Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M07568g1651638581e-120
YMR022W (QRI8)1651638101e-112
Kwal_26.82241651637971e-110
Scas_709.491651637801e-108
ABR059W1651637551e-104
Sklu_2411.72331637611e-104
KLLA0E07711g1651637061e-96
CAGL0I00352g1671623458e-42
Scas_635.182731623531e-41
Kwal_27.104442781563504e-41
YDR054C (CDC34)2951623514e-41
CAGL0E04598g2951653514e-41
YGL058W (RAD6)1721623405e-41
KLLA0C05632g1641623397e-41
AGL203C2701563477e-41
AAR156C1701623397e-41
Sklu_2136.52721623461e-40
KLLA0D09196g2921623462e-40
Scas_563.81711623362e-40
Scas_718.342581643344e-39
AER173C1471503055e-36
Sklu_2299.51541453057e-36
KLLA0E12595g1481533041e-35
CAGL0E04752g1471523021e-35
Kwal_14.18281521453022e-35
Scas_635.14*1481532961e-34
YBR082C (UBC4)1481532919e-34
YDR059C (UBC5)1481532883e-33
Kwal_27.124012361402831e-31
YOR339C (UBC11)1561492752e-31
CAGL0D00814g1571592423e-26
CAGL0G08063g1491502403e-26
YDL064W (UBC9)1571612396e-26
Sklu_2410.41611522398e-26
Scas_636.15*1531432371e-25
YDR092W (UBC13)1531252335e-25
AER056C1571592327e-25
KLLA0C17622g1591252311e-24
AGR121C1541252292e-24
KLLA0E04983g1571652274e-24
Kwal_26.70091611522275e-24
AFR314W1551562257e-24
Sklu_1838.21631212199e-23
Kwal_56.234821491212135e-22
Kwal_27.108372461362117e-21
Kwal_23.42271221232011e-20
AGR372W2421292072e-20
YER100W (UBC6)2501372064e-20
CAGL0I05478g2461372047e-20
Sklu_1826.31611381953e-19
Sklu_2425.62511371961e-18
ADR169C2111521931e-18
KLLA0E20493g2511341933e-18
Scas_609.72401371915e-18
CAGL0E00671g2131521871e-17
YDR177W (UBC1)2151521871e-17
Kwal_55.212461601501771e-16
Scas_599.162241291811e-16
CAGL0D06468g1871561782e-16
Sklu_1817.22151521783e-16
Scas_682.102141521748e-16
Kwal_23.64852151491749e-16
YGR133W (PEX4)1831511721e-15
Scas_621.41931201651e-14
Scas_551.9153931586e-14
YLR306W (UBC12)1881611598e-14
CAGL0M03399g2141641601e-13
Kwal_34.161742131271573e-13
KLLA0C18656g2281251549e-13
KLLA0A11198g2021641512e-12
YEL012W (UBC8)2181211494e-12
AEL045W2111331484e-12
Scas_712.591711221449e-12
Scas_694.332311231461e-11
KLLA0E03916g1581371385e-11
CAGL0I10450g1621531386e-11
KLLA0C17248g1841111371e-10
ADL035C2001171204e-08
YGL087C (MMS2)137134963e-05
AFL064W138105922e-04
KLLA0E19217g139136860.001
CAGL0H03157g139135850.001
Scas_720.10*134127800.005
Kwal_27.1118210197760.012
YDR403W (DIT1)53636604.7
CAGL0M05643g17681587.3
CAGL0G06182g68155588.2
Kwal_27.968139638589.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M07568g
         (163 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M07568g complement(758110..758607) highly similar to sp|Q02...   335   e-120
YMR022W (QRI8) [3986] chr13 (318679..319176) Ubiquitin-conjugati...   316   e-112
Kwal_26.8224                                                          311   e-110
Scas_709.49                                                           305   e-108
ABR059W [650] [Homologous to ScYMR022W (QRI8) - SH] complement(5...   295   e-104
Sklu_2411.7 YMR022W, Contig c2411 14633-15334 reverse complement      297   e-104
KLLA0E07711g complement(693694..694191) highly similar to sp|Q02...   276   1e-96
CAGL0I00352g 26900..27403 highly similar to sp|P06104 Saccharomy...   137   8e-42
Scas_635.18                                                           140   1e-41
Kwal_27.10444                                                         139   4e-41
YDR054C (CDC34) [905] chr4 complement(561436..562323) Ubiquitin-...   139   4e-41
CAGL0E04598g complement(444288..445175) highly similar to sp|P14...   139   4e-41
YGL058W (RAD6) [1921] chr7 (393990..394508) Ubiquitin conjugatin...   135   5e-41
KLLA0C05632g complement(503484..503978) highly similar to sp|P06...   135   7e-41
AGL203C [4109] [Homologous to ScYDR054C (CDC34) - SH] (317749..3...   138   7e-41
AAR156C [344] [Homologous to ScYGL058W (RAD6) - SH] (626372..626...   135   7e-41
Sklu_2136.5 YDR054C, Contig c2136 7737-8555                           137   1e-40
KLLA0D09196g 772795..773673 similar to sp|P14682 Saccharomyces c...   137   2e-40
Scas_563.8                                                            134   2e-40
Scas_718.34                                                           133   4e-39
AER173C [2676] [Homologous to ScYBR082C (UBC4) - SH; ScYDR059C (...   122   5e-36
Sklu_2299.5 YGL058W, Contig c2299 10055-10519 reverse complement      122   7e-36
KLLA0E12595g join(1117022..1117068,1117342..1117741) highly simi...   121   1e-35
CAGL0E04752g complement(455965..456408) highly similar to sp|P15...   120   1e-35
Kwal_14.1828                                                          120   2e-35
Scas_635.14*                                                          118   1e-34
YBR082C (UBC4) [271] chr2 complement(406585..406984,407080..4071...   116   9e-34
YDR059C (UBC5) [910] chr4 complement(569230..569629,569720..5697...   115   3e-33
Kwal_27.12401                                                         113   1e-31
YOR339C (UBC11) [5118] chr15 complement(958357..958827) Protein ...   110   2e-31
CAGL0D00814g 98589..99062 highly similar to sp|P50623 Saccharomy...    98   3e-26
CAGL0G08063g 761662..762111 highly similar to sp|P52490 Saccharo...    97   3e-26
YDL064W (UBC9) [802] chr4 (337487..337524,337635..338070) Smt3p-...    97   6e-26
Sklu_2410.4 YOR339C, Contig c2410 15549-16034                          97   8e-26
Scas_636.15*                                                           96   1e-25
YDR092W (UBC13) [944] chr4 (629870..629899,630168..630599) Ubiqu...    94   5e-25
AER056C [2561] [Homologous to ScYDL064W (UBC9) - SH] (741224..74...    94   7e-25
KLLA0C17622g join(1555873..1555902,1556004..1556453) highly simi...    94   1e-24
AGR121C [4432] [Homologous to ScYDR092W (UBC13) - SH] (977487..9...    93   2e-24
KLLA0E04983g 443446..443919 highly similar to sp|P50623 Saccharo...    92   4e-24
Kwal_26.7009                                                           92   5e-24
AFR314W [3506] [Homologous to ScYGR133W (PEX4) - SH] complement(...    91   7e-24
Sklu_1838.2 YDR092W, Contig c1838 1546-2037 reverse complement         89   9e-23
Kwal_56.23482                                                          87   5e-22
Kwal_27.10837                                                          86   7e-21
Kwal_23.4227                                                           82   1e-20
AGR372W [4683] [Homologous to ScYER100W (UBC6) - SH] complement(...    84   2e-20
YER100W (UBC6) [1532] chr5 (359558..360310) Ubiquitin-conjugatin...    84   4e-20
CAGL0I05478g complement(518933..519673) highly similar to sp|P33...    83   7e-20
Sklu_1826.3 YGR133W, Contig c1826 3548-4033                            80   3e-19
Sklu_2425.6 YER100W, Contig c2425 8506-9261 reverse complement         80   1e-18
ADR169C [1911] [Homologous to ScYDR177W (UBC1) - NSH] (1000736.....    79   1e-18
KLLA0E20493g 1814618..1815373 similar to sp|P33296 Saccharomyces...    79   3e-18
Scas_609.7                                                             78   5e-18
CAGL0E00671g complement(61460..62101) highly similar to sp|P2173...    77   1e-17
YDR177W (UBC1) [1019] chr4 (816872..817519) Ubiquitin conjugatin...    77   1e-17
Kwal_55.21246                                                          73   1e-16
Scas_599.16                                                            74   1e-16
CAGL0D06468g 615364..615927 similar to sp|P52491 Saccharomyces c...    73   2e-16
Sklu_1817.2 YDR177W, Contig c1817 904-1551 reverse complement          73   3e-16
Scas_682.10                                                            72   8e-16
Kwal_23.6485                                                           72   9e-16
YGR133W (PEX4) [2090] chr7 (756899..757450) Ubiquitin-conjugatin...    71   1e-15
Scas_621.4                                                             68   1e-14
Scas_551.9                                                             65   6e-14
YLR306W (UBC12) [3694] chr12 (744153..744155,744290..744853) Rub...    66   8e-14
CAGL0M03399g complement(389650..390294) highly similar to sp|P28...    66   1e-13
Kwal_34.16174                                                          65   3e-13
KLLA0C18656g 1654787..1655473 similar to sp|P21734 Saccharomyces...    64   9e-13
KLLA0A11198g join(complement(974525..974529),complement(973755.....    63   2e-12
YEL012W (UBC8) [1413] chr5 (131772..131776,131900..132551) Ubiqu...    62   4e-12
AEL045W [2461] [Homologous to ScYEL012W (UBC8) - SH] complement(...    62   4e-12
Scas_712.59                                                            60   9e-12
Scas_694.33                                                            61   1e-11
KLLA0E03916g complement(365119..365595) similar to sp|P29340 Sac...    58   5e-11
CAGL0I10450g complement(1024541..1025029) similar to sp|P29340 S...    58   6e-11
KLLA0C17248g complement(1509885..1510439) similar to sp|P52491 S...    57   1e-10
ADL035C [1707] [Homologous to ScYLR306W (UBC12) - SH] (634059..6...    51   4e-08
YGL087C (MMS2) [1895] chr7 complement(346407..346809,346895..346...    42   3e-05
AFL064W [3129] [Homologous to ScYGL087C (MMS2) - SH] complement(...    40   2e-04
KLLA0E19217g join(complement(1703226..1703236), highly similar t...    38   0.001
CAGL0H03157g join(complement(297881..297891),complement(297272.....    37   0.001
Scas_720.10*                                                           35   0.005
Kwal_27.11182                                                          34   0.012
YDR403W (DIT1) [1229] chr4 (1274590..1276200) First enzyme in th...    28   4.7  
CAGL0M05643g 603919..604449 similar to sp|Q07540 Saccharomyces c...    27   7.3  
CAGL0G06182g 589050..591095 similar to sp|P38835 Saccharomyces c...    27   8.2  
Kwal_27.9681                                                           27   9.9  

>CAGL0M07568g complement(758110..758607) highly similar to sp|Q02159
           Saccharomyces cerevisiae YMR022w E2
           ubiquitin-conjugation enzyme, start by similarity
          Length = 165

 Score =  335 bits (858), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 163/163 (100%), Positives = 163/163 (100%)

Query: 1   MSKTAQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEF 60
           MSKTAQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEF
Sbjct: 1   MSKTAQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEF 60

Query: 61  PKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKIL 120
           PKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKIL
Sbjct: 61  PKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKIL 120

Query: 121 LSVMSMLSEPNIESGANIDACILWRDNRAEFEKQVKLSILKSL 163
           LSVMSMLSEPNIESGANIDACILWRDNRAEFEKQVKLSILKSL
Sbjct: 121 LSVMSMLSEPNIESGANIDACILWRDNRAEFEKQVKLSILKSL 163

>YMR022W (QRI8) [3986] chr13 (318679..319176) Ubiquitin-conjugating
           enzyme, associates with Ubc6p on the cytoplasmic side of
           endoplasmic reticulum [498 bp, 165 aa]
          Length = 165

 Score =  316 bits (810), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 153/163 (93%), Positives = 159/163 (97%)

Query: 1   MSKTAQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEF 60
           MSKTAQKRL KELQQLIKDSPPGIVAGPKS++N+F+WDCLIQGPPDTPYA GVFNA+LEF
Sbjct: 1   MSKTAQKRLLKELQQLIKDSPPGIVAGPKSENNIFIWDCLIQGPPDTPYADGVFNAKLEF 60

Query: 61  PKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKIL 120
           PKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYE AEERWSPVQSVEKIL
Sbjct: 61  PKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKIL 120

Query: 121 LSVMSMLSEPNIESGANIDACILWRDNRAEFEKQVKLSILKSL 163
           LSVMSMLSEPNIESGANIDACILWRDNR EFE+QVKLSILKSL
Sbjct: 121 LSVMSMLSEPNIESGANIDACILWRDNRPEFERQVKLSILKSL 163

>Kwal_26.8224
          Length = 165

 Score =  311 bits (797), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 156/163 (95%)

Query: 1   MSKTAQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEF 60
           MSKTAQKRL+KELQQL+KDSP GIVAGPKS+DNLFVWDCLI GPPD+PY GGVFNA LEF
Sbjct: 1   MSKTAQKRLFKELQQLLKDSPEGIVAGPKSEDNLFVWDCLISGPPDSPYQGGVFNATLEF 60

Query: 61  PKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKIL 120
           PKDYPLSPPKL FTPSILHPNIYPNGEVCISILHSPGDDPNMYE AEERWSPVQSVEKIL
Sbjct: 61  PKDYPLSPPKLLFTPSILHPNIYPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKIL 120

Query: 121 LSVMSMLSEPNIESGANIDACILWRDNRAEFEKQVKLSILKSL 163
           LSVMSMLSEPN+ESGANIDACILWRDNR EFE+QVKLSILKSL
Sbjct: 121 LSVMSMLSEPNVESGANIDACILWRDNRPEFERQVKLSILKSL 163

>Scas_709.49
          Length = 165

 Score =  305 bits (780), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 143/163 (87%), Positives = 155/163 (95%)

Query: 1   MSKTAQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEF 60
           MSKTAQ+RL KELQQL KDSPPGIVA PK+++NLF+WDCL+QGPPDT Y GG+FNA+LEF
Sbjct: 1   MSKTAQRRLLKELQQLTKDSPPGIVACPKNENNLFIWDCLVQGPPDTAYEGGIFNARLEF 60

Query: 61  PKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKIL 120
           PKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYE AEERWSPVQS+EKIL
Sbjct: 61  PKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYELAEERWSPVQSIEKIL 120

Query: 121 LSVMSMLSEPNIESGANIDACILWRDNRAEFEKQVKLSILKSL 163
           LSVMSMLSEPNIESGANIDACILWRDNR EFE+QV+ S+LKSL
Sbjct: 121 LSVMSMLSEPNIESGANIDACILWRDNREEFERQVRQSVLKSL 163

>ABR059W [650] [Homologous to ScYMR022W (QRI8) - SH]
           complement(503223..503720) [498 bp, 165 aa]
          Length = 165

 Score =  295 bits (755), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 154/163 (94%)

Query: 1   MSKTAQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEF 60
           MSKTAQKRL KELQQL++DSP GIVAGP S+DNLF+WDCLI+GP D+PY GGVFNA+L+F
Sbjct: 1   MSKTAQKRLMKELQQLLRDSPDGIVAGPVSEDNLFLWDCLIEGPADSPYEGGVFNARLQF 60

Query: 61  PKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKIL 120
           P+DYPLSPPKLTFTPSILHPN+YPNGEVCISILH+PG+DPNMYE A ERWSPVQSVEKIL
Sbjct: 61  PRDYPLSPPKLTFTPSILHPNVYPNGEVCISILHAPGEDPNMYEEASERWSPVQSVEKIL 120

Query: 121 LSVMSMLSEPNIESGANIDACILWRDNRAEFEKQVKLSILKSL 163
           LSVMSMLSEPN+ESGANIDACILWRDNRA+FE+QV+ S+ +SL
Sbjct: 121 LSVMSMLSEPNVESGANIDACILWRDNRADFERQVQESVRRSL 163

>Sklu_2411.7 YMR022W, Contig c2411 14633-15334 reverse complement
          Length = 233

 Score =  297 bits (761), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 140/163 (85%), Positives = 151/163 (92%)

Query: 1   MSKTAQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEF 60
           MSKTAQKRL KELQQL +DSP GIVAGPKS+DNLF+WDCLI GPPD+PY GGVFNA LEF
Sbjct: 69  MSKTAQKRLLKELQQLARDSPEGIVAGPKSEDNLFLWDCLITGPPDSPYEGGVFNAMLEF 128

Query: 61  PKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKIL 120
           PKDYPLSPP+LTFTPSILHPNIYPNGEVCISILHSPG+DPNMYE AEERWSPVQSVEKIL
Sbjct: 129 PKDYPLSPPRLTFTPSILHPNIYPNGEVCISILHSPGEDPNMYELAEERWSPVQSVEKIL 188

Query: 121 LSVMSMLSEPNIESGANIDACILWRDNRAEFEKQVKLSILKSL 163
           LSV SMLSEPN+ESGANIDACILWRDNR E+ ++VK  +LKSL
Sbjct: 189 LSVTSMLSEPNVESGANIDACILWRDNRPEYMRRVKRDMLKSL 231

>KLLA0E07711g complement(693694..694191) highly similar to sp|Q02159
           Saccharomyces cerevisiae YMR022w QRI8 E2
           ubiquitin-conjugation enzyme, start by similarity
          Length = 165

 Score =  276 bits (706), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 145/163 (88%)

Query: 1   MSKTAQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEF 60
           MSKTAQKRL KEL++L KDSP GI+A P  D NLF WDCLI GPPD+ Y GGVFNA+L+F
Sbjct: 1   MSKTAQKRLLKELEKLTKDSPEGILASPIDDSNLFQWDCLIMGPPDSCYEGGVFNARLDF 60

Query: 61  PKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKIL 120
           PKDYPL+PPKLTF PSILHPNIYPNGEVCISILHSPG DPNMYE   ERWSPVQSVE IL
Sbjct: 61  PKDYPLNPPKLTFQPSILHPNIYPNGEVCISILHSPGSDPNMYEHECERWSPVQSVEMIL 120

Query: 121 LSVMSMLSEPNIESGANIDACILWRDNRAEFEKQVKLSILKSL 163
           LSVMS+LSEPNIESGANIDACILWRDNR EFE+QVKL++LKSL
Sbjct: 121 LSVMSILSEPNIESGANIDACILWRDNRPEFERQVKLNLLKSL 163

>CAGL0I00352g 26900..27403 highly similar to sp|P06104 Saccharomyces
           cerevisiae YGL058w RAD6 E2 ubiquitin-conjugating, start
           by similarity
          Length = 167

 Score =  137 bits (345), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 101/162 (62%), Gaps = 14/162 (8%)

Query: 1   MSKTAQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEF 60
           MS  A++RL ++ +++ +DSPPG+ A P  D N+ VW+ +I GP DTPY  G F   LEF
Sbjct: 1   MSTPARRRLMRDFKRMKEDSPPGVSASPLPD-NVMVWNAMIIGPADTPYEDGTFRLLLEF 59

Query: 61  PKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKIL 120
            +DYP  PP + F   + HPN+Y NGE+C+ IL             + RW+P   V  IL
Sbjct: 60  DEDYPNKPPHVKFLSEMFHPNVYANGEICLDIL-------------QNRWTPTYDVASIL 106

Query: 121 LSVMSMLSEPNIESGANIDACILWRDNRAEFEKQVKLSILKS 162
            S+ S+ ++PN  S AN++A  L++D+++++ K+VK ++ KS
Sbjct: 107 TSIQSLFNDPNPASPANVEAATLFKDHKSQYIKRVKETVEKS 148

>Scas_635.18
          Length = 273

 Score =  140 bits (353), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 105/162 (64%), Gaps = 4/162 (2%)

Query: 4   TAQKRLYKELQQLI--KDSPPGIVAGPKSDDNLFVWDC-LIQGPPDTPYAGGVFNAQLEF 60
           TA   L ++ ++L   K + P        D NLFVW+  ++    D+ Y GG F AQ+ F
Sbjct: 7   TAASLLLRQYRELTDPKKAIPSFHIELDDDSNLFVWNIGVMVLNEDSIYHGGYFKAQMRF 66

Query: 61  PKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKIL 120
           P+D+P SPP+  FTP+I HPN+Y +G +CISILH  G DP   E   E WSPVQ+VE +L
Sbjct: 67  PEDFPFSPPQFRFTPAIYHPNVYRDGRLCISILHQ-GGDPMTDEPDAETWSPVQTVESVL 125

Query: 121 LSVMSMLSEPNIESGANIDACILWRDNRAEFEKQVKLSILKS 162
           +S++S+L +PNI S AN+DA + +R N  +++++VK+ + +S
Sbjct: 126 ISIVSLLEDPNISSPANVDAAVDYRKNPEQYKQRVKMEVERS 167

>Kwal_27.10444
          Length = 278

 Score =  139 bits (350), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 68/156 (43%), Positives = 100/156 (64%), Gaps = 3/156 (1%)

Query: 8   RLYKELQQLIKDSPPGIVAGPKSDDNLFVWDC-LIQGPPDTPYAGGVFNAQLEFPKDYPL 66
           R Y+EL    K + P        D N+F+W+  ++    D+ Y GG F AQ+ FP+D+P 
Sbjct: 14  RQYRELTD-AKKAIPSFHIELDDDSNIFLWNVGVMVLNEDSIYHGGYFKAQMRFPEDFPF 72

Query: 67  SPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMSM 126
           SPP   FTP+I HPN+Y +G +CISILH+ G DP   E   E WSPVQ+VE +L+S++S+
Sbjct: 73  SPPTFRFTPAIYHPNVYRDGRLCISILHTSG-DPTSEEPDSETWSPVQTVESVLISIVSL 131

Query: 127 LSEPNIESGANIDACILWRDNRAEFEKQVKLSILKS 162
           L +PNI S AN+DA + +R N  ++ ++V L + +S
Sbjct: 132 LEDPNISSPANVDAAVDYRKNADQYRQRVLLEVERS 167

>YDR054C (CDC34) [905] chr4 complement(561436..562323)
           Ubiquitin-conjugating enzyme (E2); component of the SCF
           (Skp1p-Cdc53p-F-box) complexes which act with various
           F-box proteins to direct target proteins into the
           ubiquitin-dependent degradation pathway [888 bp, 295 aa]
          Length = 295

 Score =  139 bits (351), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 68/162 (41%), Positives = 105/162 (64%), Gaps = 4/162 (2%)

Query: 4   TAQKRLYKELQQLI--KDSPPGIVAGPKSDDNLFVWDC-LIQGPPDTPYAGGVFNAQLEF 60
           TA   L ++ ++L   K + P      + D N+F W+  ++    D+ Y GG F AQ+ F
Sbjct: 7   TASSLLLRQYRELTDPKKAIPSFHIELEDDSNIFTWNIGVMVLNEDSIYHGGFFKAQMRF 66

Query: 61  PKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKIL 120
           P+D+P SPP+  FTP+I HPN+Y +G +CISILH  G DP   E   E WSPVQ+VE +L
Sbjct: 67  PEDFPFSPPQFRFTPAIYHPNVYRDGRLCISILHQSG-DPMTDEPDAETWSPVQTVESVL 125

Query: 121 LSVMSMLSEPNIESGANIDACILWRDNRAEFEKQVKLSILKS 162
           +S++S+L +PNI S AN+DA + +R N  +++++VK+ + +S
Sbjct: 126 ISIVSLLEDPNINSPANVDAAVDYRKNPEQYKQRVKMEVERS 167

>CAGL0E04598g complement(444288..445175) highly similar to sp|P14682
           Saccharomyces cerevisiae YDR054c CDC34 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 295

 Score =  139 bits (351), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 69/165 (41%), Positives = 106/165 (64%), Gaps = 4/165 (2%)

Query: 1   MSKTAQKRLYKELQQLI--KDSPPGIVAGPKSDDNLFVWDC-LIQGPPDTPYAGGVFNAQ 57
           +  TA   L ++ ++L   K + P      + D N+FVW+  ++    D+ Y GG F AQ
Sbjct: 4   LKSTAASLLLRQYRELTDPKKAIPSFHIELEDDSNIFVWNIGVMVLNEDSIYHGGYFKAQ 63

Query: 58  LEFPKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVE 117
           + FP D+P SPP+  FTP+I HPN+Y +G +CISILH  G DP   E   E WSPVQ+VE
Sbjct: 64  MRFPDDFPFSPPQFRFTPAIYHPNVYRDGRLCISILHQSG-DPMTDEPDAETWSPVQTVE 122

Query: 118 KILLSVMSMLSEPNIESGANIDACILWRDNRAEFEKQVKLSILKS 162
            +L+S++S+L +PNI S AN+DA + +R N  +++++VK+ + +S
Sbjct: 123 SVLISIVSLLEDPNISSPANVDAAVDFRKNPEQYKQRVKMEVERS 167

>YGL058W (RAD6) [1921] chr7 (393990..394508) Ubiquitin conjugating
           (E2) enzyme involved in error-prone and error-free
           DNA-damage recovery pathways, in the N-end rule protein
           degradation pathway, mediates methylation of histone H3
           lysines 4 and 79 by ubiquitination of histone H2B [519
           bp, 172 aa]
          Length = 172

 Score =  135 bits (340), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 63/162 (38%), Positives = 101/162 (62%), Gaps = 14/162 (8%)

Query: 1   MSKTAQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEF 60
           MS  A++RL ++ +++ +D+PPG+ A P  D N+ VW+ +I GP DTPY  G F   LEF
Sbjct: 1   MSTPARRRLMRDFKRMKEDAPPGVSASPLPD-NVMVWNAMIIGPADTPYEDGTFRLLLEF 59

Query: 61  PKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKIL 120
            ++YP  PP + F   + HPN+Y NGE+C+ IL +             RW+P   V  IL
Sbjct: 60  DEEYPNKPPHVKFLSEMFHPNVYANGEICLDILQN-------------RWTPTYDVASIL 106

Query: 121 LSVMSMLSEPNIESGANIDACILWRDNRAEFEKQVKLSILKS 162
            S+ S+ ++PN  S AN++A  L++D+++++ K+VK ++ KS
Sbjct: 107 TSIQSLFNDPNPASPANVEAATLFKDHKSQYVKRVKETVEKS 148

>KLLA0C05632g complement(503484..503978) highly similar to sp|P06104
           Saccharomyces cerevisiae YGL058w RAD6 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 164

 Score =  135 bits (339), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 63/162 (38%), Positives = 101/162 (62%), Gaps = 14/162 (8%)

Query: 1   MSKTAQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEF 60
           MS  A++RL ++ +++ +DSPPG+ A P  D N+ +W+ +I GP DTPY  G F   LEF
Sbjct: 1   MSTPARRRLMRDFKRMKEDSPPGVSASPLPD-NVMIWNAMIIGPADTPYEDGTFRLLLEF 59

Query: 61  PKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKIL 120
            ++YP  PP + F   + HPN+Y NGE+C+ IL             + RW+P   V  IL
Sbjct: 60  DEEYPNKPPHVKFLSEMFHPNVYANGEICLDIL-------------QNRWTPTYDVASIL 106

Query: 121 LSVMSMLSEPNIESGANIDACILWRDNRAEFEKQVKLSILKS 162
            S+ S+ ++PN  S AN++A  L++D+++++ K+VK ++ KS
Sbjct: 107 TSIQSLFNDPNPASPANVEAATLFQDHKSQYVKRVKETVEKS 148

>AGL203C [4109] [Homologous to ScYDR054C (CDC34) - SH]
           (317749..318561) [813 bp, 270 aa]
          Length = 270

 Score =  138 bits (347), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 100/156 (64%), Gaps = 3/156 (1%)

Query: 8   RLYKELQQLIKDSPPGIVAGPKSDDNLFVWDC-LIQGPPDTPYAGGVFNAQLEFPKDYPL 66
           R Y+EL    K + P        D N+F W+  ++    D+ Y GG F AQ+ FP+D+P 
Sbjct: 14  RQYRELTDP-KKAIPSFHIELDDDSNIFSWNIGVMVLNEDSIYHGGYFKAQMRFPEDFPF 72

Query: 67  SPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMSM 126
           SPP   FTP+I HPN+Y +G +CISILH  G DP   E   E WSPVQ+VE +L+S++S+
Sbjct: 73  SPPSFRFTPAIYHPNVYRDGRLCISILHQSG-DPTSDEPDSETWSPVQTVESVLISIVSL 131

Query: 127 LSEPNIESGANIDACILWRDNRAEFEKQVKLSILKS 162
           L +PNI S AN+DA + +R N  +++++VKL + +S
Sbjct: 132 LEDPNISSPANVDAAVDYRKNPEQYKQRVKLEVERS 167

>AAR156C [344] [Homologous to ScYGL058W (RAD6) - SH]
           (626372..626884) [513 bp, 170 aa]
          Length = 170

 Score =  135 bits (339), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 63/162 (38%), Positives = 101/162 (62%), Gaps = 14/162 (8%)

Query: 1   MSKTAQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEF 60
           MS  A++RL ++ +++ +D+PPG+ A P  D N+ VW+ +I GP DTPY  G F   LEF
Sbjct: 1   MSTPARRRLMRDFKRMKEDAPPGVSASPLPD-NVMVWNAMIIGPADTPYEDGTFRLLLEF 59

Query: 61  PKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKIL 120
            ++YP  PP + F   + HPN+Y NGE+C+ IL             + RW+P   V  IL
Sbjct: 60  DEEYPNKPPHVKFLSEMFHPNVYANGEICLDIL-------------QNRWTPTYDVASIL 106

Query: 121 LSVMSMLSEPNIESGANIDACILWRDNRAEFEKQVKLSILKS 162
            S+ S+ ++PN  S AN++A  L++D+++++ K+VK ++ KS
Sbjct: 107 TSIQSLFNDPNPASPANVEAATLFKDHKSQYVKRVKETVEKS 148

>Sklu_2136.5 YDR054C, Contig c2136 7737-8555
          Length = 272

 Score =  137 bits (346), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 68/162 (41%), Positives = 104/162 (64%), Gaps = 4/162 (2%)

Query: 4   TAQKRLYKELQQLI--KDSPPGIVAGPKSDDNLFVWDC-LIQGPPDTPYAGGVFNAQLEF 60
           TA   L ++ ++L   K + P        D N+F+W+  ++    D+ Y GG F AQ++F
Sbjct: 7   TAASLLLRQYRELTDPKKAIPSFHIELDDDSNIFLWNIGVMVLNEDSIYHGGYFKAQMKF 66

Query: 61  PKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKIL 120
           P+D+P SPP   FTP+I HPN+Y +G +CISILH  G DP   E   E WSPVQ+VE +L
Sbjct: 67  PEDFPFSPPNFRFTPAIYHPNVYRDGRLCISILHQSG-DPTSDEPDSETWSPVQTVESVL 125

Query: 121 LSVMSMLSEPNIESGANIDACILWRDNRAEFEKQVKLSILKS 162
           +S++S+L +PNI S AN+DA + +R N  +++++V L + +S
Sbjct: 126 ISIVSLLEDPNISSPANVDAAVDYRKNPEQYKQRVHLEVERS 167

>KLLA0D09196g 772795..773673 similar to sp|P14682 Saccharomyces
           cerevisiae YDR054c CDC34 E2 ubiquitin-conjugating
           enzyme, start by similarity
          Length = 292

 Score =  137 bits (346), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 106/162 (65%), Gaps = 4/162 (2%)

Query: 4   TAQKRLYKELQQLI--KDSPPGIVAGPKSDDNLFVWDC-LIQGPPDTPYAGGVFNAQLEF 60
           TA   L ++ ++L   K + P      + D N+F+W+  ++    ++ Y GG F AQ++F
Sbjct: 6   TAASLLLRQYRELTDPKKAIPSFHIALEDDSNIFLWNIGVMVLNEESIYHGGYFKAQMKF 65

Query: 61  PKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKIL 120
           P D+P SPP   FTP+I HPN+Y +G +CISILH  G +P   E  EE WSPVQ+VE +L
Sbjct: 66  PDDFPFSPPTFRFTPAIYHPNVYRDGRLCISILHQSG-NPTSDEPDEETWSPVQTVESVL 124

Query: 121 LSVMSMLSEPNIESGANIDACILWRDNRAEFEKQVKLSILKS 162
           +S++S+L +PNI S AN+DA + ++ N  +++++VKL + +S
Sbjct: 125 ISIVSLLEDPNISSPANVDAAVDYKKNPDQYKQKVKLEVERS 166

>Scas_563.8
          Length = 171

 Score =  134 bits (336), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 101/162 (62%), Gaps = 14/162 (8%)

Query: 1   MSKTAQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEF 60
           MS  A++RL ++ +++ +D+PPG+ A P  D N+ VW+ +I GP +TPY  G F   LEF
Sbjct: 1   MSTAARRRLMRDFKRMKEDAPPGVSASPLPD-NVMVWNAMIIGPAETPYEDGTFRLLLEF 59

Query: 61  PKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKIL 120
            ++YP  PP + F   + HPN+Y NGE+C+ IL             + RW+P   V  IL
Sbjct: 60  DEEYPNKPPHVKFLSEMFHPNVYANGEICLDIL-------------QNRWTPTYDVASIL 106

Query: 121 LSVMSMLSEPNIESGANIDACILWRDNRAEFEKQVKLSILKS 162
            S+ S+ ++PN  S AN++A  L++D+++++ K+VK ++ KS
Sbjct: 107 TSIQSLFNDPNPASPANVEAATLFKDHKSQYIKRVKETVEKS 148

>Scas_718.34
          Length = 258

 Score =  133 bits (334), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 104/164 (63%), Gaps = 4/164 (2%)

Query: 2   SKTAQKRLYKELQQLI--KDSPPGIVAGPKSDDNLFVWDC-LIQGPPDTPYAGGVFNAQL 58
           +++A   L ++ ++L   K + P      + D N+F W+  ++    D+ Y GG F +Q+
Sbjct: 12  ARSAANLLLRQYRELTDPKRAIPSFHIELEDDSNIFTWNIGVMVLNKDSIYHGGYFQSQM 71

Query: 59  EFPKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEK 118
           +FPKD+P SPP+  F P I HPN+Y +G++CISILH  G D    E   E WSPVQSVE 
Sbjct: 72  KFPKDFPFSPPQFKFIPPIYHPNVYRDGKLCISILHQSG-DAMTSEPDNETWSPVQSVES 130

Query: 119 ILLSVMSMLSEPNIESGANIDACILWRDNRAEFEKQVKLSILKS 162
           +L+S++S+L +PN+ S AN+DA + +R N  E++K+V   + +S
Sbjct: 131 VLISIVSLLEDPNVSSPANVDAAVEYRKNYNEYKKKVLQQVERS 174

>AER173C [2676] [Homologous to ScYBR082C (UBC4) - SH; ScYDR059C
           (UBC5) - SH] (960420..960863) [444 bp, 147 aa]
          Length = 147

 Score =  122 bits (305), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 61/150 (40%), Positives = 88/150 (58%), Gaps = 14/150 (9%)

Query: 7   KRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPL 66
           KR+ KEL  L +D P    AGP  DD L+ W   I GPPD+PYAGGVF   + FP DYP 
Sbjct: 4   KRITKELNDLGRDPPTSCSAGPVGDD-LYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPF 62

Query: 67  SPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMSM 126
            PPK++FT  I HPNI  NG +C+ IL             +++WSP  ++ K+LLS+ S+
Sbjct: 63  KPPKISFTTKIYHPNINANGNICLDIL-------------KDQWSPALTISKVLLSICSL 109

Query: 127 LSEPNIESGANIDACILWRDNRAEFEKQVK 156
           L++ N +     +   +++ +RA++E   K
Sbjct: 110 LTDANPDDPLVPEIAHIYKTDRAKYEATAK 139

>Sklu_2299.5 YGL058W, Contig c2299 10055-10519 reverse complement
          Length = 154

 Score =  122 bits (305), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 89/145 (61%), Gaps = 14/145 (9%)

Query: 18  KDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPLSPPKLTFTPSI 77
           +D+PPG+ A P  D N+ VW+ +I GP DTPY  G F   LEF ++YP  PP + F   +
Sbjct: 3   EDAPPGVSASPLPD-NVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEM 61

Query: 78  LHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMSMLSEPNIESGAN 137
            HPN+Y NGE+C+ IL             + RW+P   V  IL S+ S+ ++PN  S AN
Sbjct: 62  FHPNVYANGEICLDIL-------------QNRWTPTYDVASILTSIQSLFNDPNPASPAN 108

Query: 138 IDACILWRDNRAEFEKQVKLSILKS 162
           ++A  L++D+++++ K+VK ++ KS
Sbjct: 109 VEAATLFKDHKSQYVKRVKETVEKS 133

>KLLA0E12595g join(1117022..1117068,1117342..1117741) highly similar
           to sp|P15731 Saccharomyces cerevisiae YBR082c UBC4 E2
           ubiquitin-conjugating enzyme or sp|P15732 Saccharomyces
           cerevisiae YDR059c UBC5, start by similarity
          Length = 148

 Score =  121 bits (304), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 90/153 (58%), Gaps = 14/153 (9%)

Query: 4   TAQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKD 63
           ++ KR+ KEL  L +D P    AGP  DD ++ W   I GPPD+PYAGGVF   + FP D
Sbjct: 2   SSLKRITKELNDLGRDPPTSCSAGPVGDD-VYHWQASIMGPPDSPYAGGVFFLSIHFPTD 60

Query: 64  YPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSV 123
           YP  PPK++FT  I HPNI  NG +C+ IL             +++WSP  ++ K+LLS+
Sbjct: 61  YPFKPPKISFTTKIYHPNINANGNICLDIL-------------KDQWSPALTISKVLLSI 107

Query: 124 MSMLSEPNIESGANIDACILWRDNRAEFEKQVK 156
            S+L++ N +     +   L++ +RA++E   +
Sbjct: 108 CSLLTDANPDDPLVPEIAHLYKTDRAKYEATAR 140

>CAGL0E04752g complement(455965..456408) highly similar to sp|P15731
           Saccharomyces cerevisiae YBR082c UBC4 E2
           ubiquitin-conjugating enzyme or sp|P15732 Saccharomyces
           cerevisiae YDR059c UBC5, start by similarity
          Length = 147

 Score =  120 bits (302), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 89/152 (58%), Gaps = 14/152 (9%)

Query: 5   AQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDY 64
           + KR+ KEL  L +D P    AGP  DD L+ W   I GPPD+PYAGGVF   + FP DY
Sbjct: 2   SSKRIAKELSDLGRDPPTSCSAGPVGDD-LYHWQASIMGPPDSPYAGGVFFLSIHFPTDY 60

Query: 65  PLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVM 124
           P  PPK++FT  I HPNI  NG +C+ IL             +++WSP  ++ K+LLS+ 
Sbjct: 61  PFKPPKISFTTKIYHPNINANGNICLDIL-------------KDQWSPALTLSKVLLSIC 107

Query: 125 SMLSEPNIESGANIDACILWRDNRAEFEKQVK 156
           S+L++ N +     +   +++ +RA++E   +
Sbjct: 108 SLLTDANPDDPLVPEIAHIYKTDRAKYEATAR 139

>Kwal_14.1828
          Length = 152

 Score =  120 bits (302), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 89/145 (61%), Gaps = 14/145 (9%)

Query: 18  KDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPLSPPKLTFTPSI 77
           +D+PPG+ A P  D N+ VW+ +I GP +TPY  G F   LEF ++YP  PP + F   I
Sbjct: 3   EDAPPGVSASPLPD-NVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLSEI 61

Query: 78  LHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMSMLSEPNIESGAN 137
            HPN+Y NGE+C+ IL             + RW+P   V  IL S+ S+ ++PN  S AN
Sbjct: 62  FHPNVYANGEICLDIL-------------QNRWTPTYDVASILTSIQSLFNDPNPASPAN 108

Query: 138 IDACILWRDNRAEFEKQVKLSILKS 162
           ++A  L++D+++++ K+VK ++ KS
Sbjct: 109 VEAATLFKDHKSQYIKRVKETVEKS 133

>Scas_635.14*
          Length = 148

 Score =  118 bits (296), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 58/153 (37%), Positives = 89/153 (58%), Gaps = 14/153 (9%)

Query: 4   TAQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKD 63
           ++ KR+ KEL  + +D P    AGP  DD L+ W   I GPPD+PYAGGVF   + FP D
Sbjct: 2   SSSKRITKELSDMGRDPPTSCSAGPVGDD-LYHWQASIMGPPDSPYAGGVFFLSIHFPTD 60

Query: 64  YPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSV 123
           YP  PPK++FT  I HPNI  NG +C+ IL             +++WSP  ++ K+LLS+
Sbjct: 61  YPFKPPKISFTTKIYHPNINANGNICLDIL-------------KDQWSPALTLSKVLLSI 107

Query: 124 MSMLSEPNIESGANIDACILWRDNRAEFEKQVK 156
            S+L++ N +     +   +++ +R ++E   +
Sbjct: 108 CSLLTDANPDDPLVPEIAHIYKTDRPKYEATAR 140

>YBR082C (UBC4) [271] chr2 complement(406585..406984,407080..407126)
           Ubiquitin-conjugating (E2) enzyme, together with Ubc5p
           is responsible for the majority of ubiquitin-dependent
           protein degradation of short-lived and abnormal proteins
           [447 bp, 148 aa]
          Length = 148

 Score =  116 bits (291), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 58/153 (37%), Positives = 88/153 (57%), Gaps = 14/153 (9%)

Query: 4   TAQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKD 63
           ++ KR+ KEL  L +D P    AGP  DD L+ W   I GP D+PYAGGVF   + FP D
Sbjct: 2   SSSKRIAKELSDLERDPPTSCSAGPVGDD-LYHWQASIMGPADSPYAGGVFFLSIHFPTD 60

Query: 64  YPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSV 123
           YP  PPK++FT  I HPNI  NG +C+ IL             +++WSP  ++ K+LLS+
Sbjct: 61  YPFKPPKISFTTKIYHPNINANGNICLDIL-------------KDQWSPALTLSKVLLSI 107

Query: 124 MSMLSEPNIESGANIDACILWRDNRAEFEKQVK 156
            S+L++ N +     +   +++ +R ++E   +
Sbjct: 108 CSLLTDANPDDPLVPEIAHIYKTDRPKYEATAR 140

>YDR059C (UBC5) [910] chr4 complement(569230..569629,569720..569766)
           Ubiquitin-conjugating enzyme that with Ubc4p is
           responsible for most of ubiquitin-dependent protein
           degradation of short-lived and abnormal proteins [447
           bp, 148 aa]
          Length = 148

 Score =  115 bits (288), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 58/153 (37%), Positives = 88/153 (57%), Gaps = 14/153 (9%)

Query: 4   TAQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKD 63
           ++ KR+ KEL  L +D P    AGP  DD L+ W   I GP D+PYAGGVF   + FP D
Sbjct: 2   SSSKRIAKELSDLGRDPPASCSAGPVGDD-LYHWQASIMGPSDSPYAGGVFFLSIHFPTD 60

Query: 64  YPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSV 123
           YP  PPK+ FT  I HPNI  +G +C+ IL             +++WSP  ++ K+LLS+
Sbjct: 61  YPFKPPKVNFTTKIYHPNINSSGNICLDIL-------------KDQWSPALTLSKVLLSI 107

Query: 124 MSMLSEPNIESGANIDACILWRDNRAEFEKQVK 156
            S+L++ N +     +   +++ ++A++E   K
Sbjct: 108 CSLLTDANPDDPLVPEIAQIYKTDKAKYEATAK 140

>Kwal_27.12401
          Length = 236

 Score =  113 bits (283), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 82/140 (58%), Gaps = 14/140 (10%)

Query: 17  IKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPLSPPKLTFTPS 76
           ++D P    AGP  DD L+ W   I GPPD+PYAGGVF   + FP DYP  PPK++FT  
Sbjct: 103 LRDPPTSCSAGPVGDD-LYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK 161

Query: 77  ILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMSMLSEPNIESGA 136
           I HPNI  NG +C+ IL             +++WSP  ++ K+LLS+ S+L++ N +   
Sbjct: 162 IYHPNINANGNICLDIL-------------KDQWSPALTISKVLLSICSLLTDANPDDPL 208

Query: 137 NIDACILWRDNRAEFEKQVK 156
             +   +++ +RA++E   K
Sbjct: 209 VPEIAHIYKTDRAKYEATAK 228

>YOR339C (UBC11) [5118] chr15 complement(958357..958827) Protein
           with similarity to ubiquitin-conjugating enzymes [471
           bp, 156 aa]
          Length = 156

 Score =  110 bits (275), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 82/149 (55%), Gaps = 13/149 (8%)

Query: 7   KRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPL 66
           KRL  EL QL+  +   I A P  D++L  W   I GP DTPY+G  F   L+FP++YP 
Sbjct: 11  KRLQNELLQLLSSTTESISAFPVDDNDLTYWVGYITGPKDTPYSGLKFKVSLKFPQNYPF 70

Query: 67  SPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMSM 126
            PP + F   + HPN+  +G +C+ IL             +E+WS V +VE ILLS+ S+
Sbjct: 71  HPPMIKFLSPMWHPNVDKSGNICLDIL-------------KEKWSAVYNVETILLSLQSL 117

Query: 127 LSEPNIESGANIDACILWRDNRAEFEKQV 155
           L EPN  S  N  A  LW  +  E+ K+V
Sbjct: 118 LGEPNNRSPLNAVAAELWDADMEEYRKKV 146

>CAGL0D00814g 98589..99062 highly similar to sp|P50623 Saccharomyces
           cerevisiae YDL064w UBC9 E2 ubiquitin-conjugating enzyme,
           start by similarity
          Length = 157

 Score = 97.8 bits (242), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 82/159 (51%), Gaps = 15/159 (9%)

Query: 1   MSKTAQKRLYKELQQLIKDSPPGIVA----GPKSDDNLFVWDCLIQGPPDTPYAGGVFNA 56
           MS    +RL +E ++  KD P G  A    GP    NL  W+  I G   T +  GVF  
Sbjct: 1   MSSLCLQRLQEERKKWRKDHPFGFYAKPTKGPDGTLNLQKWEAGIPGKEGTIWQDGVFPI 60

Query: 57  QLEFPKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSV 116
            +E+P +YP  PPK+ F     HPNIYP+G VC+SIL+   D           W P  ++
Sbjct: 61  TVEYPDEYPSKPPKVKFPAGFYHPNIYPSGTVCLSILNEDQD-----------WRPAITL 109

Query: 117 EKILLSVMSMLSEPNIESGANIDACILWRDNRAEFEKQV 155
           ++I+L V  +L  PN  S A   A   +  N+AE+EK+V
Sbjct: 110 KQIVLGVQDLLDSPNPNSPAQEPAWRAFSKNKAEYEKKV 148

>CAGL0G08063g 761662..762111 highly similar to sp|P52490
           Saccharomyces cerevisiae YDR092w UBC13 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 149

 Score = 97.1 bits (240), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 78/150 (52%), Gaps = 14/150 (9%)

Query: 7   KRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPL 66
           KR+ KE ++L+ D  PGI A P  +DNL  +D  I+GP  +PY  G+F  +L  P+DYP+
Sbjct: 6   KRIIKETERLVSDPVPGITAEP-HEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPM 64

Query: 67  SPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMSM 126
             PK+ F   I HPNI   G +C+ +L +              WSP   +  +LLS+ ++
Sbjct: 65  EAPKVRFLTKIYHPNIDRLGRICLDVLKT-------------NWSPALQIRTVLLSIQAL 111

Query: 127 LSEPNIESGANIDACILWRDNRAEFEKQVK 156
           L+ PN       D    W  + A+ ++  K
Sbjct: 112 LASPNPNDPLANDVAEDWIKDEAKAKQTAK 141

>YDL064W (UBC9) [802] chr4 (337487..337524,337635..338070)
           Smt3p-conjugating enzyme required for G2/M transition,
           conjugates Smt3p to Pol30p (PCNA) in S phase, which may
           be antagonistic to non-proteolytic ubiquitination of
           Pol30p in the Rad6-dependent DNA repair pathway [474 bp,
           157 aa]
          Length = 157

 Score = 96.7 bits (239), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 87/161 (54%), Gaps = 15/161 (9%)

Query: 1   MSKTAQKRLYKELQQLIKDSPPGIVAGP--KSDD--NLFVWDCLIQGPPDTPYAGGVFNA 56
           MS    +RL +E ++  KD P G  A P  K+D   +L  W+  I G   T +AGGV+  
Sbjct: 1   MSSLCLQRLQEERKKWRKDHPFGFYAKPVKKADGSMDLQKWEAGIPGKEGTNWAGGVYPI 60

Query: 57  QLEFPKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSV 116
            +E+P +YP  PPK+ F     HPN+YP+G +C+SIL+   D           W P  ++
Sbjct: 61  TVEYPNEYPSKPPKVKFPAGFYHPNVYPSGTICLSILNEDQD-----------WRPAITL 109

Query: 117 EKILLSVMSMLSEPNIESGANIDACILWRDNRAEFEKQVKL 157
           ++I+L V  +L  PN  S A   A   +  N+AE++K+V L
Sbjct: 110 KQIVLGVQDLLDSPNPNSPAQEPAWRSFSRNKAEYDKKVLL 150

>Sklu_2410.4 YOR339C, Contig c2410 15549-16034
          Length = 161

 Score = 96.7 bits (239), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 57/152 (37%), Positives = 87/152 (57%), Gaps = 13/152 (8%)

Query: 4   TAQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKD 63
           +  KRL  EL QL+    PG+ A P+++D+L  W  +I GP  TPY G  F   L+FP+ 
Sbjct: 14  SVTKRLQSELVQLMMSPSPGLSAFPENEDDLTKWSGIITGPDGTPYEGLRFKISLQFPQS 73

Query: 64  YPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSV 123
           YP + P++TF   + HPN+  +G +C+ IL             +++WS V +V+ ILLS+
Sbjct: 74  YPYTAPRVTFVSPMWHPNVDMSGNICLDIL-------------KDQWSAVYNVQTILLSL 120

Query: 124 MSMLSEPNIESGANIDACILWRDNRAEFEKQV 155
            S+L EPN  S  N  A  LW  N  E+++++
Sbjct: 121 QSLLEEPNNSSPLNAVAAELWDKNMEEYKRKL 152

>Scas_636.15*
          Length = 153

 Score = 95.9 bits (237), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 51/143 (35%), Positives = 73/143 (51%), Gaps = 14/143 (9%)

Query: 7   KRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPL 66
           KR+ KE ++LI D  PGI A P  +DNL  ++  ++GP  +PY  G+F  +L  P DYP+
Sbjct: 6   KRIIKETERLISDPVPGITAEP-HEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPM 64

Query: 67  SPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMSM 126
             PK+ F   I HPNI   G +C+ +L +              WSP   +  +LLSV ++
Sbjct: 65  EAPKVRFLTKIYHPNIDRLGRICLDVLKT-------------NWSPALQIRTVLLSVQAL 111

Query: 127 LSEPNIESGANIDACILWRDNRA 149
           L+ PN       D    W  N A
Sbjct: 112 LASPNPNDPLANDVAEEWIQNEA 134

>YDR092W (UBC13) [944] chr4 (629870..629899,630168..630599)
           Ubiquitin-conjugating (E2) enzyme involved in
           Rad6-dependent post-replicative repair pathway, required
           for non-proteolytic multi-ubiquitination of Pol30p
           (PCNA) [462 bp, 153 aa]
          Length = 153

 Score = 94.4 bits (233), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 47/125 (37%), Positives = 68/125 (54%), Gaps = 14/125 (11%)

Query: 7   KRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPL 66
           KR+ KE ++L+ D  PGI A P  DDNL  +   I+GP  +PY  G+F  +L  P DYP+
Sbjct: 6   KRIIKETEKLVSDPVPGITAEP-HDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPM 64

Query: 67  SPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMSM 126
             PK+ F   I HPNI   G +C+ +L +              WSP   +  +LLS+ ++
Sbjct: 65  EAPKVRFLTKIYHPNIDRLGRICLDVLKT-------------NWSPALQIRTVLLSIQAL 111

Query: 127 LSEPN 131
           L+ PN
Sbjct: 112 LASPN 116

>AER056C [2561] [Homologous to ScYDL064W (UBC9) - SH]
           (741224..741659,741718..741755) [474 bp, 157 aa]
          Length = 157

 Score = 94.0 bits (232), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 83/159 (52%), Gaps = 15/159 (9%)

Query: 1   MSKTAQKRLYKELQQLIKDSPPGIVAGP-KSDD---NLFVWDCLIQGPPDTPYAGGVFNA 56
           M+    +RL +E ++  KD P G  A P K +D   NL  W+  I G   T +  GV+  
Sbjct: 1   MNSLCLQRLQEERKKWRKDHPFGFWAKPTKKEDGSMNLQKWEAGIPGREGTIWKDGVYPI 60

Query: 57  QLEFPKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSV 116
            +E+P DYP  PP++ F     HPNIYP+G VC+SIL+   D           W P  ++
Sbjct: 61  TIEYPDDYPSKPPRVKFPAGFYHPNIYPSGTVCLSILNEDQD-----------WKPAITM 109

Query: 117 EKILLSVMSMLSEPNIESGANIDACILWRDNRAEFEKQV 155
           ++ILL V  +L+ PN  S A   A   +  N  E+EK+V
Sbjct: 110 KQILLGVQDLLTSPNPNSPAQEPAWRAYAKNLQEYEKKV 148

>KLLA0C17622g join(1555873..1555902,1556004..1556453) highly similar
           to sp|P52490 Saccharomyces cerevisiae YDR092w UBC13 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 159

 Score = 93.6 bits (231), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 68/125 (54%), Gaps = 14/125 (11%)

Query: 7   KRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPL 66
           KR+ KE ++L+ D  PGI A P  +DNL  +   I+GP  +PY  GVF  +L  P DYP+
Sbjct: 6   KRIIKETERLVSDPVPGITAEP-HEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPM 64

Query: 67  SPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMSM 126
             PK+ F   I HPNI   G +C+ +L +              WSP   +  +LLSV ++
Sbjct: 65  EAPKVRFLTKIYHPNIDRLGRICLDVLKN-------------NWSPALQIRTVLLSVQAL 111

Query: 127 LSEPN 131
           L+ PN
Sbjct: 112 LASPN 116

>AGR121C [4432] [Homologous to ScYDR092W (UBC13) - SH]
           (977487..977921,977971..978000) [465 bp, 154 aa]
          Length = 154

 Score = 92.8 bits (229), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 70/125 (56%), Gaps = 14/125 (11%)

Query: 7   KRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPL 66
           KR+ KE ++L+ D  PGI A P  +DNL  +D  I+GP  +PY  GVF  +L  P +YP+
Sbjct: 6   KRIIKETERLVSDPVPGISAEPH-EDNLRYFDVSIEGPQQSPYEHGVFRLELFLPDEYPM 64

Query: 67  SPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMSM 126
            PPK+ F   I HPNI   G +C+ +L +              WSP   +  +LLS+ ++
Sbjct: 65  EPPKVRFLTKIYHPNIDRLGRICLDVLKT-------------NWSPALQIRTVLLSIQAL 111

Query: 127 LSEPN 131
           L+ PN
Sbjct: 112 LATPN 116

>KLLA0E04983g 443446..443919 highly similar to sp|P50623
           Saccharomyces cerevisiae YDL064w UBC9 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 157

 Score = 92.0 bits (227), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 56/165 (33%), Positives = 84/165 (50%), Gaps = 15/165 (9%)

Query: 1   MSKTAQKRLYKELQQLIKDSPPGIVAGP--KSDD--NLFVWDCLIQGPPDTPYAGGVFNA 56
           MS    +RL +E ++  KD P G  A P  K+D   NL  W+  I G   T +  G++  
Sbjct: 1   MSSLCLQRLQEERKKWRKDHPYGFFAKPTKKTDGSMNLQKWEAGIPGRDGTLWKNGLYPL 60

Query: 57  QLEFPKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSV 116
            +E+P DYP  PPK+ F     HPN+YP+G +C+SIL+   D           W P  ++
Sbjct: 61  TIEYPDDYPSKPPKVKFPAGFYHPNVYPSGTICLSILNEDQD-----------WRPAITL 109

Query: 117 EKILLSVMSMLSEPNIESGANIDACILWRDNRAEFEKQVKLSILK 161
           +++LL V  +L  PN  S A   A   +  N  E+E++V    L+
Sbjct: 110 KQLLLGVQDLLDSPNPNSPAQEPAWRAFSKNIKEYERKVSEQALR 154

>Kwal_26.7009
          Length = 161

 Score = 92.0 bits (227), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 85/152 (55%), Gaps = 13/152 (8%)

Query: 4   TAQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKD 63
           +  KRL  EL QL+    PG+ A P+S+D+L  W  +I GP  TPY G  F   LEF + 
Sbjct: 14  SVTKRLQSELVQLMMSPSPGLSAFPESEDDLTKWCGIITGPDGTPYEGLRFKIALEFAQT 73

Query: 64  YPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSV 123
           YP + PK+ F   + HPN+  +G +C+ IL             +++WS V +V+ ILLS+
Sbjct: 74  YPYTAPKVRFVSPMWHPNVDMSGNICLDIL-------------KDQWSAVYNVQTILLSL 120

Query: 124 MSMLSEPNIESGANIDACILWRDNRAEFEKQV 155
            S+L EPN  S  N  A  LW  +  E++K++
Sbjct: 121 QSLLEEPNNSSPLNAVAAELWDTDMQEYKKKL 152

>AFR314W [3506] [Homologous to ScYGR133W (PEX4) - SH]
           complement(1006421..1006888) [468 bp, 155 aa]
          Length = 155

 Score = 91.3 bits (225), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 51/156 (32%), Positives = 85/156 (54%), Gaps = 16/156 (10%)

Query: 8   RLYKELQQLIKDSPPGIVAGPKSDDN--LFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYP 65
           R YK+LQ+ +   P  +   P  ++N  L  W+   QGP +TPYAG  F  ++  P+ YP
Sbjct: 6   REYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYP 65

Query: 66  LSPPKLTFTP-SILHPNI-YPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSV 123
             PPK +F P  I HPNI +  GEVC+ +L              E WSPV ++ +++ ++
Sbjct: 66  NEPPKCSFPPHHICHPNIKWSTGEVCLDLL------------KHEAWSPVYNLLQVVEAI 113

Query: 124 MSMLSEPNIESGANIDACILWRDNRAEFEKQVKLSI 159
            ++L+EP ++S  ++D   L+  +RA ++  V   +
Sbjct: 114 STLLAEPGVDSPLDVDLSRLYTTDRAAYDGVVNYRL 149

>Sklu_1838.2 YDR092W, Contig c1838 1546-2037 reverse complement
          Length = 163

 Score = 89.0 bits (219), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 66/121 (54%), Gaps = 14/121 (11%)

Query: 11  KELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPLSPPK 70
           +E ++L+ D  PGI A P  DDNL  +   I+GP  +PY  GVF  +L  P+DYP+  PK
Sbjct: 20  QETERLVSDPVPGISAEPH-DDNLRYFQVTIEGPQQSPYENGVFELELFLPEDYPMEAPK 78

Query: 71  LTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMSMLSEP 130
           + F   I HPNI   G +C+ +L +              WSP   +  +LLS+ ++L+ P
Sbjct: 79  VRFLTKIYHPNIDRLGRICLDVLKN-------------NWSPALQIRTVLLSIQALLASP 125

Query: 131 N 131
           N
Sbjct: 126 N 126

>Kwal_56.23482
          Length = 149

 Score = 86.7 bits (213), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 65/121 (53%), Gaps = 14/121 (11%)

Query: 11  KELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPLSPPK 70
           +E ++L+ D  PGI A P  ++NL  +   I+GP  +PY  GVF  +L  P DYP+  PK
Sbjct: 10  QETERLVSDPVPGITAEPH-EENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPK 68

Query: 71  LTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMSMLSEP 130
           + F   I HPNI   G +C+ +L +              WSP   +  +LLSV ++L+ P
Sbjct: 69  VRFLTKIYHPNIDRLGRICLDVLKT-------------NWSPALQIRTVLLSVQALLASP 115

Query: 131 N 131
           N
Sbjct: 116 N 116

>Kwal_27.10837
          Length = 246

 Score = 85.9 bits (211), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 74/136 (54%), Gaps = 15/136 (11%)

Query: 2   SKTAQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFP 61
           ++ AQKRL KE + ++++ PP I+A P ++DN+  W  +I GPPDTPY GG ++  L FP
Sbjct: 3   TRQAQKRLSKEYKSMVENPPPFIIAQP-NEDNVLEWHYVITGPPDTPYMGGQYHGTLVFP 61

Query: 62  KDYPLSPPKLTF-TPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKIL 120
            DYP  PP +   TPS        +  +C+S          M +   + W+P  SV  IL
Sbjct: 62  SDYPFKPPAIRMVTPS---GRFKEDTRLCLS----------MSDYHPDTWNPSWSVSTIL 108

Query: 121 LSVMSMLSEPNIESGA 136
             ++S ++     +GA
Sbjct: 109 TGLLSFMTSEENTTGA 124

>Kwal_23.4227
          Length = 122

 Score = 82.0 bits (201), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 63/123 (51%), Gaps = 11/123 (8%)

Query: 33  NLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPLSPPKLTFTPSILHPNIYPNGEVCISI 92
           NL  W+  I G   T +  GVF   +E+P DYP  PPK+ F     HPNIYP+G VC+SI
Sbjct: 2   NLQKWEAGIPGKEGTIWKEGVFPITIEYPDDYPSKPPKVKFPAGFYHPNIYPSGTVCLSI 61

Query: 93  LHSPGDDPNMYESAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWRDNRAEFE 152
           L+   D           W P  ++++I L V  +L  PN  S A   A   +  N  E+E
Sbjct: 62  LNEDQD-----------WRPAITLKQIALGVQDLLDSPNPNSPAQEPAWRAFSKNVKEYE 110

Query: 153 KQV 155
           ++V
Sbjct: 111 RKV 113

>AGR372W [4683] [Homologous to ScYER100W (UBC6) - SH]
           complement(1419828..1420556) [729 bp, 242 aa]
          Length = 242

 Score = 84.3 bits (207), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 71/129 (55%), Gaps = 17/129 (13%)

Query: 2   SKTAQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFP 61
           S+ A KRL KE + + ++ PP IVA PK +DN+ VW  +I GPP+TPY  G ++  L FP
Sbjct: 3   SRQAYKRLSKEYKMMTENPPPYIVAAPK-EDNILVWHYVITGPPETPYEDGQYHGTLVFP 61

Query: 62  KDYPLSPPKLTFTPSILHPN--IYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKI 119
            DYP +PP +     +L PN     N  +C+S          M +   + W+P  SV  I
Sbjct: 62  NDYPFNPPAI----RMLTPNGRFRENTRLCLS----------MSDYHPDTWNPSWSVATI 107

Query: 120 LLSVMSMLS 128
           L  ++S ++
Sbjct: 108 LTGLLSFMT 116

>YER100W (UBC6) [1532] chr5 (359558..360310) Ubiquitin-conjugating
           enzyme, anchored in the ER membrane with the
           catalytically active domain in cytoplasm [753 bp, 250
           aa]
          Length = 250

 Score = 84.0 bits (206), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 74/137 (54%), Gaps = 17/137 (12%)

Query: 2   SKTAQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFP 61
           +K A KRL KE + ++++ PP I+A P ++DN+  W  +I GP DTPY GG ++  L FP
Sbjct: 3   TKQAHKRLTKEYKLMVENPPPYILARP-NEDNILEWHYIITGPADTPYKGGQYHGTLTFP 61

Query: 62  KDYPLSPPKLTFTPSILHPN--IYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKI 119
            DYP  PP +     ++ PN    PN  +C+S          M +   + W+P  SV  I
Sbjct: 62  SDYPYKPPAI----RMITPNGRFKPNTRLCLS----------MSDYHPDTWNPGWSVSTI 107

Query: 120 LLSVMSMLSEPNIESGA 136
           L  ++S ++     +G+
Sbjct: 108 LNGLLSFMTSDEATTGS 124

>CAGL0I05478g complement(518933..519673) highly similar to sp|P33296
           Saccharomyces cerevisiae YER100w UBC6 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 246

 Score = 83.2 bits (204), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 75/137 (54%), Gaps = 17/137 (12%)

Query: 2   SKTAQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFP 61
           +K AQKRL KE + ++++ PP I+A P +++N+  W  +I GPPDTPY GG ++  L FP
Sbjct: 3   TKQAQKRLTKEYKMMVENPPPFIIARP-NEENILEWHYVISGPPDTPYDGGQYHGTLTFP 61

Query: 62  KDYPLSPPKLTFTPSILHPN--IYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKI 119
            DYP  PP +     ++ PN     N  +C+S          M +   + W+P  SV  I
Sbjct: 62  SDYPYKPPAI----RMITPNGRFKENTRLCLS----------MSDYHPDTWNPGWSVATI 107

Query: 120 LLSVMSMLSEPNIESGA 136
           L  ++S ++     +G+
Sbjct: 108 LNGLLSFMTGDESTTGS 124

>Sklu_1826.3 YGR133W, Contig c1826 3548-4033
          Length = 161

 Score = 79.7 bits (195), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 48/138 (34%), Positives = 70/138 (50%), Gaps = 18/138 (13%)

Query: 28  PKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPLSPPKLTFTP----SILHPNI- 82
           PK   N++ W   I GPP+TPYA  VF   +E P  YPL PP++ F P    +I H N+ 
Sbjct: 31  PKDTGNMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVD 90

Query: 83  YPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMSMLSEPNIESGANID-AC 141
           +  GE+C+ IL              E WSPV  +  ++ ++  +L EP  ES  N+D A 
Sbjct: 91  FKTGEICLDIL------------TREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIAN 138

Query: 142 ILWRDNRAEFEKQVKLSI 159
           +L   +   +E  +K  I
Sbjct: 139 VLKAGDLEAYEGLIKYYI 156

>Sklu_2425.6 YER100W, Contig c2425 8506-9261 reverse complement
          Length = 251

 Score = 80.1 bits (196), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 73/137 (53%), Gaps = 17/137 (12%)

Query: 2   SKTAQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFP 61
           ++ A KRL KE + +I++ P  I A P ++DN+  W  +I GPPDTPY  G ++  L FP
Sbjct: 3   TRQAHKRLTKEYKAIIENPPQFINAQP-NEDNILEWHYIITGPPDTPYTDGQYHGTLVFP 61

Query: 62  KDYPLSPPKLTFTPSILHPN--IYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKI 119
            DYP  PP +     ++ PN     N  +C++          M +   + W+P  SV  I
Sbjct: 62  ADYPFKPPAI----RMITPNGRFKENTRLCMT----------MSDYHPDTWNPAWSVATI 107

Query: 120 LLSVMSMLSEPNIESGA 136
           L+ ++S ++   + +G+
Sbjct: 108 LMGLLSFMTGDEVTTGS 124

>ADR169C [1911] [Homologous to ScYDR177W (UBC1) - NSH]
           (1000736..1001371) [636 bp, 211 aa]
          Length = 211

 Score = 79.0 bits (193), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 71/152 (46%), Gaps = 14/152 (9%)

Query: 7   KRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPL 66
           KRL KE+Q +  D    I     S+ ++        GPP TPY GG F   ++ P +YP 
Sbjct: 5   KRLMKEIQSVKDDPDANISLAFVSESDIHHLKGTFLGPPGTPYHGGTFIVDIQVPLEYPF 64

Query: 67  SPPKLTFTPSILHPNIYP-NGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMS 125
            PPK+ F   + HPNI    G +C+ IL             +  WSPV +++  L+S+ +
Sbjct: 65  KPPKMQFDTKVYHPNISSVTGAICLDIL-------------KNSWSPVLTLKTSLISLQA 111

Query: 126 MLSEPNIESGANIDACILWRDNRAEFEKQVKL 157
           +L  P      + +    +  +RA F++   L
Sbjct: 112 LLQSPEPNDPQDAEVAKHYLSDRASFDRTAAL 143

>KLLA0E20493g 1814618..1815373 similar to sp|P33296 Saccharomyces
           cerevisiae YER100w UBC6 E2 ubiquitin-conjugating enzyme,
           start by similarity
          Length = 251

 Score = 79.0 bits (193), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 69/134 (51%), Gaps = 17/134 (12%)

Query: 5   AQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDY 64
           A KRL KE + ++ + PP I+A P  +DN+  W  +I GPP TPY  G ++  L FP DY
Sbjct: 6   ANKRLTKEYKNIVNNPPPFIIAAP-HEDNILEWHYVITGPPSTPYENGQYHGTLTFPSDY 64

Query: 65  PLSPPKLTFTPSILHPN--IYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLS 122
           P +PP +     ++ PN     N  +C+S          M +   E W+P  SV  IL  
Sbjct: 65  PFNPPAI----RMITPNGRFKENTRLCLS----------MSDYHPEAWNPAWSVVTILNG 110

Query: 123 VMSMLSEPNIESGA 136
           ++S ++     +G+
Sbjct: 111 LLSFMTGDEQTTGS 124

>Scas_609.7
          Length = 240

 Score = 78.2 bits (191), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 45/137 (32%), Positives = 73/137 (53%), Gaps = 17/137 (12%)

Query: 2   SKTAQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFP 61
           ++ A KRL KE + +I++  P I+A P +++N+  W  +I GPPDTPY GG ++  L FP
Sbjct: 3   TRQAHKRLSKEYKLIIENPTPYILARP-NENNILEWHYIITGPPDTPYVGGQYHGTLTFP 61

Query: 62  KDYPLSPPKLTFTPSILHPN--IYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKI 119
            DYP  PP +     ++ PN     N  +C+S          M +   + W+P  SV  I
Sbjct: 62  SDYPFKPPAI----RMITPNGRFKENTRLCLS----------MSDYHPDLWNPGWSVATI 107

Query: 120 LLSVMSMLSEPNIESGA 136
           L  ++S ++     +G+
Sbjct: 108 LNGLLSFMTGDEATTGS 124

>CAGL0E00671g complement(61460..62101) highly similar to sp|P21734
           Saccharomyces cerevisiae YDR177w E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 213

 Score = 76.6 bits (187), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 70/152 (46%), Gaps = 14/152 (9%)

Query: 7   KRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPL 66
           KR+ KELQ +  D    I     S+ ++        GPP TPY GG F   +E P +YP 
Sbjct: 5   KRIMKELQAVKDDPEANISLEFVSESDIHHLKGSFLGPPGTPYEGGKFIVDIEVPMEYPF 64

Query: 67  SPPKLTFTPSILHPNIYP-NGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMS 125
            PPK+ F   + HPNI    G +C+ IL +              WSPV +++  L+S+ +
Sbjct: 65  KPPKMKFDSKVYHPNISSVTGAICLDILKNA-------------WSPVITLKSALISLQA 111

Query: 126 MLSEPNIESGANIDACILWRDNRAEFEKQVKL 157
           +L  P      + +    +  +R  F+K   L
Sbjct: 112 LLQSPEPNDPQDAEVAQHYLRDRQSFDKTAAL 143

>YDR177W (UBC1) [1019] chr4 (816872..817519) Ubiquitin conjugating
           enzyme (E2) that plays a role early in spore
           germination, in degradation of mis-folded proteins in
           the ER, and degradation of Gal2p at the plasma membrane
           [648 bp, 215 aa]
          Length = 215

 Score = 76.6 bits (187), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 69/152 (45%), Gaps = 14/152 (9%)

Query: 7   KRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPL 66
           KR+ KE+Q +  D    I     S+ ++        GPP TPY GG F   +E P +YP 
Sbjct: 5   KRIMKEIQAVKDDPAAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPMEYPF 64

Query: 67  SPPKLTFTPSILHPNIYP-NGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMS 125
            PPK+ F   + HPNI    G +C+ IL +              WSPV +++  L+S+ +
Sbjct: 65  KPPKMQFDTKVYHPNISSVTGAICLDILKNA-------------WSPVITLKSALISLQA 111

Query: 126 MLSEPNIESGANIDACILWRDNRAEFEKQVKL 157
           +L  P      + +    +  +R  F K   L
Sbjct: 112 LLQSPEPNDPQDAEVAQHYLRDRESFNKTAAL 143

>Kwal_55.21246
          Length = 160

 Score = 72.8 bits (177), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 74/150 (49%), Gaps = 18/150 (12%)

Query: 1   MSKTAQKRLYKELQQLIKDSPPGIVAG---PKSDDNLFVWDCLIQGPPDTPYAGGVFNAQ 57
           MS+   K  YK L + +K+ P         P SDDNL+VW+  I GP DTPY G  F+  
Sbjct: 1   MSQRLAKE-YKTLLKTLKEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLL 59

Query: 58  LEFPKDYPLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYESAEERWSPVQS 115
           +  P  YPL PPK+ F    + H N+ + +G +CI++L                WSP   
Sbjct: 60  ITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLE------------RAHWSPAWD 107

Query: 116 VEKILLSVMSMLSEPNIESGANIDACILWR 145
           +  ++ ++  +L+ P  +S  ++D   L R
Sbjct: 108 LLHLVHAIWLLLANPEPDSPLDVDLACLRR 137

>Scas_599.16
          Length = 224

 Score = 74.3 bits (181), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 70/129 (54%), Gaps = 17/129 (13%)

Query: 2   SKTAQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFP 61
           +K A KRL KE + ++++  P I+A P ++DN+  W  +I GPPDTPY  G ++  L FP
Sbjct: 105 TKQALKRLTKEYKLMVENPLPYILARP-NEDNILEWHYIITGPPDTPYKDGQYHGTLTFP 163

Query: 62  KDYPLSPPKLTFTPSILHPN--IYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKI 119
            DYP  PP +     ++ PN     N  +C+S          M +   + W+P  SV  I
Sbjct: 164 SDYPYKPPAI----RMITPNGRFKDNTRLCLS----------MSDYHPDLWNPGWSVNTI 209

Query: 120 LLSVMSMLS 128
           L  ++S+++
Sbjct: 210 LNGLLSLMT 218

>CAGL0D06468g 615364..615927 similar to sp|P52491 Saccharomyces
           cerevisiae YLR306w UBC12 E2 ubiquitin-conjugating
           enzyme, start by similarity
          Length = 187

 Score = 73.2 bits (178), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/156 (30%), Positives = 78/156 (50%), Gaps = 16/156 (10%)

Query: 5   AQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDC-LIQGPPDTPYAGGVFNAQLEFPKD 63
           A+ RL K++++L  + PP +     S DN       +I  P +  Y GG F     F + 
Sbjct: 33  AKLRLQKDIEEL--ELPPTVRVNIISLDNHKEMSLNIIIIPDEGFYKGGKFRFTATFLET 90

Query: 64  YPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSV 123
           YP+ PPK+     I HPNI P+G++C++IL              E WSP   ++ I+L +
Sbjct: 91  YPIDPPKVICNNKIFHPNIDPHGKICLNILR-------------EDWSPALDLQCIVLGL 137

Query: 124 MSMLSEPNIESGANIDACILWRDNRAEFEKQVKLSI 159
           +S+  EPN     N +A  +   ++ EF   V+L++
Sbjct: 138 LSLFQEPNGNDPLNKEAAEVLNKDKLEFGNLVRLAM 173

>Sklu_1817.2 YDR177W, Contig c1817 904-1551 reverse complement
          Length = 215

 Score = 73.2 bits (178), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 70/152 (46%), Gaps = 14/152 (9%)

Query: 7   KRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPL 66
           KR+ KE+Q    D    I     S+ ++        GPP TPY GG F   ++ P +YP 
Sbjct: 5   KRIIKEIQAAKDDPEANITLSFVSESDIHHLKGSFYGPPGTPYEGGNFIVDIQVPLEYPF 64

Query: 67  SPPKLTFTPSILHPNIYP-NGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMS 125
            PPK+ F   + HPNI    G +C+ IL +              WSPV +++  L+S+ +
Sbjct: 65  KPPKMQFDTKVYHPNISSVTGAICLDILKNA-------------WSPVITLKSALISLQA 111

Query: 126 MLSEPNIESGANIDACILWRDNRAEFEKQVKL 157
           +L  P      + +    +  +++ F+K   L
Sbjct: 112 LLQSPEPNDPQDAEVAQHFIRDKSSFDKTAAL 143

>Scas_682.10
          Length = 214

 Score = 71.6 bits (174), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 68/152 (44%), Gaps = 14/152 (9%)

Query: 7   KRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPL 66
           KR+ KELQ +  D    I     ++ ++        GPP TPY GG F   +E P +YP 
Sbjct: 5   KRIMKELQAVKDDPEARIELEFVNESDIHHLKGSFLGPPGTPYEGGQFIVDIEVPMEYPF 64

Query: 67  SPPKLTFTPSILHPNIYP-NGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMS 125
            PP + F   + HPNI    G +C+ IL +              WSPV +++  L+S+ +
Sbjct: 65  KPPMMKFDTKVYHPNISSVTGAICLDILKNA-------------WSPVITLKSALISLQA 111

Query: 126 MLSEPNIESGANIDACILWRDNRAEFEKQVKL 157
           +L  P      + +    +  +R  F K   L
Sbjct: 112 LLQSPEPNDPQDAEVAQHYLKDRESFNKTAAL 143

>Kwal_23.6485
          Length = 215

 Score = 71.6 bits (174), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 72/149 (48%), Gaps = 16/149 (10%)

Query: 7   KRLYKELQQLIKDSPPGIVAGPKSDDN-LFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYP 65
           KR+ KELQ  IKD P   V     ++N + +      GPP TPY  G +   +E P +YP
Sbjct: 5   KRVMKELQA-IKDDPEARVDLQLVNENDIHLLKGSFLGPPGTPYENGKYIVDIEVPMEYP 63

Query: 66  LSPPKLTFTPSILHPNIYP-NGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVM 124
             PPK+ F   + HPN+    G +C+ IL +              WSPV +++  L+S+ 
Sbjct: 64  FKPPKMKFQTKVYHPNVSSVTGAICLDILKNA-------------WSPVITLKSALISLQ 110

Query: 125 SMLSEPNIESGANIDACILWRDNRAEFEK 153
           ++L  P      + +    +  ++A F+K
Sbjct: 111 ALLQSPEPNDPQDAEVAQHYIRDKASFDK 139

>YGR133W (PEX4) [2090] chr7 (756899..757450) Ubiquitin-conjugating
           enzyme and peroxisomal biogenesis protein (peroxin) [552
           bp, 183 aa]
          Length = 183

 Score = 70.9 bits (172), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 74/151 (49%), Gaps = 25/151 (16%)

Query: 2   SKTAQKRLYKE----LQQLIKDSP-----PGIVA--GPKSDDNLFVWDCLIQGPPDTPYA 50
           S T   R+ KE    L+ L  D P      GI+    P  + +L  W+ +I GP DTPY 
Sbjct: 15  SDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYE 74

Query: 51  GGVFNAQLEFPKDYPLSPPKLTFTP-SILHPNI-YPNGEVCISILHSPGDDPNMYESAEE 108
              F   +E P  YP++PPK++F   +ILH N+    GE+C++IL              E
Sbjct: 75  NHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL------------KPE 122

Query: 109 RWSPVQSVEKILLSVMSMLSEPNIESGANID 139
            W+PV  +   + +V  +L EP  +S  ++D
Sbjct: 123 EWTPVWDLLHCVHAVWRLLREPVCDSPLDVD 153

>Scas_621.4
          Length = 193

 Score = 68.2 bits (165), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 59/120 (49%), Gaps = 13/120 (10%)

Query: 40  LIQGPPDTPYAGGVFNAQLEFPKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDD 99
           +I  P +  Y  G F   LEF  +YP+ PPK+     I HPNI   G+VC++IL      
Sbjct: 73  VIISPDEGYYKNGHFRFSLEFNDNYPMEPPKVVCRNRIYHPNIDVQGKVCLNILR----- 127

Query: 100 PNMYESAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWRDNRAEFEKQVKLSI 159
                   E WSP   ++ I++ ++ +  EPN +   N DA  ++  +   F K V+ ++
Sbjct: 128 --------EDWSPALDLQSIIVGLLFLFLEPNAKDPLNTDAAAVFSKDSNAFAKFVRKTM 179

>Scas_551.9
          Length = 153

 Score = 65.5 bits (158), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 34/93 (36%), Positives = 50/93 (53%), Gaps = 4/93 (4%)

Query: 5   AQKRLYKELQQLIKDSPPGIVAGPK----SDDNLFVWDCLIQGPPDTPYAGGVFNAQLEF 60
           A++   K  ++  KD P G  A P        NL  W+  I G   T +A GV+   +E+
Sbjct: 59  AKRFKTKNRKKWRKDHPFGFFAKPTRHPDGSMNLQKWEAGIPGKEGTIWAEGVYPITIEY 118

Query: 61  PKDYPLSPPKLTFTPSILHPNIYPNGEVCISIL 93
           P +YP  PPK+    +  HPN+YP+G +C+SIL
Sbjct: 119 PNEYPSKPPKVKLPANFYHPNVYPSGTICLSIL 151

>YLR306W (UBC12) [3694] chr12 (744153..744155,744290..744853)
           Rub1p-conjugating enzyme, with similarity to ubiquitin-
           and ubiquitin-like protein-conjugating enzymes [567 bp,
           188 aa]
          Length = 188

 Score = 65.9 bits (159), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 72/161 (44%), Gaps = 20/161 (12%)

Query: 4   TAQKRLYKELQQLIKDSPP----GIVAGPKSDDNLFVWDCLIQGPPDTPYAG-GVFNAQL 58
            A+ RL ++L  L  D PP     ++  P S D        +   PD  Y   G  N  L
Sbjct: 27  AARIRLKRDLDSL--DLPPTVTLNVITSPDSADRSQSPKLEVIVRPDEGYYNYGSINFNL 84

Query: 59  EFPKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEK 118
           +F + YP+ PPK+     I HPNI   G VC++IL              E WSP   ++ 
Sbjct: 85  DFNEVYPIEPPKVVCLKKIFHPNIDLKGNVCLNILR-------------EDWSPALDLQS 131

Query: 119 ILLSVMSMLSEPNIESGANIDACILWRDNRAEFEKQVKLSI 159
           I+  ++ +  EPN     N DA  L  +   EF + V+L++
Sbjct: 132 IITGLLFLFLEPNPNDPLNKDAAKLLCEGEKEFAEAVRLTM 172

>CAGL0M03399g complement(389650..390294) highly similar to sp|P28263
           Saccharomyces cerevisiae YEL012w UBC8 E2
           ubiquitin-conjugating enzyme, hypothetical start
          Length = 214

 Score = 66.2 bits (160), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 81/164 (49%), Gaps = 21/164 (12%)

Query: 1   MSKTAQKRLYKELQQLI-KDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLE 59
           MS  +++R+  ++ +L+  D    +V     +D++  +     GP DTPY GGV+   +E
Sbjct: 1   MSGNSKRRIETDVMKLLMSDHEVELV-----EDSMQEFHVKFYGPKDTPYEGGVWRLHVE 55

Query: 60  FPKDYPLSPPKLTFTPSILHPNI-YPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEK 118
            P +YP   P + F   I HPNI   +G +C+ +++S              WSP+  +  
Sbjct: 56  LPDNYPYKSPSIGFVNKIFHPNIDIASGSICLDVINS-------------TWSPLYDLLN 102

Query: 119 ILLSVM-SMLSEPNIESGANIDACILWRDNRAEFEKQVKLSILK 161
           I+  ++  +L EPN     N +A  L   ++  +E++V+  I K
Sbjct: 103 IVEWMLPGLLKEPNGSDPLNNEAANLQLKDKKVYEEKVREYIDK 146

>Kwal_34.16174
          Length = 213

 Score = 65.1 bits (157), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 63/127 (49%), Gaps = 15/127 (11%)

Query: 32  DNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPLSPPKLTFTPSILHPNI-YPNGEVCI 90
           DN+  +     GP +TPY GGV+   +E P +YP   P + F   I HPNI   +G +C+
Sbjct: 15  DNMQEFHVKFHGPRETPYEGGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDAASGSICL 74

Query: 91  SILHSPGDDPNMYESAEERWSPVQSVEKILLSVM-SMLSEPNIESGANIDACILWRDNRA 149
            +++S              WSP+  +  IL  ++  +L EPN     N +A  L   ++ 
Sbjct: 75  DVINSA-------------WSPLYDLLNILEWMIPGLLKEPNGSDPLNNEAATLQLKSKE 121

Query: 150 EFEKQVK 156
            +E++++
Sbjct: 122 LYERKIR 128

>KLLA0C18656g 1654787..1655473 similar to sp|P21734 Saccharomyces
           cerevisiae YDR177w UBC1 E2 ubiquitin-conjugating enzyme,
           start by similarity
          Length = 228

 Score = 63.9 bits (154), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 60/125 (48%), Gaps = 14/125 (11%)

Query: 7   KRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPL 66
           KR+ KE+Q + +D    I     ++ ++        GP  TPY GG F   +  P +YP 
Sbjct: 5   KRILKEIQAVKEDPEAQIELKFVNESDIHHMKGSFIGPSGTPYEGGKFVVDINIPVEYPY 64

Query: 67  SPPKLTFTPSILHPNIYP-NGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMS 125
            PP++ F   + HPN+    G +C+ IL +              W+PV +++  L+S+ +
Sbjct: 65  KPPQMKFDTKVYHPNVSSVTGAICLDILKNA-------------WTPVITLKSALISLQA 111

Query: 126 MLSEP 130
           +L  P
Sbjct: 112 LLQSP 116

>KLLA0A11198g
           join(complement(974525..974529),
           complement(973755..974358)) similar to sp|P28263
           Saccharomyces cerevisiae YEL012w UBC8 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 202

 Score = 62.8 bits (151), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 78/164 (47%), Gaps = 21/164 (12%)

Query: 1   MSKTAQKRLYKELQQLI-KDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLE 59
           MS  +++R+  ++ +L+  D    +V     +D +  +     GP DTPY  GV+   +E
Sbjct: 1   MSSNSKRRIETDVMKLLMSDHDVELV-----EDKMQEFHIKFHGPKDTPYEKGVWRLHVE 55

Query: 60  FPKDYPLSPPKLTFTPSILHPNI-YPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEK 118
            P +YP   P + F   I HPNI   +G +C+ +++S              WSP+  +  
Sbjct: 56  LPDNYPYKSPSIGFVNKIFHPNIDAASGSICLDVINST-------------WSPLYDLLN 102

Query: 119 ILLSVM-SMLSEPNIESGANIDACILWRDNRAEFEKQVKLSILK 161
           I+  ++  +L EPN     N +A  L   ++  +E+++   I K
Sbjct: 103 IVEWMIPGLLKEPNGSDPLNNEAATLQLKDKDMYEQKIHEYINK 146

>YEL012W (UBC8) [1413] chr5 (131772..131776,131900..132551)
           Ubiquitin-conjugating enzyme involved in the catabolite
           degradation of fructose-1,6-bisphosphate [657 bp, 218
           aa]
          Length = 218

 Score = 62.0 bits (149), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 60/121 (49%), Gaps = 15/121 (12%)

Query: 43  GPPDTPYAGGVFNAQLEFPKDYPLSPPKLTFTPSILHPNI-YPNGEVCISILHSPGDDPN 101
           GP DTPY  GV+   +E P +YP   P + F   I HPNI   +G +C+ +++S      
Sbjct: 38  GPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDIASGSICLDVINST----- 92

Query: 102 MYESAEERWSPVQSVEKILLSVM-SMLSEPNIESGANIDACILWRDNRAEFEKQVKLSIL 160
                   WSP+  +  I+  ++  +L EPN     N +A  L   ++  +E+++K  I 
Sbjct: 93  --------WSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLRDKKLYEEKIKEYID 144

Query: 161 K 161
           K
Sbjct: 145 K 145

>AEL045W [2461] [Homologous to ScYEL012W (UBC8) - SH]
           complement(549376..549380,549444..550074) [636 bp, 211
           aa]
          Length = 211

 Score = 61.6 bits (148), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 63/133 (47%), Gaps = 15/133 (11%)

Query: 31  DDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPLSPPKLTFTPSILHPNI-YPNGEVC 89
           DDN+  +     GP  TPY  GV+   +E P +YP   P + F   I HPNI   +G +C
Sbjct: 26  DDNMQEFHVKFHGPKGTPYERGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDAASGSIC 85

Query: 90  ISILHSPGDDPNMYESAEERWSPVQSVEKILLSVM-SMLSEPNIESGANIDACILWRDNR 148
           + +++S              WSP+  +  I+  ++  +L EPN     N +A  L   N 
Sbjct: 86  LDVINS-------------TWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATLQLKNP 132

Query: 149 AEFEKQVKLSILK 161
             +E++++  I K
Sbjct: 133 QMYEEKIQEYIDK 145

>Scas_712.59
          Length = 171

 Score = 60.1 bits (144), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 60/122 (49%), Gaps = 14/122 (11%)

Query: 28  PKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPLSPPKLTFTP-SILHPNI-YPN 85
           P S  +L  W   I+GP  TPYA   F  Q+E P  YP+ PP + F P S+ H N+ +  
Sbjct: 39  PISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQT 98

Query: 86  GEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWR 145
           G +C+ IL             ++ W+P  ++   + ++  +L +P  +S  N+D   + R
Sbjct: 99  GAICLDIL------------EKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILR 146

Query: 146 DN 147
            N
Sbjct: 147 VN 148

>Scas_694.33
          Length = 231

 Score = 60.8 bits (146), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 60/123 (48%), Gaps = 15/123 (12%)

Query: 41  IQGPPDTPYAGGVFNAQLEFPKDYPLSPPKLTFTPSILHPNI-YPNGEVCISILHSPGDD 99
             GP DTPY  GV+   +E P +YP   P + F   I HPNI   +G +C+ +++S    
Sbjct: 59  FHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDIASGSICLDVINST--- 115

Query: 100 PNMYESAEERWSPVQSVEKILLSVM-SMLSEPNIESGANIDACILWRDNRAEFEKQVKLS 158
                     WSP+  +  I+  ++  +L EPN     N +A  L   ++  +E++++  
Sbjct: 116 ----------WSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATLELRDKKLYEEKIREY 165

Query: 159 ILK 161
           I K
Sbjct: 166 IDK 168

>KLLA0E03916g complement(365119..365595) similar to sp|P29340
           Saccharomyces cerevisiae YGR133w PAS2 E2
           ubiquitin-conjugating enzyme - peroxin, start by
           similarity
          Length = 158

 Score = 57.8 bits (138), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 73/137 (53%), Gaps = 24/137 (17%)

Query: 27  GPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKD---YPLS-PPKLTFTP-SILHPN 81
            P  DD+L  W C  QGP ++P+ G  F   L    D   YP+S  P++ F P ++ HPN
Sbjct: 27  APVDDDDLSEWVCRFQGPSESPFEG--FELGLNITIDLEKYPISGGPRVLFEPRTVAHPN 84

Query: 82  I-YPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDA 140
           + +  GE+C+ +L             ++ W+P+ ++  ++ ++  +L++P ++S  ++D 
Sbjct: 85  VKWDTGEICLDLL-------------KDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDI 131

Query: 141 CILWRDNRAEFEKQVKL 157
             ++    A++E  V++
Sbjct: 132 AQIY---DADYEAYVQI 145

>CAGL0I10450g complement(1024541..1025029) similar to sp|P29340
           Saccharomyces cerevisiae YGR133w ubiquitin-conjugating
           enzyme - peroxin, hypothetical start
          Length = 162

 Score = 57.8 bits (138), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 69/153 (45%), Gaps = 25/153 (16%)

Query: 8   RLYKELQQLIK-----DSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPK 62
           R+ KEL ++ K     DS   +   P  D +L  W  +I+GP +TPY    F   +E P 
Sbjct: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62

Query: 63  DYPLSPPKLTFTPSIL-------HPNI-YPNGEVCISILHSPGDDPNMYESAEERWSPVQ 114
            YP+ PP + F            H N+    GE+C+ IL   G            WSP+ 
Sbjct: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEG------------WSPIW 110

Query: 115 SVEKILLSVMSMLSEPNIESGANIDACILWRDN 147
            +  ++ ++  +L EP  +S  ++D   + ++N
Sbjct: 111 DILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143

>KLLA0C17248g complement(1509885..1510439) similar to sp|P52491
           Saccharomyces cerevisiae YLR306w UBC12 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 184

 Score = 57.4 bits (137), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 51/111 (45%), Gaps = 13/111 (11%)

Query: 49  YAGGVFNAQLEFPKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEE 108
           YAGG +   +     YP+ PP +     I HPNI  +G VC+++L              E
Sbjct: 72  YAGGTYYFNVFIKDTYPMEPPVVKCMHRIYHPNIDIDGNVCLNLL-------------RE 118

Query: 109 RWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWRDNRAEFEKQVKLSI 159
            W+P   ++ I++ ++ +  EPN     N DA     ++   FE +V  S+
Sbjct: 119 DWTPALDIQSIIIGILFLFHEPNGRDPLNKDAAKTLIEDPLRFENKVNHSL 169

>ADL035C [1707] [Homologous to ScYLR306W (UBC12) - SH]
           (634059..634610,634663..634713) [603 bp, 200 aa]
          Length = 200

 Score = 50.8 bits (120), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 54/117 (46%), Gaps = 13/117 (11%)

Query: 44  PPDTPYAGGVFNAQLEFPKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMY 103
           P +  Y GG F   + F   YP+ PP +    +I HPNI  +G +C+++L          
Sbjct: 83  PEEGVYRGGHFRFSVVFRDTYPIEPPTVKCLNTIYHPNIDYSGNICLNVL---------- 132

Query: 104 ESAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWRDNRAEFEKQVKLSIL 160
               E WSPV  ++ ++L ++ +  EPN     N  A      +   FE  V+ +++
Sbjct: 133 ---REDWSPVMDLQTVVLGLLFLFLEPNGSDPLNRQAADTMLRDPYRFETNVQATMM 186

>YGL087C (MMS2) [1895] chr7
           complement(346407..346809,346895..346905)
           Ubiquitin-conjugating enzyme variant (UEV) protein
           required for resistance to DNA damaging agents and
           non-proteolytic multi-ubiquitination of Pol30p (PCNA)
           [414 bp, 137 aa]
          Length = 137

 Score = 41.6 bits (96), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 60/134 (44%), Gaps = 15/134 (11%)

Query: 1   MSKTAQK-RLYKELQQLIKD-SPPGIVAGPKSDDNLFV--WDCLIQGPPDTPYAGGVFNA 56
           MSK  +  RL +EL++  K   P     G    D++ +  W+  I GPP + +   +++ 
Sbjct: 1   MSKVPRNFRLLEELEKGEKGFGPESCSYGLADSDDITMTKWNGTILGPPHSNHENRIYSL 60

Query: 57  QLEFPKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSV 116
            ++   +YP SPPK+TF   I  P + P      +  H+  D           W    ++
Sbjct: 61  SIDCGPNYPDSPPKVTFISKINLPCVNPTTGEVQTDFHTLRD-----------WKRAYTM 109

Query: 117 EKILLSVMSMLSEP 130
           E +LL +   ++ P
Sbjct: 110 ETLLLDLRKEMATP 123

>AFL064W [3129] [Homologous to ScYGL087C (MMS2) - SH]
           complement(314210..314220,314273..314678) [417 bp, 138
           aa]
          Length = 138

 Score = 40.0 bits (92), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 51/105 (48%), Gaps = 9/105 (8%)

Query: 1   MSKTAQK-RLYKELQQLIKDSPP-----GIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVF 54
           MSK  +  RL +EL++  K   P     G+  G   D ++  W+  I GPP + +   ++
Sbjct: 1   MSKVPRSFRLLEELEKGEKGMGPESCSYGLADG--DDISMTHWNGTILGPPHSSHENRIY 58

Query: 55  NAQLEFPKDYPLSPPKLTFTPSILHPNIYPN-GEVCISILHSPGD 98
           +  +E   +YP  PPK+ F   I  P + P+ GEV     H+  D
Sbjct: 59  SVVIECGAEYPDRPPKVRFISRINLPCVDPSTGEVRPEAFHALRD 103

>KLLA0E19217g join(complement(1703226..1703236), highly similar to
           sp|P53152 Saccharomyces cerevisiae YGL087c MMS2 part of
           the error-free postreplication repair pathway singleton,
           start by similarity
          Length = 139

 Score = 37.7 bits (86), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 59/136 (43%), Gaps = 16/136 (11%)

Query: 1   MSKTAQK-RLYKELQQLIKD-SPPGIVAGPKSDDNLFV--WDCLIQGPPDTPYAGGVFNA 56
           MSK  +  RL +EL++  K   P     G    D++ +  W+  I GPP + +   +++ 
Sbjct: 1   MSKVPRSFRLLEELEKGEKGLGPESCSYGLSDSDDITMTKWNGTILGPPHSNHENRIYSV 60

Query: 57  QLEFPKDYPLSPPKLTFTPSILHPNI-YPNGEVCISILHSPGDDPNMYESAEERWSPVQS 115
            +E    YP  PPK+ F   I  P +    GEV     H+  +           W    +
Sbjct: 61  LIECGPSYPDEPPKVKFVSKINLPCVNSTTGEVVKEKFHTLKE-----------WKRSYT 109

Query: 116 VEKILLSVMSMLSEPN 131
           +E +LL +   ++ P+
Sbjct: 110 METVLLELRKEMATPS 125

>CAGL0H03157g
           join(complement(297881..297891),
           complement(297272..297680)) highly similar to sp|P53152
           Saccharomyces cerevisiae YGL087c MMS2 part of the
           error-free postreplication repair pathway
          Length = 139

 Score = 37.4 bits (85), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 59/135 (43%), Gaps = 16/135 (11%)

Query: 1   MSKTAQK-RLYKELQQLIKD-SPPGIVAGPKSDDNLFV--WDCLIQGPPDTPYAGGVFNA 56
           MSK  +  RL +EL++  K   P     G    D++ +  W+  I GPP + +   +++ 
Sbjct: 1   MSKVPRSFRLLEELEKGEKGLGPESCSYGLADADDITMTRWNGTILGPPHSNHENRIYSV 60

Query: 57  QLEFPKDYPLSPPKLTFTPSILHPNI-YPNGEVCISILHSPGDDPNMYESAEERWSPVQS 115
            +E    YP  PP +TF   I  P +    GEV     ++  D           W  + +
Sbjct: 61  SIECGPKYPDEPPTITFISKINLPCVDQSTGEVNKEKFNTLKD-----------WKRLYN 109

Query: 116 VEKILLSVMSMLSEP 130
           +E ILL +   ++ P
Sbjct: 110 METILLDLRKEMASP 124

>Scas_720.10*
          Length = 134

 Score = 35.4 bits (80), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 54/127 (42%), Gaps = 15/127 (11%)

Query: 8   RLYKELQQLIKD-SPPGIVAGPKSDDNLFV--WDCLIQGPPDTPYAGGVFNAQLEFPKDY 64
           RL +EL++  K   P     G    D++ +  W+  I GPP + +   +++  +     Y
Sbjct: 5   RLLEELEKGEKGLGPESCSYGLADSDDITMTKWNGTILGPPHSNHENRIYSVAIHCGPHY 64

Query: 65  PLSPPKLTFTPSILHPNI-YPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSV 123
           P +PP + F   I  P +    GEV  +  H+  D           W    ++E +LL +
Sbjct: 65  PDAPPTIKFVSKINLPCVDEKTGEVKQASFHTLRD-----------WKRSYTMETLLLDL 113

Query: 124 MSMLSEP 130
              ++ P
Sbjct: 114 RKEMASP 120

>Kwal_27.11182
          Length = 101

 Score = 33.9 bits (76), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 41/97 (42%), Gaps = 10/97 (10%)

Query: 34  LFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPLSPPKLTFTPSILHPNIYPNGEVCISIL 93
           +  W+  I GPP + +   +++  LE    YP  PPK+ F   I  P        C++  
Sbjct: 1   MTYWNGTILGPPHSNHENRIYSVALECGNAYPDEPPKIKFISKINLP--------CVN-- 50

Query: 94  HSPGDDPNMYESAEERWSPVQSVEKILLSVMSMLSEP 130
            + G+      S    W    ++E +LL +   ++ P
Sbjct: 51  QTTGEVKRDQFSTLRDWKRSYNMETLLLDLRKEMALP 87

>YDR403W (DIT1) [1229] chr4 (1274590..1276200) First enzyme in the
           pathway for biosynthesis of dityrosine in the outer
           layer of the spore wall; expressed late (10-16 hr) in
           sporulation [1611 bp, 536 aa]
          Length = 536

 Score = 27.7 bits (60), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (2%)

Query: 5   AQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCL 40
           A KRL K  Q L+K  PPG+     SD ++F  DC+
Sbjct: 243 ALKRLIKATQDLVKIYPPGMKIWIVSDGHVFS-DCI 277

>CAGL0M05643g 603919..604449 similar to sp|Q07540 Saccharomyces
           cerevisiae YDL120w YFH1 regulates mitochondrial iron
           accumulation, hypothetical start
          Length = 176

 Score = 26.9 bits (58), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 38/81 (46%), Gaps = 9/81 (11%)

Query: 52  GVFNAQLEFPKDYPLSPPKLTFTPSILHPNIYPNGEVCISI--------LHSPGDDPNMY 103
           G+F+   E  ++YP   P++ ++  ++   +   G   I+         L SP   PN +
Sbjct: 77  GLFDNLEELSENYPQHIPEVEYSHGVMSLTVAGVGTYVINKQPPNKQIWLSSPNSGPNRF 136

Query: 104 ESAEERWSPVQSVEKILLSVM 124
           +  +  W  +++ E  LLSV+
Sbjct: 137 DLYKGEWISLRNNE-TLLSVL 156

>CAGL0G06182g 589050..591095 similar to sp|P38835 Saccharomyces
           cerevisiae YHR131c, start by similarity
          Length = 681

 Score = 26.9 bits (58), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 25/55 (45%), Gaps = 2/55 (3%)

Query: 40  LIQGPPDTP--YAGGVFNAQLEFPKDYPLSPPKLTFTPSILHPNIYPNGEVCISI 92
           +I G P +P  Y    +N  + FP    L+P  +T  P   HP +Y    V + +
Sbjct: 54  IIDGEPASPPDYDEVNYNRHVTFPIWEDLTPCSMTEKPPAYHPTVYNVAIVSVKL 108

>Kwal_27.9681
          Length = 396

 Score = 26.9 bits (58), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 2/38 (5%)

Query: 104 ESAEERWSPVQSVEKILLS--VMSMLSEPNIESGANID 139
           ++A   W P + +E+I +S  V+  + EP  ESG N+D
Sbjct: 143 QAAWSGWKPFKVMERIKVSNDVVEFIVEPKPESGLNLD 180

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.135    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,906,604
Number of extensions: 256942
Number of successful extensions: 568
Number of sequences better than 10.0: 90
Number of HSP's gapped: 496
Number of HSP's successfully gapped: 90
Length of query: 163
Length of database: 16,596,109
Length adjustment: 94
Effective length of query: 69
Effective length of database: 13,342,017
Effective search space: 920599173
Effective search space used: 920599173
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 57 (26.6 bits)