAHTTVSYTTSSASGAEDTXXXXXXXX 302
            N+D++ NRI      +   ++LN+ V  IE  G +  +  +    SG E          
Sbjct: 242 TNFDSVVNRIGDTFPKDW--IRLNTEVKAIERDGKNVLIKLS----SGEEYI-------- 287

Query: 303 XXXXTVQCSYVIVTIPQSLL-----------SEGAVEFKPPLVPQISAALQKMHFGSLGK 351
                  C Y IVTIPQS+L           ++G ++FKPPL PQI  A +K+HFG LGK
Sbjct: 288 -------CQYTIVTIPQSVLQLSLQLPDESNTKGRIDFKPPLNPQIQEAFKKIHFGGLGK 340

Query: 352 VVFEFEECCWDLXXXXXXXXXXXXXXXXXEFTALLRKESREKNYTAQRLQALVQDVKQLL 411
           VVFEF++C W                    F   +RK        A+  + L+ ++K   
Sbjct: 341 VVFEFDKCTW----SNESSRIFTLAHSQENFVEDVRK--------AETWEGLIDNLKT-- 386

Query: 412 GDDAVRHDCWNQPLLFVNMAKTTGVPSLMMLMAPPLTHYIESL-HDSHQVYEFFKPVLSQ 470
               +  +CW+ PLLF+N+AK+ G P+L+MLM  PL++YIES+ +D  +VYEFF+PVL +
Sbjct: 387 PSSQLFENCWDFPLLFINLAKSIGRPTLIMLMQSPLSNYIESIGNDKQKVYEFFQPVLDK 446

Query: 471 IMSVCNAPGHIINGLDIAGGVAGDDANVSDKGPILRNVIVTDWTNDPYSKGAYSACYAGD 530
           +M+   +   +INGL      + +        PIL+N++VT+W NDPYS+GAYSAC+AGD
Sbjct: 447 VMTTLQS-NKVINGL------SANPTEAETNSPILKNLLVTNWNNDPYSRGAYSACFAGD 499

Query: 531 DALDMFLAMSNGQSSRVRFAGEHTILDGAGCAYGAWESGERE 572
           DAL+M +AMSNGQ SR+RFAGEHTI+DGAG  +G+WESG RE
Sbjct: 500 DALEMIIAMSNGQDSRIRFAGEHTIMDGAGAVHGSWESGRRE 541

>Kwal_26.8214
          Length = 502

 Score =  412 bits (1058), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 232/578 (40%), Positives = 312/578 (53%), Gaps = 104/578 (17%)

Query: 7   VVVVGAGIAGLKAASVLTQSG-KSCLVIESRDRIGGRLCTVTGYNGARYDLGASWHHDTL 65
           VV++GAGI+GLKAASVL + G  SC+VIE+RDRIGGRL TV+GY G +YD+GASWHHDTL
Sbjct: 6   VVIIGAGISGLKAASVLHEKGCDSCIVIEARDRIGGRLHTVSGYKGRKYDVGASWHHDTL 65

Query: 66  TNRLFAEEVQLAAVDGADSTPQMFXXXXXXXXXXXXXXXXXXXXXXXXXXVYAPFVFDDD 125
            N LF EE+ L   +                                      PFVFDDD
Sbjct: 66  VNGLFLEEMGLPREE------------------------------------RTPFVFDDD 89

Query: 126 DPLIVDKIRGSL---GDVTIRLIADEIEKFIELYFHSEYTAELSDDNDSQHSHEGFPRAD 182
             L+ DK RG +     + + ++ +E+ K+ +L +  +   E                 D
Sbjct: 90  SMLVFDKARGRVDYDSQMELEILVEELSKYTQLQYFEDLEVE-----------------D 132

Query: 183 MPLFDMLLMYLQQRAPFLTDDQMWYGIQYARYMELWHGVSWYQLSSRDSFFGHQGRNAFV 242
           +  F  ++ YL +R   LTDDQ+ Y  Q AR+MELWHG+ W   SS+     HQGRNAFV
Sbjct: 133 VNYFQTIMKYLYERRELLTDDQIQYLPQLARFMELWHGIDWKSQSSKGLEIAHQGRNAFV 192

Query: 243 MNYDTIYNRIHGQIRTELGTVQLNSTVTKIENAGAHTTVSYTTSSASGAEDTXXXXXXXX 302
           +N+  I  R+   I  E    +L + V +++  G    VS +                  
Sbjct: 193 LNFGNIAQRVASTIPQEW--FELETEVREVKKEGEKVLVSTSKGE--------------- 235

Query: 303 XXXXTVQCSYVIVTIPQSLLS--------EGAVEFKPPLVPQISAALQKMHFGSLGKVVF 354
               T+ C YVIVTIPQS+L+        +G +EF PPL  +I  +L+  HFG LGKVVF
Sbjct: 236 ----TISCDYVIVTIPQSILAHSLQPEPRKGRIEFIPPLSSEIKTSLEHAHFGGLGKVVF 291

Query: 355 EFEECCWDLXXXXXXXXXXXXXXXXXEFTALLRKESREKNYTAQRLQALVQDVKQLLGDD 414
           EFE CCW                        L  + RE    +Q ++ L  D K    + 
Sbjct: 292 EFESCCWSKERSRALALGKPIVD--------LTSKIREAVDLSQLVEKLDLDSKYTYKNG 343

Query: 415 AVRHDCWNQPLLFVNMAKTTGVPSLMMLMAPPLTHYIESLHDSHQVYEFFKPVLSQIMSV 474
               + W+ PLLFVN+AK T +PS +MLM  PLT YIES+ D  ++YEFFKP+L Q++  
Sbjct: 344 ----ESWDFPLLFVNLAKHTDIPSFIMLMPNPLTEYIESIKDKEKLYEFFKPILDQLLVT 399

Query: 475 CNAPGHIINGLDIAGGVAGDDANVSDKGPILRNVIVTDWTNDPYSKGAYSACYAGDDALD 534
                 II   D    +  +D    +K P+L+N++ T WT D Y+ GAYSACY GDD ++
Sbjct: 400 FGCFEPIIKDFD--DEIVSED----EKKPVLKNILTTSWTGDDYALGAYSACYPGDDPMN 453

Query: 535 MFLAMSNGQSSRVRFAGEHTILDGAGCAYGAWESGERE 572
           + LA+SN Q+SR+RFAGEHTI+DGAGC YGAWESG+RE
Sbjct: 454 VVLALSNNQTSRIRFAGEHTIMDGAGCVYGAWESGKRE 491

>Sklu_2411.9 YMR020W, Contig c2411 17037-18530 reverse complement
          Length = 497

 Score =  394 bits (1013), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 231/579 (39%), Positives = 306/579 (52%), Gaps = 109/579 (18%)

Query: 7   VVVVGAGIAGLKAASVL-TQSGKSCLVIESRDRIGGRLCTVTGYNGARYDLGASWHHDTL 65
           VV++GAGIAGLKAAS L  ++  SC+V+ESRDRIGGRL TV GY+G +YDLGASWHHDTL
Sbjct: 7   VVIIGAGIAGLKAASDLYAKNCHSCVVLESRDRIGGRLHTVEGYDGRKYDLGASWHHDTL 66

Query: 66  TNRLFAEEVQLAAVDGADSTPQMFXXXXXXXXXXXXXXXXXXXXXXXXXXVYAPFVFDDD 125
            N LF EE+QL   +                                      PFVFDDD
Sbjct: 67  MNGLFLEELQLPEQERT------------------------------------PFVFDDD 90

Query: 126 DPLIVDKIRGSLGD----VTIRLIADEIEKFIELYFHSEYTAELSDDNDSQHSHEGFPRA 181
           D LI+    G   D    + + ++ +E+++FIEL F                  E     
Sbjct: 91  D-LILFTENGKRLDHDPKLILEVLKEELDRFIELQFF-----------------ESLDVK 132

Query: 182 DMPLFDMLLMYLQQRAPFLTDDQMWYGIQYARYMELWHGVSWYQLSSRDSFFGHQGRNAF 241
           D+  F ++L YL QR  FL+D+Q+ +  Q ARY+ELWHG+ W  LS + +   HQGRNA 
Sbjct: 133 DISYFQIILKYLYQRRDFLSDEQLKHLPQLARYLELWHGIDWKTLSGKYAHIDHQGRNAM 192

Query: 242 VMNYDTIYNRIHGQIRTELGTVQLNSTVTKIENAGAHTTVSYTTSSASGAEDTXXXXXXX 301
           V++Y +I  R+      E   ++L++ V ++   G    V                    
Sbjct: 193 VLHYSSIVKRVASSFPKEW--LKLSTEVCEVRREGKKVCVK------------------- 231

Query: 302 XXXXXTVQCSYVIVTIPQSLLS--------EGAVEFKPPLVPQISAALQKMHFGSLGKVV 353
                T  C YV+VT+PQS+L          G +EF PPL   I  +  K+H+G+LGKVV
Sbjct: 232 -TFEETYVCDYVVVTVPQSILELSLHKEARTGRIEFCPPLNKDIVESFGKVHYGTLGKVV 290

Query: 354 FEFEECCWDLXXXXXXXXXXXXXXXXXEFTALLRKESREKNYTAQRLQALVQDVKQLLGD 413
           FEF++CCW                         RK     ++ A  ++ L +D    LG+
Sbjct: 291 FEFDKCCWSTERAKILSMGKTP-------EGFARKVRNATDFCAL-VKELDKDTSYELGN 342

Query: 414 DAVRHDCWNQPLLFVNMAKTTGVPSLMMLMAPPLTHYIESLHDSHQVYEFFKPVLSQIMS 473
           D      W+ PL FVN+AKTTGVPS +MLM  PLT Y+ESL D   VYE+FKP+L  +  
Sbjct: 343 DP-----WDFPLYFVNLAKTTGVPSFVMLMQEPLTGYVESLEDKRHVYEYFKPILESLFK 397

Query: 474 VCNAPGHIINGLDIAGGVAGDDANVSDKGPILRNVIVTDWTNDPYSKGAYSACYAGDDAL 533
           V  +   I    D   G+     NV    PIL+NV  T+WT +PYS GAYSAC+  DD +
Sbjct: 398 VLGSDAPIC---DFEKGIDDARENV----PILKNVFTTNWTREPYSLGAYSACFPNDDPM 450

Query: 534 DMFLAMSNGQSSRVRFAGEHTILDGAGCAYGAWESGERE 572
           D  LA+  GQ S +RFAGEHT++DGAGC YGAWESG+RE
Sbjct: 451 DFILALEKGQDSHIRFAGEHTVMDGAGCVYGAWESGKRE 489

>ABR057W [648] [Homologous to ScYMR020W (FMS1) - SH]
           complement(500154..501716) [1563 bp, 520 aa]
          Length = 520

 Score =  323 bits (827), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 203/579 (35%), Positives = 293/579 (50%), Gaps = 101/579 (17%)

Query: 5   YDVVVVGAGIAGLKAASVLTQSG-KSCLVIESRDRIGGRLCTVTG--YNGARYDLGASWH 61
           Y VVVVGAGIAGLKAA+ L  +G + C+V+E+R R GGRL  V    + G RYDLGASWH
Sbjct: 10  YTVVVVGAGIAGLKAAAELHSAGIEKCVVLEARARTGGRLLQVESSVFPGRRYDLGASWH 69

Query: 62  HDTLTNRLFAEEVQLAAVDGADSTPQMFXXXXXXXXXXXXXXXXXXXXXXXXXXVYAPFV 121
           HDTL+N LFAEE++L   + A                                     +V
Sbjct: 70  HDTLSNELFAEELRLPEAERAG------------------------------------YV 93

Query: 122 FDDDDPLIVDKIRGSLGDVTIRLIADEIEKFIELYFHSEYTAELSDDNDSQHSHEGFPRA 181
           FDD   ++V    G   D    L+ + +++ +E Y   +Y              E     
Sbjct: 94  FDDVPTMVVSPA-GRRLDGDFGLMLEALQREVEHYIEEQY-------------FESLEAR 139

Query: 182 DMPLFDMLLMYLQQRAPFLTDDQMWYGIQYARYMELWHGVSWYQLSSRDSFFGHQGRNAF 241
           DMP F++++ YL +R   LTDDQ+       R+ E WH + W  LS++ S   + GRNAF
Sbjct: 140 DMPFFELVMAYLYERRGVLTDDQIQQLPGTVRFREFWHAIDWKLLSAKLSEVENNGRNAF 199

Query: 242 VMNYDTIYNRIHGQIRTELGTVQLNSTVTKIENAGAHTTVSYTTSSASGAEDTXXXXXXX 301
           V+NYD +  R+   +  E   ++L + VTKIE      TV  TT  A GA          
Sbjct: 200 VLNYDKLLRRVESGVPREW--IRLGTRVTKIERV--RDTVHITT--ADGA---------- 243

Query: 302 XXXXXTVQCSYVIVTIPQSLLS--------EGAVEFKPPLVPQISAALQKMHFGSLGKVV 353
                  +C+  IVT+PQS+L          G +EF+PPL   I++A ++ H+ SLGK+ 
Sbjct: 244 ---CYVSKCA--IVTVPQSVLELSLKPERVPGRIEFRPPLNDNITSAFERAHYASLGKIF 298

Query: 354 FEFEECCWDLXXXXXXXXXXXXXXXXXEFTALLRKESREKNYTAQRLQALVQDVKQLLGD 413
           FEF++C WD                  +F+A +RK        AQ LQ L++       +
Sbjct: 299 FEFDKCTWD----TQRPRVAIAAKVPDDFSAQVRK--------AQDLQELLRSASAQT-E 345

Query: 414 DAVRHDCWNQPLLFVNMAKTTGVPSLMMLMAPPLTHYIESLHDSHQVYEFFKPVLSQIMS 473
             +  DC++ P  F NM    G+P+L+     PLT ++E L    ++ ++FKP +   + 
Sbjct: 346 VKLGQDCFDFPQEFQNMVALAGIPTLIAFTQTPLTEHVERL-SKQEIVDYFKPAIVVALR 404

Query: 474 VCNAPGHIINGLDIAGGVAGDDANVSDKGPILRNVIVTDWTNDPYSKGAYSACYAGDDAL 533
              +    +   D+      DD   S  GPIL+NVI   W+ D YS+G+Y+  +  DD L
Sbjct: 405 ALGSKEECL--FDLGNTQPQDD---SHPGPILKNVIFNPWSQDTYSRGSYTGSHVDDDQL 459

Query: 534 DMFLAMSNGQSSRVRFAGEHTILDGAGCAYGAWESGERE 572
            + +A++NGQ SR+RFAGEHT+++G GC YGAWESG RE
Sbjct: 460 PLTVALNNGQDSRIRFAGEHTVMEGNGCTYGAWESGRRE 498

>KLLA0E07744g complement(696382..697983) similar to sp|P50264
           Saccharomyces cerevisiae YMR020w FMS1 suppressor of
           fenpropimorph resistance mutation FEN2 singleton, start
           by similarity
          Length = 533

 Score =  319 bits (818), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 207/585 (35%), Positives = 302/585 (51%), Gaps = 118/585 (20%)

Query: 5   YDVVVVGAGIAGLKAASVLTQSG-KSCLVIESRDRIGGRLCTVTGYNGARYDLGASWHHD 63
           Y V+V+GAGI+GLKA S L +SG +S + IESRDR+GGRL T  G NG +YD+G SWHHD
Sbjct: 36  YSVIVIGAGISGLKATSDLVKSGIESVICIESRDRVGGRLNTRQGRNG-KYDIGGSWHHD 94

Query: 64  TLTNRLFAEEVQLAAVDGADSTPQMFXXXXXXXXXXXXXXXXXXXXXXXXXXVYAPFVFD 123
           TL+N LF EE+ L   +                                     A FVFD
Sbjct: 95  TLSNGLFMEEMSLPESE------------------------------------RAGFVFD 118

Query: 124 DDD-PLIVDKIRGSLGDVTIRLIADEIEKFIELYFHSEYTAELSDDNDSQHSHEGFPRAD 182
           D+D   +VDK  G L    +  +A E EK++E+ ++     E                 D
Sbjct: 119 DEDRACLVDKKLGVLEVDQLECLAYEFEKWVEMRYYDSLDVE-----------------D 161

Query: 183 MPLFDMLLMYLQQRAPFLTDDQMWYGIQYARYMELWHGVSWYQLSSRDSFFGHQGRNAFV 242
           +  F + + +   R  FLTD+Q+++  Q  RYMELWHGV WY LS + S   H GRNA V
Sbjct: 162 VSYFQLCIEFCFSRKEFLTDEQLYHLPQLLRYMELWHGVDWYALSGKWSGIEHNGRNALV 221

Query: 243 MNYDTIYNRIHGQIRTELGTVQLNSTVTKIENAGAHTTVSYTTSSASGAEDTXXXXXXXX 302
           ++YD I  RI   ++ ++   +  + + K+ N        Y  ++  G            
Sbjct: 222 LHYDKILARISNPVKDKIHLSESVNLIKKLSNG------KYQVNTDKGK----------- 264

Query: 303 XXXXTVQCSYVIVTIPQSLLS--------------EGAVEFKPPLVPQISAAL-QKMHFG 347
                  C Y IVT+PQS+L+              +  + F+PPL   I  A+  K  FG
Sbjct: 265 -----YLCDYCIVTVPQSVLAISCEQEENEFSHMRKARIGFEPPLNGDIFEAITTKASFG 319

Query: 348 SLGKVVFEFEECCWDLXXXXXXXXXXXXXXXXXEFTALLRKESREKNYTAQRLQALVQDV 407
           SLGKV+FEF+   W                   +F   +R        +A+ L+ L++D+
Sbjct: 320 SLGKVIFEFDSIKW----SKTSGRILTVHEQPTDFVESIR--------SAKDLKTLLKDI 367

Query: 408 KQLLGDDAVRHDCWNQPLLFVNMAKTTGVPSLMMLMAPPLTHYIESLHDSHQVYEFFKPV 467
           +Q L       D W  P  F+N+AK T   S + L+  P+T YIE+L  + +V EFF+PV
Sbjct: 368 EQKLPRS--HEDSWKNPTCFLNLAKHTDTASFVALIQQPVTEYIETLT-TEEVEEFFRPV 424

Query: 468 LSQIMSVCNAPGHIINGLDIAGGVAGDDANVSDKGPILRNVIVTDWTNDPYSKGAYSACY 527
           L+++++   +  +I +          +D     K PIL+N++ ++W++DP+S GAYSAC 
Sbjct: 425 LNKLLNSLGSSDYISD---------LNDEVKESKTPILKNILTSNWSSDPFSLGAYSACQ 475

Query: 528 AGDDALDMFLAMSNGQSSRVRFAGEHTILDGAGCAYGAWESGERE 572
            GDD +D+ +A++ GQ + +RFAGEHTI+DGAGCAYGAWESG+RE
Sbjct: 476 PGDDPMDLVIALNVGQGN-LRFAGEHTIMDGAGCAYGAWESGKRE 519

>CAGL0K01925g 170068..171414 highly similar to sp|P39958
          Saccharomyces cerevisiae YER136w Secretory pathway GDP
          dissociation inhibitor, start by similarity
          Length = 448

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%)

Query: 1  MDRTYDVVVVGAGIAGLKAASVLTQSGKSCLVIESRDRIGGRLCTVT 47
          +DR YDV+V+G GI     + +L+  GK  L I+ +D  GG   ++T
Sbjct: 6  IDRDYDVIVLGTGITECILSGLLSVEGKKVLHIDKQDHYGGEAASIT 52

>AFR183C [3375] [Homologous to ScYER136W (GDI1) - SH]
          (770855..772195) [1341 bp, 446 aa]
          Length = 446

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%)

Query: 1  MDRTYDVVVVGAGIAGLKAASVLTQSGKSCLVIESRDRIGGRLCTVT 47
          MD  YDV+V+G G+     + VL+  GK  L I+ +D  GG   +VT
Sbjct: 1  MDEDYDVIVLGTGLTECILSGVLSVEGKKVLHIDRQDHYGGESASVT 47

>CAGL0D05940g 566095..567564 highly similar to sp|P32476
          Saccharomyces cerevisiae YGR175c ERG1 squalene
          monooxygenase, hypothetical start
          Length = 489

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 4/54 (7%)

Query: 4  TYDVVVVGAGIAGLKAASVLTQSGKSCLVIESR----DRIGGRLCTVTGYNGAR 53
          TYD ++VGAG+ G   A+ L + GK  L++E      DRI G L    G    R
Sbjct: 11 TYDALIVGAGVIGPCVATALARKGKKVLIVEREWSQPDRIVGELMQPGGLRALR 64

>AAL141C [46] [Homologous to ScYGR175C (ERG1) - SH]
          (101503..102996) [1494 bp, 497 aa]
          Length = 497

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 27/54 (50%), Gaps = 4/54 (7%)

Query: 4  TYDVVVVGAGIAGLKAASVLTQSGKSCLVIESR----DRIGGRLCTVTGYNGAR 53
           YD +VVGAG+ G   A+ L + GK  L++E      DRI G L    G    R
Sbjct: 19 VYDAIVVGAGVVGPCVATALARKGKKVLIVEREWSQPDRIVGELMQPAGVRALR 72

>YGR175C (ERG1) [2128] chr7 complement(846936..848426) Squalene
          monooxygenase (squalene epoxidase), an enzyme of the
          ergosterol biosynthesis pathway [1491 bp, 496 aa]
          Length = 496

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 4/54 (7%)

Query: 4  TYDVVVVGAGIAGLKAASVLTQSGKSCLVIES----RDRIGGRLCTVTGYNGAR 53
          TYD +V+GAG+ G   A+ L + GK  L++E      DRI G L    G    R
Sbjct: 18 TYDAIVIGAGVIGPCVATGLARKGKKVLIVERDWAMPDRIVGELMQPGGVRALR 71

>Scas_710.12
          Length = 454

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%)

Query: 1  MDRTYDVVVVGAGIAGLKAASVLTQSGKSCLVIESRDRIGGRLCTVT 47
          +D  YDV+V+G GI     + +L+  GK  L I+ +D  GG   +VT
Sbjct: 6  LDTDYDVIVLGTGITECILSGLLSVDGKKVLHIDKQDHYGGEAASVT 52

>Sklu_2225.5 YER136W, Contig c2225 5036-6379 reverse complement
          Length = 447

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%)

Query: 1  MDRTYDVVVVGAGIAGLKAASVLTQSGKSCLVIESRDRIGGRLCTVT 47
          MD  YDV+V+G G      + +L+  GK  L I+ +D  GG   +VT
Sbjct: 1  MDENYDVIVLGTGTTECILSGLLSVDGKKVLHIDKQDHYGGESASVT 47

>YER136W (GDI1) [1565] chr5 (439612..440967) GDP dissociation
          inhibitor [1356 bp, 451 aa]
          Length = 451

 Score = 37.7 bits (86), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%)

Query: 1  MDRTYDVVVVGAGIAGLKAASVLTQSGKSCLVIESRDRIGGRLCTVT 47
          +D  YDV+V+G GI     + +L+  GK  L I+ +D  GG   +VT
Sbjct: 6  IDTDYDVIVLGTGITECILSGLLSVDGKKVLHIDKQDHYGGEAASVT 52

>Kwal_14.2064
          Length = 447

 Score = 37.7 bits (86), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 27/46 (58%)

Query: 1  MDRTYDVVVVGAGIAGLKAASVLTQSGKSCLVIESRDRIGGRLCTV 46
          MD +YDV+V+G G+     + +L+  GK  L I+ +D  GG   +V
Sbjct: 1  MDESYDVIVLGTGLTECILSGLLSVDGKKVLHIDKQDHYGGESASV 46

>KLLA0F09185g 854314..855651 gi|15290262|gb|AAK94894.1
          Kluyveromyces lactis putative GDP dissociation
          inhibitor, start by similarity
          Length = 445

 Score = 37.7 bits (86), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%)

Query: 1  MDRTYDVVVVGAGIAGLKAASVLTQSGKSCLVIESRDRIGGRLCTVT 47
          MD  YDV+V+G G+     + +L+  GK  L ++ +D  GG   +VT
Sbjct: 1  MDENYDVIVLGTGLTECILSGLLSIEGKKVLHVDRQDHYGGESSSVT 47

>Kwal_33.15045
          Length = 496

 Score = 37.7 bits (86), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 27/54 (50%), Gaps = 4/54 (7%)

Query: 4  TYDVVVVGAGIAGLKAASVLTQSGKSCLVIESR----DRIGGRLCTVTGYNGAR 53
          TYD +VVG G+ G   A+ L + GK  L++E      DRI G L    G    R
Sbjct: 18 TYDAIVVGCGVIGPCVATGLARKGKKVLIVEREWSMPDRIVGELMQPGGVRAMR 71

>Scas_620.10
          Length = 492

 Score = 37.0 bits (84), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 27/49 (55%), Gaps = 4/49 (8%)

Query: 4  TYDVVVVGAGIAGLKAASVLTQSGKSCLVIES----RDRIGGRLCTVTG 48
          TYD +VVGAG+ G   A+ L + GK  L++E      DRI G L    G
Sbjct: 14 TYDAIVVGAGVIGPCVATGLARKGKKVLIVERDWAMPDRIVGELMQPGG 62

>KLLA0F15224g 1403958..1405460 highly similar to sp|P32476
          Saccharomyces cerevisiae YGR175c ERG1 squalene
          monooxygenase singleton, start by similarity
          Length = 500

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 4/54 (7%)

Query: 4  TYDVVVVGAGIAGLKAASVLTQSGKSCLVIES----RDRIGGRLCTVTGYNGAR 53
           YD +VVG G+ G   A+ L + GK  L++E      DRI G L    G    R
Sbjct: 22 VYDAIVVGCGVVGPCIATGLARKGKKVLIVERDWTMPDRIVGELMQPGGLRALR 75

>CAGL0L01089g complement(121900..128358) highly similar to sp|Q12680
            Saccharomyces cerevisiae YDL171c GLT1 glutamate synthase,
            hypothetical start
          Length = 2152

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 23/37 (62%)

Query: 7    VVVVGAGIAGLKAASVLTQSGKSCLVIESRDRIGGRL 43
            V ++G+G AG+  A +L ++G S  V E  DR GG L
Sbjct: 1794 VAIIGSGPAGMACADMLNRAGHSVTVFERADRCGGLL 1830

>YDL171C (GLT1) [700] chr4 complement(149204..155641) Glutamate
            synthase (NADPH, GOGAT), involved with glutamine
            synthetase (Gln1p) in glutamate biosynthesis [6438 bp,
            2145 aa]
          Length = 2145

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 24/39 (61%)

Query: 5    YDVVVVGAGIAGLKAASVLTQSGKSCLVIESRDRIGGRL 43
            + V V+G+G AGL  A +L ++G +  V E  DR GG L
Sbjct: 1783 FTVGVIGSGPAGLACADMLNRAGHTVTVYERSDRCGGLL 1821

>KLLA0E19723g 1743508..1749933 highly similar to sp|Q12680
            Saccharomyces cerevisiae YDL171c GLT1 glutamate synthase
            (NAPDPH) (GOGAT) singleton, start by similarity
          Length = 2141

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 23/37 (62%)

Query: 7    VVVVGAGIAGLKAASVLTQSGKSCLVIESRDRIGGRL 43
            V V+G+G AG+  A  L ++G S +V E  DR GG L
Sbjct: 1784 VAVIGSGPAGMACADQLNRAGHSVVVYERADRCGGLL 1820

>YFL018C (LPD1) [1664] chr6 complement(101622..103121)
          Dihydrolipoamide dehydrogenase, (E3) component of
          pyruvate dehydrogenase complex, 2-oxoglutarate
          dehydrogenase complex (alpha-ketogluterate dehydrogense
          complex), branched chain 2-oxoacid dehydrogenase
          complex, and glycine carboxylase complex [1500 bp, 499
          aa]
          Length = 499

 Score = 34.3 bits (77), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%)

Query: 1  MDRTYDVVVVGAGIAGLKAASVLTQSGKSCLVIESRDRIGGRLCTV 46
          +++++DVV++G G AG  AA    Q G +   +E R ++GG    V
Sbjct: 23 INKSHDVVIIGGGPAGYVAAIKAAQLGFNTACVEKRGKLGGTCLNV 68

>ADR290W [2031] [Homologous to ScYDL171C (GLT1) - SH]
            complement(1196235..1202822) [6588 bp, 2195 aa]
          Length = 2195

 Score = 34.7 bits (78), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%)

Query: 7    VVVVGAGIAGLKAASVLTQSGKSCLVIESRDRIGGRL 43
            V ++G+G AGL  A  L ++G S  V E  DR GG L
Sbjct: 1838 VAIIGSGPAGLSCADQLNRAGHSVTVYERADRCGGLL 1874

>AFR367W [3559] [Homologous to ScYEL047C - SH; ScYJR051W (OSM1) -
           SH] complement(1101019..1102530) [1512 bp, 503 aa]
          Length = 503

 Score = 33.9 bits (76), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 10/71 (14%)

Query: 7   VVVVGAGIAGLKAASVLTQSGKSCLVIESRDRIGGR-LCTVTGYNGAR---------YDL 56
           VVVVG G+AGL   + L ++G   ++++    IGG  +   +G NGA          YD 
Sbjct: 46  VVVVGLGLAGLSTGAQLVKNGVPVILMDKASAIGGNSVKASSGINGAGTQVQELLGVYDS 105

Query: 57  GASWHHDTLTN 67
             S++ DT+ +
Sbjct: 106 ADSFYRDTVAS 116

>Kwal_33.14854
          Length = 2163

 Score = 33.5 bits (75), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%)

Query: 7    VVVVGAGIAGLKAASVLTQSGKSCLVIESRDRIGGRL 43
            + ++G+G AGL  A  L ++G S  V E  DR GG L
Sbjct: 1804 IAIIGSGPAGLACADQLNRAGHSVTVYERADRCGGLL 1840

>KLLA0F16753g complement(1541959..1543422) similar to sp|P21375
          Saccharomyces cerevisiae YJR051w OSM1 osmotic growth
          protein, start by similarity
          Length = 487

 Score = 32.7 bits (73), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 7  VVVVGAGIAGLKAASVLTQSGKSCLVIESRDRIGGR-LCTVTGYNGARYD 55
          VVV+G+G+AGL  ++ L +     +++E    IGG  +   +G NGA  D
Sbjct: 33 VVVIGSGLAGLTTSTQLVKFNIPIVLLEKTGSIGGNSIKASSGINGAGTD 82

>KLLA0F02860g 267100..268401 weakly similar to sp|Q9UTM9
          Schizosaccharomyces pombe Putative fructosyl amino acid
          oxidase, start by similarity
          Length = 433

 Score = 32.7 bits (73), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 1/47 (2%)

Query: 4  TYDVVVVGAGIAGLKAASVLTQSGKSCLVIESRDRIGGRLCTVTGYN 50
           YDVV+VGAGI GL  A  L +S    +V++ + +I  +L     YN
Sbjct: 3  NYDVVIVGAGIFGLSTAVQLARSKYKVVVVD-KFQIPSQLSASCDYN 48

>ACR122C [1169] [Homologous to NOHBY] (565397..567427) [2031 bp, 676
           aa]
          Length = 676

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 20/34 (58%)

Query: 7   VVVVGAGIAGLKAASVLTQSGKSCLVIESRDRIG 40
           V++VG G  GL  A+ L   G S L+IE   R+G
Sbjct: 266 VLIVGGGQGGLAVAARLKSFGISSLIIEKNARVG 299

>KLLA0A08492g 751047..752168 weakly similar to sp|Q99042
          Trigonopsis variabilis D-amino acid oxidase (EC
          1.4.3.3) (DAMOX) (DAO) (DAAO), start by similarity
          Length = 373

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 38/82 (46%), Gaps = 20/82 (24%)

Query: 7  VVVVGAGIAGLKAA-SVLTQSGKSC---LVIESRDRIGGRLCTVTGYNGARYDLGASW-- 60
          VVVVGAGI+GL  A S+L   G+     LVI +RD  G    T T Y+      GA+W  
Sbjct: 4  VVVVGAGISGLSVAHSLLELYGRDKIEELVIIARDIPG----TFTSYDYTSPWAGANWDS 59

Query: 61 ----------HHDTLTNRLFAE 72
                      DT+T   F E
Sbjct: 60 FAAPDDHAQIKRDTVTYEWFTE 81

>Kwal_27.10088
          Length = 498

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 11/75 (14%)

Query: 4   TYDVVVVGAGIAGLKAASVLTQSGKSCLV-IESRDRIGGR-LCTVTGYNGA----RYDLG 57
           T  VV++G+G+AGL AA+ L    K  +V +E    +GG  +   +G NGA    +  LG
Sbjct: 37  TTPVVIIGSGLAGLTAANQLVLKHKVPIVMLEKASSLGGNSIKASSGINGALTSTQKTLG 96

Query: 58  -----ASWHHDTLTN 67
                ++++ DTL++
Sbjct: 97  VNDSPSAFYQDTLSS 111

>Kwal_47.17972
          Length = 498

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 22/44 (50%)

Query: 3  RTYDVVVVGAGIAGLKAASVLTQSGKSCLVIESRDRIGGRLCTV 46
          + +D+VV+GAG  G  AA    Q G     +E R R GG    V
Sbjct: 26 KKHDLVVIGAGPGGYVAAIKAAQLGFDTACVEKRGRAGGTCLNV 69

>Scas_678.4
          Length = 680

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 1   MDRTYDVVVVGAGIAGLKAASVLTQSG 27
           +D  YD VVVGAG AGL+A   L ++G
Sbjct: 89  IDHEYDCVVVGAGGAGLRATFGLAEAG 115

>KLLA0D11154g 952049..953530 highly similar to sp|P09624
          Saccharomyces cerevisiae YFL018c LPD1 dihydrolipoamide
          dehydrogenase precursor, hypothetical start
          Length = 493

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 22/44 (50%)

Query: 3  RTYDVVVVGAGIAGLKAASVLTQSGKSCLVIESRDRIGGRLCTV 46
          + +D+VV+G G  G  AA    Q G     +E R R+GG    V
Sbjct: 21 KKHDLVVIGGGPGGYVAAIKAAQLGYDVACVEKRGRLGGTCLNV 64

>AFR512W [3704] [Homologous to ScYFL018C (LPD1) - SH; ScYPL017C -
           NSH] complement(1353616..1355106) [1491 bp, 496 aa]
          Length = 496

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 23/37 (62%)

Query: 7   VVVVGAGIAGLKAASVLTQSGKSCLVIESRDRIGGRL 43
           +VV+G GI GL+  SV ++ G    VIE + +IG  +
Sbjct: 206 LVVIGGGIIGLEMGSVYSRLGSKVTVIEFQPQIGATM 242

>YEL047C (YEL047C) [1381] chr5 complement(65385..66797)
          Cytoplasmic soluble fumarate reductase, involved with
          Osm1p in the reoxidation of NADH and the production of
          succinate during anaerobic growth [1413 bp, 470 aa]
          Length = 470

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 36/69 (52%), Gaps = 3/69 (4%)

Query: 7  VVVVGAGIAGLKAASVLTQS-GKSCLVIESRDRIGGR-LCTVTGYNGARYDLGASWHHDT 64
          VVV+G G+AGL AA+ L         ++E    IGG  +   +G NGA  +    +H + 
Sbjct: 6  VVVIGTGLAGLAAANELVNKYNIPVTILEKASSIGGNSIKASSGINGACTETQRHFHIED 65

Query: 65 LTNRLFAEE 73
           + RLF ++
Sbjct: 66 -SPRLFEDD 73

>CAGL0L01177g complement(134729..136126) highly similar to
          sp|P32614 Saccharomyces cerevisiae YEL047c FRDS1
          soluble fumarate reductase, hypothetical start
          Length = 465

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 8  VVVGAGIAGLKAASVLTQSGKS-CLVIESRDRIGGRLCTV-TGYNGA 52
          V+VG G+AGL  A+ L + GKS  ++++    IGG      +G NGA
Sbjct: 4  VIVGTGLAGLTCANQLLELGKSPVILLDKTGTIGGNSTKASSGINGA 50

>YMR299C (YMR299C) [4253] chr13 complement(864411..865349) Protein
           of unknown function [939 bp, 312 aa]
          Length = 312

 Score = 30.0 bits (66), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 22/48 (45%), Gaps = 3/48 (6%)

Query: 505 LRNVIVTDWTND---PYSKGAYSACYAGDDALDMFLAMSNGQSSRVRF 549
           L N     WTND    YS   Y+     DDALD+        SS+VR+
Sbjct: 58  LINYATIGWTNDLKENYSVDVYTLIRNTDDALDLLKPFLQEHSSKVRW 105

>YPL017C (YPL017C) [5420] chr16 complement(518730..520229) Member
          of the pyridine nucleotide-disulfide oxidoreductase
          family, contains a pyridine nucleotide-disulfide
          oxidoreductase dimerization domain, has moderate
          similarity to dihydrolipoamide dehydrogenase (S.
          cerevisiae Lpd1p) [1500 bp, 499 aa]
          Length = 499

 Score = 30.4 bits (67), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%)

Query: 4  TYDVVVVGAGIAGLKAASVLTQSGKSCLVIESRDRIGG 41
           YDV+V+G G  G  AA   +Q+G     ++ R  +GG
Sbjct: 17 VYDVLVIGCGPGGFTAAMQASQAGLLTACVDQRASLGG 54

>KLLA0E14806g 1322461..1323663 similar to ca|CA0218|IPF15294
          Candida albicans unknown function, hypothetical start
          Length = 400

 Score = 30.0 bits (66), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 5  YDVVVVGAGIAGLKAASVLTQ-SGKSCLVIESRDRIG 40
          Y   V+GAG+ GL  A+ LT+  G   +V+E   +IG
Sbjct: 27 YSHAVIGAGVVGLAIANELTKVPGNKVIVLEKNAKIG 63

>CAGL0I01320g complement(107768..109270) similar to sp|P21375
           Saccharomyces cerevisiae YJR051w OSM1 osmotic growth
           protein, start by similarity
          Length = 500

 Score = 30.0 bits (66), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 43/84 (51%), Gaps = 4/84 (4%)

Query: 7   VVVVGAGIAGLKAASVLTQSGK-SCLVIESRDRIGGR-LCTVTGYNGARYDLGASWHHDT 64
           VVV+G G+AGL  ++ L  + K   ++I+    IGG  +   +G NGA     A+ +   
Sbjct: 37  VVVIGTGLAGLTTSNQLAHTYKIPVVLIDKASSIGGNSIKASSGINGAGTTTQANLNVKD 96

Query: 65  LTNRLFAEEVQLAAVDGADSTPQM 88
            +  LF E+  +++  G  S P M
Sbjct: 97  -SPELFLEDT-ISSAKGKGSRPLM 118

>Scas_589.13
          Length = 1311

 Score = 29.6 bits (65), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 32/74 (43%), Gaps = 11/74 (14%)

Query: 116 VYAPFVFDDDDPLIVDKIR-----------GSLGDVTIRLIADEIEKFIELYFHSEYTAE 164
           + +PFV   D P I++ IR           G  G V I+    EI K++       YT E
Sbjct: 592 IESPFVITLDLPHILNNIRLSEISNHENLKGLSGAVQIKDSPVEIFKYLARELEFSYTEE 651

Query: 165 LSDDNDSQHSHEGF 178
              D D + + +GF
Sbjct: 652 KLSDKDMESTFDGF 665

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.135    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,636,658
Number of extensions: 647289
Number of successful extensions: 1562
Number of sequences better than 10.0: 62
Number of HSP's gapped: 1554
Number of HSP's successfully gapped: 72
Length of query: 572
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 465
Effective length of database: 12,891,983
Effective search space: 5994772095
Effective search space used: 5994772095
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)