Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M07590g45644920880.0
Kwal_26.82193914053841e-41
YMR021C (MAC1)4171643377e-35
ABR058C3501753277e-34
Sklu_2411.83821653164e-32
Scas_576.54071673016e-30
KLLA0E07733g4691782843e-27
Scas_668.16291381208e-07
YGL166W (CUP2)225381045e-05
AEL295C544381066e-05
Scas_710.11743381068e-05
YPR008W (HAA1)694381059e-05
KLLA0A03047g567381051e-04
Kwal_14.1543599381041e-04
CAGL0L09339g877381032e-04
CAGL0I04180g26564920.002
Kwal_33.151486022650.60
Kwal_33.13360140863711.4
Kwal_47.1781999499692.3
AAL161W6456603.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M07590g
         (449 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M07590g 758940..760310 weakly similar to sp|P35192 Saccharo...   808   0.0  
Kwal_26.8219                                                          152   1e-41
YMR021C (MAC1) [3985] chr13 complement(317164..318417) Transcrip...   134   7e-35
ABR058C [649] [Homologous to ScYMR021C (MAC1) - SH] (501771..502...   130   7e-34
Sklu_2411.8 YMR021C, Contig c2411 15729-16877                         126   4e-32
Scas_576.5                                                            120   6e-30
KLLA0E07733g 694992..696401 weakly similar to sp|P35192 Saccharo...   114   3e-27
Scas_668.16                                                            51   8e-07
YGL166W (CUP2) [1824] chr7 (191133..191810) Copper-dependent tra...    45   5e-05
AEL295C [2210] [Homologous to ScYPR008W (HAA1) - SH; ScYGL166W (...    45   6e-05
Scas_710.11                                                            45   8e-05
YPR008W (HAA1) [5444] chr16 (573013..575097) Nuclear protein tha...    45   9e-05
KLLA0A03047g 269553..271256 some similarities with sp|Q12753 Sac...    45   1e-04
Kwal_14.1543                                                           45   1e-04
CAGL0L09339g 1012259..1014892 some similarities with sp|Q12753 S...    44   2e-04
CAGL0I04180g 367258..368055 sp|P41772 Candida glabrata metal-act...    40   0.002
Kwal_33.15148                                                          30   0.60 
Kwal_33.13360                                                          32   1.4  
Kwal_47.17819                                                          31   2.3  
AAL161W [26] [Homologous to ScYLL009C (COX17) - SH] complement(6...    28   3.5  

>CAGL0M07590g 758940..760310 weakly similar to sp|P35192
           Saccharomyces cerevisiae YMR021c metal binding
           activator, start by similarity
          Length = 456

 Score =  808 bits (2088), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/449 (88%), Positives = 397/449 (88%)

Query: 1   MIIFKNDKYACVKCIRGHRSSLCVHTGRMLVKVRNRGRKKGIDVRDAIVVGDIHRKRSCE 60
           MIIFKNDKYACVKCIRGHRSSLCVHTGRMLVKVRNRGRKKGIDVRDAIVVGDIHRKRSCE
Sbjct: 1   MIIFKNDKYACVKCIRGHRSSLCVHTGRMLVKVRNRGRKKGIDVRDAIVVGDIHRKRSCE 60

Query: 61  CASGHAGDDSKQYGAPNADVSRPHESGLNSTCVGMNKQPILFVRAKKVLKAQLIGGELKE 120
           CASGHAGDDSKQYGAPNADVSRPHESGLNSTCVGMNKQPILFVRAKKVLKAQLIGGELKE
Sbjct: 61  CASGHAGDDSKQYGAPNADVSRPHESGLNSTCVGMNKQPILFVRAKKVLKAQLIGGELKE 120

Query: 121 MSEVDMSRLEXXXXXXXXXXXXXXXPKVEILDNNVLNVTQGNIDDDMVLVDDTKNFAGAS 180
           MSEVDMSRLE               PKVEILDNNVLNVTQGNIDDDMVLVDDTKNFAGAS
Sbjct: 121 MSEVDMSRLEVDTSDDETVATTTTVPKVEILDNNVLNVTQGNIDDDMVLVDDTKNFAGAS 180

Query: 181 IGELIDEQLSSINVEPTGSHCCGSQPHGIDPMKXXXXXXXXXXXXKYPFFQLLTKRGVYL 240
           IGELIDEQLSSINVEPTGSHCCGSQPHGIDPMK            KYPFFQLLTKRGVYL
Sbjct: 181 IGELIDEQLSSINVEPTGSHCCGSQPHGIDPMKTTTVTAAATETEKYPFFQLLTKRGVYL 240

Query: 241 STQXXXXXXXXXXXXXLIHRTEEEINNYIEASGVPLTNLDSSTSLQATPEIESPRPSCMC 300
           STQ             LIHRTEEEINNYIEASGVPLTNLDSSTSLQATPEIESPRPSCMC
Sbjct: 241 STQCSCSAANCACSNCLIHRTEEEINNYIEASGVPLTNLDSSTSLQATPEIESPRPSCMC 300

Query: 301 KPEECTCDGCDIHTIEVVPFQRIVIHGLINTRLTKKTLIQYRKKLIGQKYWWDYCMVYIP 360
           KPEECTCDGCDIHTIEVVPFQRIVIHGLINTRLTKKTLIQYRKKLIGQKYWWDYCMVYIP
Sbjct: 301 KPEECTCDGCDIHTIEVVPFQRIVIHGLINTRLTKKTLIQYRKKLIGQKYWWDYCMVYIP 360

Query: 361 CLRCNNFDGLDIVGFFDNIIKEHGHELEDAKEKVDAGSIQNLTSQAENFIMNMNNSIDNG 420
           CLRCNNFDGLDIVGFFDNIIKEHGHELEDAKEKVDAGSIQNLTSQAENFIMNMNNSIDNG
Sbjct: 361 CLRCNNFDGLDIVGFFDNIIKEHGHELEDAKEKVDAGSIQNLTSQAENFIMNMNNSIDNG 420

Query: 421 VSSXXXXXXXXXXXXRLQSHYANLVKTEG 449
           VSS            RLQSHYANLVKTEG
Sbjct: 421 VSSNTTNNMNNINDTRLQSHYANLVKTEG 449

>Kwal_26.8219
          Length = 391

 Score =  152 bits (384), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 123/405 (30%), Positives = 181/405 (44%), Gaps = 51/405 (12%)

Query: 1   MIIFKNDKYACVKCIRGHRSSLCVHTGRMLVKVRNRGRKKGIDVRDAIVVGDIHRKRSCE 60
           MIIF  +KY+CV CIRGHRSS C H+ RMLVKVR RGR     VR  I+V    +  S  
Sbjct: 1   MIIFDGEKYSCVSCIRGHRSSTCKHSNRMLVKVRTRGRPSAQTVRKVILVDASSQVNS-- 58

Query: 61  CASGHAGDDSKQYGAPNADVSRPHESGLNSTCVGMNKQPILFVRAKKVLKAQLIG----- 115
             S H  +D +      +  +         +C  MNKQPILF+R     KA L+      
Sbjct: 59  --SPHTEEDDQGQSPCCSSSAS-------RSCTKMNKQPILFLRTMSTQKALLVDGALKI 109

Query: 116 ----------GELKEMSEVDMSRLEXXXXXXXXXXXXXXXPKVEILDNNVLNVTQGNI-D 164
                     G+ K +SE D                     K  + + + L    GN+  
Sbjct: 110 MIEDTDPAFHGKYKFVSERDYLLNHLQIPLDDYSQETNGLAKNSVKEPSSL----GNLLQ 165

Query: 165 DDMVLVDDTKNFAGASIGELIDEQLSSINVEPTGSHCCGSQPHGIDPMKXXXXXXXXXXX 224
            D +L ++++      I    +EQ +  +  PTG H    Q   +D              
Sbjct: 166 SDTLLSNESQKHEYPDIK--FEEQ-NRPSFLPTGKHT--EQISTLD-----------SEA 209

Query: 225 XKYPFFQLLTKRGVYLSTQXXXXXXXXXXXXXLIHRTEEEINNYIEASGVPLTNLDSSTS 284
                 +L T +GVYLSTQ             LIHR EEE+ +YI+ SGVPL+ + +   
Sbjct: 210 HNTSMVELFTHKGVYLSTQCSCDEGNCSCVNCLIHRKEEELESYIQQSGVPLSTIGNGRI 269

Query: 285 LQATPEIESPRPSCMCK--PEECTCDGCDIHTIEVVPFQRIVIHGLINTRLTKKTLIQYR 342
               P  +S + + +CK   EEC    C +H  E++    I I+GLIN  + +K++I+++
Sbjct: 270 --TFPIEQSSKDAFVCKYSAEECPIQDCLLHPAEILSLNHIFIYGLINVPIKRKSVIKFK 327

Query: 343 KKLIGQKYWWDYCMVYIPCLRCNNFDGLDIVGFFDNIIKEHGHEL 387
            KLI  K+WW      +P +        DI  +F++II+    E+
Sbjct: 328 HKLIPSKFWWHLLKEELPNMPHEQSASFDIFQWFEHIIETFNAEI 372

>YMR021C (MAC1) [3985] chr13 complement(317164..318417)
           Transcription factor involved in induction of genes
           required for the reduction and utilization of iron and
           copper [1254 bp, 417 aa]
          Length = 417

 Score =  134 bits (337), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 59/164 (35%), Positives = 97/164 (59%), Gaps = 4/164 (2%)

Query: 231 QLLTKRGVYLSTQXXXXXXXXXXXXXLIHRTEEEINNYIEASGVPLTNLDSST----SLQ 286
           ++LT +G++LSTQ             LIHR+EEE+N+YI+ SGVPLTN+  +      + 
Sbjct: 251 EVLTHKGIFLSTQCSCEDESCPCVNCLIHRSEEELNSYIQQSGVPLTNIGEAQITDKMMD 310

Query: 287 ATPEIESPRPSCMCKPEECTCDGCDIHTIEVVPFQRIVIHGLINTRLTKKTLIQYRKKLI 346
              + +     C+C P+ CTCDGC  H+  ++PF++   +G++N RLT+KT I+++ KL+
Sbjct: 311 YLDDCKCTDKECICPPDNCTCDGCFSHSTNIIPFEKFFFYGILNARLTRKTQIKFKGKLV 370

Query: 347 GQKYWWDYCMVYIPCLRCNNFDGLDIVGFFDNIIKEHGHELEDA 390
             KYWWD+  + +P +     + LDI  +F  ++  +   L DA
Sbjct: 371 PSKYWWDFLKLQVPLMTDAQLELLDIHAWFQKLVSNYAPHLSDA 414

 Score = 98.6 bits (244), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 66/123 (53%), Gaps = 22/123 (17%)

Query: 1   MIIFKNDKYACVKCIRGHRSSLCVHTGRMLVKVRNRGRKKGIDVRDAIVVGDIHRKRSCE 60
           MIIF  +KYAC  CIRGHRSS C H+ RML+KVR RGR   + +RDAI+V    +    E
Sbjct: 1   MIIFNGNKYACASCIRGHRSSTCRHSHRMLIKVRTRGRPSPMAIRDAILVDSTSQSTEYE 60

Query: 61  CASGHAGDDSKQYGAPNADVSRPHESGLNSTCVGMNKQPILFVRAKKVLKAQLIGGELKE 120
             +   GD                       C  MN+QPILFVRA  V KA++I G+L  
Sbjct: 61  NGAQIEGD----------------------CCSAMNQQPILFVRASAVRKARMINGKLHI 98

Query: 121 MSE 123
           + E
Sbjct: 99  LME 101

>ABR058C [649] [Homologous to ScYMR021C (MAC1) - SH]
           (501771..502826) [1056 bp, 351 aa]
          Length = 350

 Score =  130 bits (327), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 96/175 (54%), Gaps = 19/175 (10%)

Query: 234 TKRGVYLSTQXXXXXXXXXXXXXLIHRTEEEINNYIEASGVPLTNLD------------- 280
           T +GVYLSTQ             LIHR EEE++ +I  SGVPLT++D             
Sbjct: 164 TYKGVYLSTQCSCDDSACQCANCLIHRKEEELDQFIRQSGVPLTSVDLEDRKPAEAGACC 223

Query: 281 --SSTSLQATPEIESPRPSCMCKPEECTCDGCDIHTIEVVPFQRIVIHGLINTRLTKKTL 338
              ++ L       + R SC C P  C C  C+IH  EVV   R+++HG++NT L +K  
Sbjct: 224 GDRASGLLGYDYAANERTSCACSPVSCMCKDCEIHAEEVVSMNRLLLHGILNTPLKRKMS 283

Query: 339 IQYRKKLIGQKYWWDYCMVYIPC--LRCNNFDGLDIVGFFDNIIKEHGHELEDAK 391
           IQY+ KLI  K+WWD  ++Y+ C   R    + LD++ +FDNII+ HG  L DA+
Sbjct: 284 IQYKGKLINSKFWWD--ILYLQCAVAREPQLEALDLLQWFDNIIETHGAALPDAE 336

 Score = 90.5 bits (223), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 66/123 (53%), Gaps = 19/123 (15%)

Query: 1   MIIFKNDKYACVKCIRGHRSSLCVHTGRMLVKVRNRGRKKGIDVRDAIVVGDIHRKRSCE 60
           MIIF  +KY+C  CIRGHRS+ C H+ RMLVKVR RGR   +D+R  I+V          
Sbjct: 1   MIIFDGEKYSCAACIRGHRSTTCKHSDRMLVKVRTRGRPSPMDIRKVILV---------- 50

Query: 61  CASGHAGDDSKQYGAPNADVSRPHESGLNSTCVGMNKQPILFVRAKKVLKAQLIGGELKE 120
                  D   Q    + D     + G   TC  M++QPILF++A K  KA L+ G LK 
Sbjct: 51  -------DAGSQVPMEDEDTEECCDGG--KTCGKMDRQPILFLKALKTQKALLVDGALKI 101

Query: 121 MSE 123
           M E
Sbjct: 102 MIE 104

>Sklu_2411.8 YMR021C, Contig c2411 15729-16877
          Length = 382

 Score =  126 bits (316), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 93/165 (56%), Gaps = 9/165 (5%)

Query: 229 FFQLLTKRGVYLSTQXXXXXXXXXXXXXLIHRTEEEINNYIEASGVPLTNLDSSTSL--- 285
             +LLT +GVYLSTQ             LIHR EEE+N YI  SG+PLTNL +       
Sbjct: 195 MVELLTHKGVYLSTQCSCEDDNCQCDNCLIHRKEEELNKYIRQSGIPLTNLGNGRVTDDE 254

Query: 286 --QATPEIE----SPRPSCMCKPEECTCDGCDIHTIEVVPFQRIVIHGLINTRLTKKTLI 339
                  I+    S    C C P++C C  C  H  E++    +++HG++NT+L +KT+I
Sbjct: 255 NGHGNGSIKTISCSTESVCRCPPQDCICPHCLDHPGEIISMSNLLLHGVLNTQLKRKTII 314

Query: 340 QYRKKLIGQKYWWDYCMVYIPCLRCNNFDGLDIVGFFDNIIKEHG 384
           +YR KLI  KYWWD+  + IP +     + LD++ +FD+I++ +G
Sbjct: 315 KYRNKLIPSKYWWDFIKLQIPLMSRRQLESLDLLRWFDSIVEAYG 359

 Score = 97.8 bits (242), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 61/128 (47%), Positives = 70/128 (54%), Gaps = 22/128 (17%)

Query: 1   MIIFKNDKYACVKCIRGHRSSLCVHTGRMLVKVRNRGRKKGIDVRDAIVVGDIHRKRSCE 60
           MIIF  DKY+CV CIRGHRSS C H+ RMLVKVR RGR   +DVR  I+V          
Sbjct: 1   MIIFDGDKYSCVACIRGHRSSTCKHSDRMLVKVRTRGRPSPMDVRKVIMV---------- 50

Query: 61  CASGHAGDDSKQYGAP--NADVSRP--HESGLNS-TCVGMNKQPILFVRAKKVLKAQLIG 115
                  D   Q   P    + S P    S  NS +C  MNKQPILF+RA +  KA L+ 
Sbjct: 51  -------DTDSQVEPPVHTPEDSNPCCQRSNANSKSCNKMNKQPILFLRAMRTQKALLVD 103

Query: 116 GELKEMSE 123
           G LK M E
Sbjct: 104 GMLKIMVE 111

>Scas_576.5
          Length = 407

 Score =  120 bits (301), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 96/167 (57%), Gaps = 2/167 (1%)

Query: 226 KYPFFQLLTKRGVYLSTQXXXXXXXXXXXXXLIHRTEEEINNYIEASGVPLTNLDSSTSL 285
           K P   L T +GVYLS+              LIHR E+E+N+YI  SG+PLTN+  +   
Sbjct: 230 KTPLVDLFTHKGVYLSSACSCEDGNCPCLNCLIHRNEDELNSYIRQSGIPLTNVGEAE-- 287

Query: 286 QATPEIESPRPSCMCKPEECTCDGCDIHTIEVVPFQRIVIHGLINTRLTKKTLIQYRKKL 345
                +E    +C C   +C C  C +H  E++   +I+++GL++  L +KT+I+++ KL
Sbjct: 288 YKNELMECTTSNCACTAVDCLCQDCIVHPTEIISIDKILLNGLLHMTLRRKTVIKFKNKL 347

Query: 346 IGQKYWWDYCMVYIPCLRCNNFDGLDIVGFFDNIIKEHGHELEDAKE 392
           I  +YWWD+ +     L+  + + +DI+G+FD++I ++  EL DA +
Sbjct: 348 IPSQYWWDFLIGKTVKLQEGDLESIDIIGWFDSLINKYPMELLDASD 394

 Score = 96.7 bits (239), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 55/126 (43%), Positives = 70/126 (55%), Gaps = 25/126 (19%)

Query: 1   MIIFKNDKYACVKCIRGHRSSLCVHTGRMLVKVRNRGRKKGIDVRDAIVVGDIHR---KR 57
           MII+ ++KYAC  CIRGHRSS C HT RMLVKVR RGR    ++RD I+V    R   K 
Sbjct: 1   MIIYASEKYACASCIRGHRSSTCKHTNRMLVKVRTRGRPSPTEIRDVIMVDSSSRIDAKS 60

Query: 58  SCECASGHA----GDDSKQYGAPNADVSRPHESGLNSTCVGMNKQPILFVRAKKVLKAQL 113
           SC  ++  +    GDDS                  NS    M +QP+LFVR K   KA+L
Sbjct: 61  SCHSSNHQSKLAEGDDS------------------NSCSQNMERQPVLFVRVKDSKKARL 102

Query: 114 IGGELK 119
           + G+L+
Sbjct: 103 LNGKLQ 108

>KLLA0E07733g 694992..696401 weakly similar to sp|P35192
           Saccharomyces cerevisiae YMR021c MAC1 metal binding
           activator singleton, start by similarity
          Length = 469

 Score =  114 bits (284), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 60/178 (33%), Positives = 87/178 (48%), Gaps = 15/178 (8%)

Query: 231 QLLTKRGVYLSTQXXXXXXXXXXXXXLIHRTEEEINNYIEASGVPLTNLDSSTSLQATPE 290
           +L T+ G YLST              LIHR E E+  Y+     P+ NL S+  L A   
Sbjct: 209 ELFTQNGAYLST-TCSCNENCQCNNCLIHREEAELERYLTELNQPMINLGSAQILTADSS 267

Query: 291 IESPRPS--------------CMCKPEECTCDGCDIHTIEVVPFQRIVIHGLINTRLTKK 336
              P                 C+C+P+ CTC  C+ H  EVV    ++++G++N +  KK
Sbjct: 268 QVEPSKDFFHGETDDQNMSTLCLCEPDFCTCFNCEAHPDEVVTLSELLLYGVLNYKWKKK 327

Query: 337 TLIQYRKKLIGQKYWWDYCMVYIPCLRCNNFDGLDIVGFFDNIIKEHGHELEDAKEKV 394
            +I+YR K+I  KYWW Y  V IP +       LD++ +FDN+I  H  EL +A + V
Sbjct: 328 MVIKYRNKVIHSKYWWHYLTVEIPSMNEKQLRSLDLMEWFDNLISSHSAELPEANDLV 385

 Score =  101 bits (251), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 58/124 (46%), Positives = 70/124 (56%), Gaps = 23/124 (18%)

Query: 1   MIIFKNDKYACVKCIRGHRSSLCVHTGRMLVKVRNRGRKKGIDVRDAIVVGDIHRKRSCE 60
           MIIF  +KY+CV CIRGHRSS C H+ RMLVKVR RGR   +D+R  I+V    R    +
Sbjct: 1   MIIFNGEKYSCVSCIRGHRSSSCKHSERMLVKVRTRGRPSPLDIRKVILVDRASRVEEVD 60

Query: 61  CASGH---AGDDSKQYGAPNADVSRPHESGLNSTCVGMNKQPILFVRAKKVLKAQLIGGE 117
             SG    AGD+S+                    C GMNKQP+LF+RA    KA LI G+
Sbjct: 61  -GSGQDNGAGDESQ-------------------LCCGMNKQPVLFLRAIATKKALLINGD 100

Query: 118 LKEM 121
           LK M
Sbjct: 101 LKIM 104

>Scas_668.16
          Length = 291

 Score = 50.8 bits (120), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 26/38 (68%)

Query: 1  MIIFKNDKYACVKCIRGHRSSLCVHTGRMLVKVRNRGR 38
          MI+   +KYAC  CIRGHRSS C H  R L K++ +GR
Sbjct: 1  MIMLNGEKYACDLCIRGHRSSSCNHRDRQLTKLKPKGR 38

>YGL166W (CUP2) [1824] chr7 (191133..191810) Copper-dependent
          transcription factor responsible for induction of
          CUP1A, CUP1B, CRS5, and SOD1 [678 bp, 225 aa]
          Length = 225

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 24/38 (63%)

Query: 1  MIIFKNDKYACVKCIRGHRSSLCVHTGRMLVKVRNRGR 38
          M++    KYAC  CIRGHR++ C HT   L  +R +GR
Sbjct: 1  MVVINGVKYACETCIRGHRAAQCTHTDGPLQMIRRKGR 38

>AEL295C [2210] [Homologous to ScYPR008W (HAA1) - SH; ScYGL166W
          (CUP2) - SH] (88054..89688) [1635 bp, 544 aa]
          Length = 544

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 26/38 (68%)

Query: 1  MIIFKNDKYACVKCIRGHRSSLCVHTGRMLVKVRNRGR 38
          M++    KYAC +CIRGHR + C HT + L+ ++ +GR
Sbjct: 1  MVLLNGVKYACERCIRGHRVTTCNHTDQPLMMIKPKGR 38

>Scas_710.11
          Length = 743

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 26/38 (68%)

Query: 1  MIIFKNDKYACVKCIRGHRSSLCVHTGRMLVKVRNRGR 38
          M++    KYAC +CIRGHR + C HT + L+ ++ +GR
Sbjct: 1  MVLINGVKYACERCIRGHRVTTCNHTDQPLMMIKPKGR 38

>YPR008W (HAA1) [5444] chr16 (573013..575097) Nuclear protein that
          activates transcription of several genes including TPO2
          and YRO2, has homology to the copper-activated
          transcription factor Ace1p [2085 bp, 694 aa]
          Length = 694

 Score = 45.1 bits (105), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 26/38 (68%)

Query: 1  MIIFKNDKYACVKCIRGHRSSLCVHTGRMLVKVRNRGR 38
          M++    KYAC +CIRGHR + C HT + L+ ++ +GR
Sbjct: 1  MVLINGIKYACERCIRGHRVTTCNHTDQPLMMIKPKGR 38

>KLLA0A03047g 269553..271256 some similarities with sp|Q12753
          Saccharomyces cerevisiae YPR008w, hypothetical start
          Length = 567

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 1  MIIFKNDKYACVKCIRGHRSSLCVHTGRMLVKVRNRGR 38
          M++    KYAC +CIRGHR + C HT + L  ++ +GR
Sbjct: 1  MVLINGVKYACERCIRGHRVTTCNHTDQPLTMIKPKGR 38

>Kwal_14.1543
          Length = 599

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 26/38 (68%)

Query: 1  MIIFKNDKYACVKCIRGHRSSLCVHTGRMLVKVRNRGR 38
          M++    KYAC +CIRGHR + C HT + L+ ++ +GR
Sbjct: 1  MVLVNGIKYACERCIRGHRVTTCNHTDQPLMMIKPKGR 38

>CAGL0L09339g 1012259..1014892 some similarities with sp|Q12753
          Saccharomyces cerevisiae YPR008w, hypothetical start
          Length = 877

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 26/38 (68%)

Query: 1  MIIFKNDKYACVKCIRGHRSSLCVHTGRMLVKVRNRGR 38
          M++    KYAC +CIRGHR + C H+ + L+ ++ +GR
Sbjct: 1  MVLINGVKYACERCIRGHRVTTCNHSDQPLMMIKPKGR 38

>CAGL0I04180g 367258..368055 sp|P41772 Candida glabrata
          metal-activated transcriptional activator, identified
          start
          Length = 265

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 2/64 (3%)

Query: 1  MIIFKNDKYACVKCIRGHRSSLCVHTGRMLVKVRNRGRKKGI--DVRDAIVVGDIHRKRS 58
          M++    KYAC  CI+ H+++ C H  R L  ++ RGR        +D     +++   S
Sbjct: 1  MVVINGVKYACDSCIKSHKAAQCEHNDRPLKILKPRGRPPTTCDHCKDMRKTKNVNPSGS 60

Query: 59 CECA 62
          C C+
Sbjct: 61 CNCS 64

>Kwal_33.15148
          Length = 60

 Score = 29.6 bits (65), Expect = 0.60,   Method: Composition-based stats.
 Identities = 10/22 (45%), Positives = 15/22 (68%)

Query: 289 PEIESPRPSCMCKPEECTCDGC 310
           P+ + P+P C+CKPE+   D C
Sbjct: 10  PQEDKPKPCCVCKPEKEARDTC 31

>Kwal_33.13360
          Length = 1408

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%)

Query: 308 DGCDIHTIEV--VPFQRIVIHGLINTRLTKKTLIQYRKKLIGQKYWWDYCMVYIPCLRCN 365
           +G DI  IEV  +P   I    ++NT L  + ++ +  K  G   +  YC++++P L  +
Sbjct: 398 EGRDIIPIEVYTLPSPDIDEKTVLNTTLVSQEILDFYSKEFGSYSFTSYCLLFLPSLPED 457

Query: 366 NFD 368
             D
Sbjct: 458 TMD 460

>Kwal_47.17819
          Length = 994

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 47/99 (47%), Gaps = 17/99 (17%)

Query: 307 CDGCDIHTI-EVVPFQRIVIHGLINTRLTKKTLIQYRKKLIGQKYWWDYCMVYIPCLRCN 365
            DG D     +V+P Q      L N  L ++ LI Y   +I +K   +Y  V+   L  +
Sbjct: 83  ADGADAELFKDVLPEQ-----DLANVNLNQRKLIFY---VISEK---NYIFVFQILLSTS 131

Query: 366 NFD-----GLDIVGFFDNIIKEHGHELEDAKEKVDAGSI 399
             D     G+ I+G  +N+ +++G EL D  E+ D  ++
Sbjct: 132 PLDIFKETGIPIIGVRENVDQDYGQELMDNNEESDCLTV 170

>AAL161W [26] [Homologous to ScYLL009C (COX17) - SH]
           complement(64596..64790) [195 bp, 64 aa]
          Length = 64

 Score = 27.7 bits (60), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 9/56 (16%)

Query: 270 EASGVPLTNLDSSTSLQATPEIESPRPSCMCKPEECTCDGCDIHT-IEVVPFQRIV 324
           E+S VP  +  SST        + P+P C+CKPE+   D C +   ++ V  Q +V
Sbjct: 3   ESSSVPGVSQGSST--------DKPKPCCVCKPEKEARDSCLLFNGVDAVKCQELV 50

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.136    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,195,335
Number of extensions: 535321
Number of successful extensions: 1281
Number of sequences better than 10.0: 22
Number of HSP's gapped: 1270
Number of HSP's successfully gapped: 28
Length of query: 449
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 344
Effective length of database: 12,961,219
Effective search space: 4458659336
Effective search space used: 4458659336
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)