Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M06875g33933415960.0
YNL025C (SSN8)32333512591e-175
Scas_666.2633534212281e-170
Sklu_2251.929933411591e-160
ADL207W36033511481e-158
Kwal_27.1149429933410801e-148
KLLA0E08151g30433810241e-140
KLLA0E06666g3981511455e-10
YPR025C (CCL1)3931551411e-09
Scas_672.123741551393e-09
CAGL0K05115g3671571322e-08
Kwal_27.106413761631295e-08
AGL273C3991711101e-05
YPR119W (CLB2)491181780.092
YGR109C (CLB6)38031710.68
CAGL0D04620g476141701.0
CAGL0M11044g37992691.2
Scas_684.18330172671.7
Scas_705.15479129672.2
AFR179C70042672.4
YGR070W (ROM1)1155117672.5
Scas_716.18d43273637.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M06875g
         (334 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M06875g complement(699260..700279) highly similar to sp|P47...   619   0.0  
YNL025C (SSN8) [4561] chr14 complement(584318..585289) Cyclin C ...   489   e-175
Scas_666.26                                                           477   e-170
Sklu_2251.9 YNL025C, Contig c2251 9078-9977 reverse complement        451   e-160
ADL207W [1534] [Homologous to ScYNL025C (SSN8) - SH] complement(...   446   e-158
Kwal_27.11494                                                         420   e-148
KLLA0E08151g complement(737811..738725) similar to sp|P47821 Sac...   399   e-140
KLLA0E06666g 605566..606762 similar to sgd|S0006229 Saccharomyce...    60   5e-10
YPR025C (CCL1) [5459] chr16 complement(613372..614553) Cyclin C ...    59   1e-09
Scas_672.12                                                            58   3e-09
CAGL0K05115g complement(497262..498365) similar to sp|P37366 Sac...    55   2e-08
Kwal_27.10641                                                          54   5e-08
AGL273C [4039] [Homologous to ScYPR025C (CCL1) - SH] (194015..19...    47   1e-05
YPR119W (CLB2) [5540] chr16 (771649..773124) G2/M-phase-specific...    35   0.092
YGR109C (CLB6) [2068] chr7 complement(705361..706503) B-type cyc...    32   0.68 
CAGL0D04620g 453500..454930 highly similar to sp|P24869 Saccharo...    32   1.0  
CAGL0M11044g 1090429..1091568 weakly similar to sp|P24869 Saccha...    31   1.2  
Scas_684.18                                                            30   1.7  
Scas_705.15                                                            30   2.2  
AFR179C [3371] [Homologous to ScYBL024W (NCL1) - SH] (766461..76...    30   2.4  
YGR070W (ROM1) [2031] chr7 (627808..631275) GDP-GTP exchange fac...    30   2.5  
Scas_716.18d                                                           29   7.4  

>CAGL0M06875g complement(699260..700279) highly similar to sp|P47821
           Saccharomyces cerevisiae YNL025c SSN8, start by
           similarity
          Length = 339

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/334 (90%), Positives = 302/334 (90%)

Query: 1   MSGSYWTSMQRQKWQHTKPSLARERQRLWVMECQLFPQGLNIIVDSKPXXXXXXXXXXXX 60
           MSGSYWTSMQRQKWQHTKPSLARERQRLWVMECQLFPQGLNIIVDSKP            
Sbjct: 1   MSGSYWTSMQRQKWQHTKPSLARERQRLWVMECQLFPQGLNIIVDSKPNSADSSNGNAAN 60

Query: 61  XXXXXXRSQLVATTKNIPITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIY 120
                 RSQLVATTKNIPITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIY
Sbjct: 61  NGGGNGRSQLVATTKNIPITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIY 120

Query: 121 LSRFLLKASVREVNLYLLVTTCVYLACKVEECPQYIRTLVSEARSLWPEFIPPDPTKVTE 180
           LSRFLLKASVREVNLYLLVTTCVYLACKVEECPQYIRTLVSEARSLWPEFIPPDPTKVTE
Sbjct: 121 LSRFLLKASVREVNLYLLVTTCVYLACKVEECPQYIRTLVSEARSLWPEFIPPDPTKVTE 180

Query: 181 FEFYLIEELQCYLIVHHPYKSMEQIVEALKEEPFKLTFTSDELQNCWSLINDSFINDVHL 240
           FEFYLIEELQCYLIVHHPYKSMEQIVEALKEEPFKLTFTSDELQNCWSLINDSFINDVHL
Sbjct: 181 FEFYLIEELQCYLIVHHPYKSMEQIVEALKEEPFKLTFTSDELQNCWSLINDSFINDVHL 240

Query: 241 TYAPHIIAMACLFITVSIQGSNTKELSLTSAVTEXXXXXXXXXXXXXXFFRFLAESHVDL 300
           TYAPHIIAMACLFITVSIQGSNTKELSLTSAVTE              FFRFLAESHVDL
Sbjct: 241 TYAPHIIAMACLFITVSIQGSNTKELSLTSAVTETLTSQSSLTPQQQTFFRFLAESHVDL 300

Query: 301 EEVMDTIQQQIILYDHWDRYHEPWIKYLLHTLYL 334
           EEVMDTIQQQIILYDHWDRYHEPWIKYLLHTLYL
Sbjct: 301 EEVMDTIQQQIILYDHWDRYHEPWIKYLLHTLYL 334

>YNL025C (SSN8) [4561] chr14 complement(584318..585289) Cyclin C
           homolog, component of RNA polymerase holoenzyme complex
           and Kornberg's mediator (SRB) subcomplex [972 bp, 323
           aa]
          Length = 323

 Score =  489 bits (1259), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 242/335 (72%), Positives = 274/335 (81%), Gaps = 19/335 (5%)

Query: 1   MSGSYWTSMQRQKWQHTKPSLARERQRLWVMECQLFPQGLNIIVDSKPXXXXXXXXXXXX 60
           MSGS+WTS QR  WQ+TK SLA+ERQ+LW++ECQLFPQGLNI++DSK             
Sbjct: 1   MSGSFWTSTQRHHWQYTKASLAKERQKLWLLECQLFPQGLNIVMDSKQNGIEQ------- 53

Query: 61  XXXXXXRSQLVATTKNIPITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIY 120
                      + TKNIPITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIY
Sbjct: 54  -----------SITKNIPITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIY 102

Query: 121 LSRFLLKASVREVNLYLLVTTCVYLACKVEECPQYIRTLVSEARSLWPEFIPPDPTKVTE 180
           LSRFL+KASVRE+NLY+LVTTCVYLACKVEECPQYIRTLVSEAR+LWPEFIPPDPTKVTE
Sbjct: 103 LSRFLIKASVREINLYMLVTTCVYLACKVEECPQYIRTLVSEARTLWPEFIPPDPTKVTE 162

Query: 181 FEFYLIEELQCYLIVHHPYKSMEQIVEALKEEPFKLTFTSDELQNCWSLINDSFINDVHL 240
           FEFYL+EEL+ YLIVHHPY+S++QIV+ LK+ PF++T +SD+LQNCWSLINDS+INDVHL
Sbjct: 163 FEFYLLEELESYLIVHHPYQSLKQIVQVLKQPPFQITLSSDDLQNCWSLINDSYINDVHL 222

Query: 241 TYAPHIIAMACLFITVSIQGSNTKELSLTSAVTEXXXX-XXXXXXXXXXFFRFLAESHVD 299
            Y PHIIA+ACLFIT+SI G  TK  SL SA +E               F RF+AES VD
Sbjct: 223 LYPPHIIAVACLFITISIHGKPTKGSSLASAASEAIRDPKNSSSPVQIAFNRFMAESLVD 282

Query: 300 LEEVMDTIQQQIILYDHWDRYHEPWIKYLLHTLYL 334
           LEEVMDTIQ+QI LYDHWD+YHE WIK+LLHTLYL
Sbjct: 283 LEEVMDTIQEQITLYDHWDKYHEQWIKFLLHTLYL 317

>Scas_666.26
          Length = 335

 Score =  477 bits (1228), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 233/342 (68%), Positives = 266/342 (77%), Gaps = 22/342 (6%)

Query: 1   MSGSYWTSMQRQKWQHTKPSLARERQRLWVMECQLFPQGLNIIVDS-KPXXXXXXXXXXX 59
           MSGSYWTS QR  WQ TK SLA+ERQ+LW++ECQLFPQGLNI +D+ KP           
Sbjct: 1   MSGSYWTSTQRHNWQFTKTSLAKERQKLWILECQLFPQGLNITMDAPKPNSSDNSNGTI- 59

Query: 60  XXXXXXXRSQLVATTKNIPITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHI 119
                     +  TTKNIPITHRDLHYD+DYNLRIYCYFLIMKLGRRLNIRQ ALATAHI
Sbjct: 60  ----------MRPTTKNIPITHRDLHYDRDYNLRIYCYFLIMKLGRRLNIRQCALATAHI 109

Query: 120 YLSRFLLKASVREVNLYLLVTTCVYLACKVEECPQYIRTLVSEARSLWPEFIPPDPTKVT 179
           YLSRFLL+ SVREVNLYLLVTT VYLACKVEECPQYIRTLVSEARSLWPEF+PPDPTKVT
Sbjct: 110 YLSRFLLRTSVREVNLYLLVTTTVYLACKVEECPQYIRTLVSEARSLWPEFVPPDPTKVT 169

Query: 180 EFEFYLIEELQCYLIVHHPYKSMEQIVEALKEEPFKLTFTSDELQNCWSLINDSFINDVH 239
           EFEFYL+EEL+ YLIVHHPY+ +EQIVE LK EPF+L  T+D+LQNCWSLINDS+I D +
Sbjct: 170 EFEFYLLEELESYLIVHHPYRPLEQIVETLKMEPFQLNLTADDLQNCWSLINDSYITDAN 229

Query: 240 LTYAPHIIAMACLFITVSIQ-------GSNTKELSLTSAVTEXXXXXXXXXXXXXXFFRF 292
           L Y PHIIAM+CLFIT++++         NTK  +L   +T               F  +
Sbjct: 230 LIYPPHIIAMSCLFITIALKNIDANVGNGNTKNDNL---ITRALSGENGMSKTQEVFNLY 286

Query: 293 LAESHVDLEEVMDTIQQQIILYDHWDRYHEPWIKYLLHTLYL 334
           +A+S VDLEEVMDTIQ+QI LYDHWD+YHEPW+K+LLHTLYL
Sbjct: 287 MAQSQVDLEEVMDTIQEQITLYDHWDKYHEPWVKFLLHTLYL 328

>Sklu_2251.9 YNL025C, Contig c2251 9078-9977 reverse complement
          Length = 299

 Score =  451 bits (1159), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 217/334 (64%), Positives = 257/334 (76%), Gaps = 37/334 (11%)

Query: 1   MSGSYWTSMQRQKWQHTKPSLARERQRLWVMECQLFPQGLNIIVDSKPXXXXXXXXXXXX 60
           MS SYW S QR KWQ+T+ SLARERQ LW+MECQLFP GL+I++++              
Sbjct: 1   MSASYWESTQRHKWQYTRESLARERQNLWLMECQLFPHGLSIVMENSKNG---------- 50

Query: 61  XXXXXXRSQLVATTKNIPITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIY 120
                   Q  + T+NIPI+H+DLHYDKDYNLRIYCYFLIMKLGRRLNIRQ ALATAH+Y
Sbjct: 51  -------GQQQSITRNIPISHKDLHYDKDYNLRIYCYFLIMKLGRRLNIRQCALATAHVY 103

Query: 121 LSRFLLKASVREVNLYLLVTTCVYLACKVEECPQYIRTLVSEARSLWPEFIPPDPTKVTE 180
           LSRFLLKAS+REVNLYLLVTTC+YLACKVEECPQ+IRTLV+EARSLWPEF+PPDPTKVTE
Sbjct: 104 LSRFLLKASIREVNLYLLVTTCIYLACKVEECPQHIRTLVNEARSLWPEFVPPDPTKVTE 163

Query: 181 FEFYLIEELQCYLIVHHPYKSMEQIVEALKEEPFKLTFTSDELQNCWSLINDSFINDVHL 240
           FEFYLIEELQ YLIVHHPY+SME IV +L+EEP++L  + ++LQN WSLINDS+I D+HL
Sbjct: 164 FEFYLIEELQSYLIVHHPYRSMEHIVSSLREEPYQLALSPEDLQNSWSLINDSYITDLHL 223

Query: 241 TYAPHIIAMACLFITVSIQGSNTKELSLTSAVTEXXXXXXXXXXXXXXFFRFLAESHVDL 300
            Y PH+IAMAC+FITV ++ S +                         F RF+AES VDL
Sbjct: 224 MYPPHVIAMACMFITVCLKKSVSHR--------------------QQTFNRFMAESQVDL 263

Query: 301 EEVMDTIQQQIILYDHWDRYHEPWIKYLLHTLYL 334
           +EVM+ IQ  I LYDHWD+Y+EPWIK+LLHT+YL
Sbjct: 264 QEVMNVIQDLITLYDHWDKYNEPWIKFLLHTVYL 297

>ADL207W [1534] [Homologous to ScYNL025C (SSN8) - SH]
           complement(339219..340301) [1083 bp, 360 aa]
          Length = 360

 Score =  446 bits (1148), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 214/335 (63%), Positives = 253/335 (75%), Gaps = 39/335 (11%)

Query: 1   MSGSYWTSMQRQKWQHTKPSLARERQRLWVMECQLFPQGLNIIVDSKPXXXXXXXXXXXX 60
           MS SYW S QR KWQ+++ SLAR RQ+LW++ECQL+PQG NI+++               
Sbjct: 29  MSASYWDSSQRNKWQYSRESLARTRQKLWMLECQLYPQGTNILMEGG------------- 75

Query: 61  XXXXXXRSQLVATTKNIPITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIY 120
                        TKNIPITHRDLHYD+DYNLRIYCYFLIMKLGRRLN+RQYALATAH+Y
Sbjct: 76  ------GKDAQPVTKNIPITHRDLHYDRDYNLRIYCYFLIMKLGRRLNVRQYALATAHVY 129

Query: 121 LSRFLLKASVREVNLYLLVTTCVYLACKVEECPQYIRTLVSEARSLWPEFIPPDPTKVTE 180
           L+RF LKAS+REVNLYLLVTTC+YLACKVEECPQ+IRTLV+EARSLWPEF+PPDPTKVTE
Sbjct: 130 LARFCLKASIREVNLYLLVTTCIYLACKVEECPQHIRTLVNEARSLWPEFVPPDPTKVTE 189

Query: 181 FEFYLIEELQCYLIVHHPYKSMEQIVEALKEEPFKLTFTSDELQNCWSLINDSFINDVHL 240
           FEFYLIEELQ Y+IVH+PY++MEQI  AL+  P+ L  + D+LQN WSLINDS+I DVHL
Sbjct: 190 FEFYLIEELQSYMIVHYPYRAMEQIAAALRRPPYNLVLSPDDLQNSWSLINDSYITDVHL 249

Query: 241 TYAPHIIAMACLFITVSIQ-GSNTKELSLTSAVTEXXXXXXXXXXXXXXFFRFLAESHVD 299
            Y PH+IAMACLFITV ++  +  ++L  T                   F RF+A+S VD
Sbjct: 250 LYPPHVIAMACLFITVCLRSAAGARDLQET-------------------FNRFMADSQVD 290

Query: 300 LEEVMDTIQQQIILYDHWDRYHEPWIKYLLHTLYL 334
           L EVMDTIQ  I LYDHWD+Y+EPWIK+LLH LYL
Sbjct: 291 LHEVMDTIQDFITLYDHWDKYNEPWIKFLLHNLYL 325

>Kwal_27.11494
          Length = 299

 Score =  420 bits (1080), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 205/334 (61%), Positives = 246/334 (73%), Gaps = 38/334 (11%)

Query: 1   MSGSYWTSMQRQKWQHTKPSLARERQRLWVMECQLFPQGLNIIVDSKPXXXXXXXXXXXX 60
           MS SYW S QR KWQ+T+  L RER +LW++ECQLFPQGL + +++              
Sbjct: 1   MSASYWESTQRLKWQYTREGLFRERHQLWLLECQLFPQGLTVTMENN------------- 47

Query: 61  XXXXXXRSQLVATTKNIPITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIY 120
                 +      ++NIPITH D+HY KD+NLRIYCYFLIMKLGRRLNIRQYALATAH+Y
Sbjct: 48  ------KGTGEPVSRNIPITHIDMHYGKDFNLRIYCYFLIMKLGRRLNIRQYALATAHVY 101

Query: 121 LSRFLLKASVREVNLYLLVTTCVYLACKVEECPQYIRTLVSEARSLWPEFIPPDPTKVTE 180
           L+RFLL+ASVREVNLYLLVTTC+YLACKVEECPQ+IRTLV+EARSLWPEF+PPDPTKVTE
Sbjct: 102 LARFLLRASVREVNLYLLVTTCIYLACKVEECPQHIRTLVNEARSLWPEFVPPDPTKVTE 161

Query: 181 FEFYLIEELQCYLIVHHPYKSMEQIVEALKEEPFKLTFTSDELQNCWSLINDSFINDVHL 240
           FEFYL+EELQ YL+VHHPY++MEQIV AL+ EP+ LT ++ +LQN WSLINDS+I D+HL
Sbjct: 162 FEFYLLEELQSYLVVHHPYRAMEQIVTALRAEPYNLTLSATDLQNSWSLINDSYITDLHL 221

Query: 241 TYAPHIIAMACLFITVSIQGSNTKELSLTSAVTEXXXXXXXXXXXXXXFFRFLAESHVDL 300
              PH+IAMA L I V +Q  +      T                   F  F+A+S VDL
Sbjct: 222 LVPPHVIAMASLLIIVCLQRPHRPAHQET-------------------FNNFMAKSQVDL 262

Query: 301 EEVMDTIQQQIILYDHWDRYHEPWIKYLLHTLYL 334
            EVMDTIQ  I LYD+WD+Y+EPWIK+LLH LYL
Sbjct: 263 AEVMDTIQDLITLYDYWDKYNEPWIKFLLHCLYL 296

>KLLA0E08151g complement(737811..738725) similar to sp|P47821
           Saccharomyces cerevisiae YNL025c SSN8 DNA-directed RNA
           polymerase II holoenzyme and Kornberg s mediator (SRB)
           subcomplex subunit, cyclin C homolog singleton, start by
           similarity
          Length = 304

 Score =  399 bits (1024), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 201/338 (59%), Positives = 241/338 (71%), Gaps = 46/338 (13%)

Query: 1   MSGSYWTSMQRQKWQHTKPSLARERQRLWVMECQLFPQGLNIIV-DSKPXXXXXXXXXXX 59
           MS SYW S QR KW++T+ SLA+E+Q+LW++ECQLFPQGLN+ + DSK            
Sbjct: 1   MSASYWDSSQRHKWKYTRESLAKEKQKLWLLECQLFPQGLNVTIHDSKANK--------- 51

Query: 60  XXXXXXXRSQLVATTKNIPITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHI 119
                         T NIP+T RDLHYD+DYNLRIYCYFLIMKLGRRLNIRQ AL TAH+
Sbjct: 52  ------------QVTTNIPVTQRDLHYDRDYNLRIYCYFLIMKLGRRLNIRQCALVTAHV 99

Query: 120 YLSRFLLKASVREVNLYLLVTTCVYLACKVEECPQYIRTLVSEARSLWPEFIPPDPTKVT 179
           YLSRFLL+ASVREVNLYLL+TTC+YLACKVEECPQ+IRTLV+EARSLWPEFIPPD TKVT
Sbjct: 100 YLSRFLLRASVREVNLYLLITTCIYLACKVEECPQHIRTLVNEARSLWPEFIPPDVTKVT 159

Query: 180 EFEFYLIEELQCYLIVHHPYKSMEQIVEALKEEPFKLTFTSDELQNCWSLINDSFINDVH 239
           EFEFYLIEELQ YLIVHHPY+S+EQI +AL  E +    + DELQ  WSLINDS+  DVH
Sbjct: 160 EFEFYLIEELQSYLIVHHPYRSLEQIEKALSSEKYNYKLSDDELQKIWSLINDSYTTDVH 219

Query: 240 LTYAPHIIAMACLFITVSI---QGSNTKELSLTSAVTEXXXXXXXXXXXXXXFFRFLAES 296
           L Y+PH+IA++CLF    I      +TK  ++                       F+AE+
Sbjct: 220 LLYSPHVIAISCLFAVSCIIHKPEDSTKRANINM---------------------FIAET 258

Query: 297 HVDLEEVMDTIQQQIILYDHWDRYHEPWIKYLLHTLYL 334
            V+LE+VM  +Q+ I LYDHWD+Y+E  I+ LLH LYL
Sbjct: 259 QVNLEQVMFILQELISLYDHWDKYNELRIRALLHELYL 296

>KLLA0E06666g 605566..606762 similar to sgd|S0006229 Saccharomyces
           cerevisiae YPR025c CCL1 TFIIH subunit (transcription
           initiation factor), cyclin C component, start by
           similarity
          Length = 398

 Score = 60.5 bits (145), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 68/151 (45%), Gaps = 11/151 (7%)

Query: 107 LNIRQYALATAHIYLSRFLLKASVREVNLYLLVTTCVYLACKVEECPQYIRTLVSEARSL 166
           LN+     ATA  +  RF L  S  E++   ++   ++LACK E     I     + +S 
Sbjct: 141 LNLPTEVCATAISFFRRFFLVNSTMEIHPKHILLASIFLACKSENYFIGIEAFAKKTKS- 199

Query: 167 WPEFIPPDPTKVTEFEFYLIEELQCYLIVHHPYKSMEQI---VEALKEEPFKLTFTSDEL 223
                   PT + ++EF ++E LQ  L+ HHPY+ +      ++ +      L +     
Sbjct: 200 -------QPTTILKYEFDVLESLQFTLLNHHPYRPLHGFFLDIQYILHGKVDLNYMGQIY 252

Query: 224 QNCWSLINDSFINDVHLTYAPHIIAMACLFI 254
            NC   I ++ + DV   Y P  I +ACL I
Sbjct: 253 TNCKRRITETLLTDVVYHYTPPQITLACLLI 283

>YPR025C (CCL1) [5459] chr16 complement(613372..614553) Cyclin C
           component of RNA polymerase transcription initiation
           factor TFIIH, required for PolII transcription, for
           nucleotide excision repair, and for activity of Kin28p
           [1182 bp, 393 aa]
          Length = 393

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 71/155 (45%), Gaps = 11/155 (7%)

Query: 103 LGRRLNIRQYALATAHIYLSRFLLKASVREVNLYLLVTTCVYLACKVEECPQYIRTLVSE 162
           + + LN+    +ATA  +  RF L+ SV +++   +V T ++LACK E     + +   +
Sbjct: 127 IAQHLNLPTEVVATAISFFRRFFLENSVMQIDPKSIVHTTIFLACKSENYFISVDSFAQK 186

Query: 163 ARSLWPEFIPPDPTKVTEFEFYLIEELQCYLIVHHPYKSMEQI---VEALKEEPFKLTFT 219
           A+S            V +FEF L+E L+  L+ HHPYK +      ++ +      L + 
Sbjct: 187 AKSTR--------DSVLKFEFKLLESLKFSLLNHHPYKPLHGFFLDIQNVLYGKVDLNYM 238

Query: 220 SDELQNCWSLINDSFINDVHLTYAPHIIAMACLFI 254
                 C   I  + + DV   Y P  I +A L I
Sbjct: 239 GQIYDRCKKRITAALLTDVVYFYTPPQITLATLLI 273

>Scas_672.12
          Length = 374

 Score = 58.2 bits (139), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 73/155 (47%), Gaps = 11/155 (7%)

Query: 103 LGRRLNIRQYALATAHIYLSRFLLKASVREVNLYLLVTTCVYLACKVEECPQYIRTLVSE 162
           + + LN+    +AT+  +  +F L+ SV + +   LV T ++LACK E     + +   +
Sbjct: 135 ISQHLNLPTEIIATSISFFKKFFLENSVMQYDPKSLVHTTIFLACKAENYFISVDSFAKK 194

Query: 163 ARSLWPEFIPPDPTKVTEFEFYLIEELQCYLIVHHPYKSMEQI---VEALKEEPFKLTFT 219
           A+S        +   + ++EF L+E L+  L++HHPYK +      ++ +      L + 
Sbjct: 195 AKS--------NREAILKYEFKLLESLKFSLLIHHPYKPLHGFFLDIQNVLHGKVDLNYM 246

Query: 220 SDELQNCWSLINDSFINDVHLTYAPHIIAMACLFI 254
                 C   I ++ + DV   + P  I +A L I
Sbjct: 247 GQIYDKCKKKITEAILTDVVYLFTPPQITLAILMI 281

>CAGL0K05115g complement(497262..498365) similar to sp|P37366
           Saccharomyces cerevisiae YPR025c Cyclin, hypothetical
           start
          Length = 367

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 73/157 (46%), Gaps = 15/157 (9%)

Query: 103 LGRRLNIRQYALATAHIYLSRFLLKASVREVNLYLLVTTCVYLACKVEECPQYIRTLVSE 162
           + +++++    +AT+  +  RF L+ SV EV    +V T ++LACK E     + +   +
Sbjct: 117 IAQKMSLPTEVVATSISFFRRFFLENSVLEVEPKDIVHTTIFLACKSENYFISVNSFAEK 176

Query: 163 ARSLWPEFIPPDPTKVT--EFEFYLIEELQCYLIVHHPYKSMEQI---VEALKEEPFKLT 217
           A++          TK T  ++EF L+E L+  L+ HHPYK +      ++        L 
Sbjct: 177 AKA----------TKETILKYEFKLLETLKFTLMNHHPYKPLHGFFLDIQKTLHGKIDLK 226

Query: 218 FTSDELQNCWSLINDSFINDVHLTYAPHIIAMACLFI 254
           +     + C   I ++ + D    Y P  I +A L I
Sbjct: 227 YMGKIYEKCKKRITEALLTDAVYFYTPPQITLATLMI 263

>Kwal_27.10641
          Length = 376

 Score = 54.3 bits (129), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 70/163 (42%), Gaps = 11/163 (6%)

Query: 95  YCYFLIMKLGRRLNIRQYALATAHIYLSRFLLKASVREVNLYLLVTTCVYLACKVEECPQ 154
           Y   +++    ++N+     ATA  +  +F L  SV E++   +  T ++ ACK E    
Sbjct: 100 YFARMLLSFANKMNLPTEVAATAISFFRKFYLSNSVAELSPKEIFHTALFFACKSENYFI 159

Query: 155 YIRTLVSEARSLWPEFIPPDPTKVTEFEFYLIEELQCYLIVHHPYKSMEQI---VEALKE 211
            + +   +AR+            V + EF L+E L   ++ HHPYK++      ++ +  
Sbjct: 160 GVESFAKKARTTT--------EAVLKHEFRLLESLNFTIMNHHPYKALHGFFLDIQTVLA 211

Query: 212 EPFKLTFTSDELQNCWSLINDSFINDVHLTYAPHIIAMACLFI 254
               + +      +C   I D+ + D    Y P  I +A L +
Sbjct: 212 GKVDMKYMGQVYTDCKKFITDALLTDAVYFYTPPQITLATLLM 254

>AGL273C [4039] [Homologous to ScYPR025C (CCL1) - SH]
           (194015..195214) [1200 bp, 399 aa]
          Length = 399

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 79/171 (46%), Gaps = 14/171 (8%)

Query: 89  DYNLRIYCYFL--IMKLGRRLNIRQYALATAHIYLSRFLLKASVREVNLYLLVTTCVYLA 146
           D  L++  ++   +   G  L +     ATA  +  +F L  SV E++   ++ T ++LA
Sbjct: 99  DEELKLVNFYAKKVRHFGNSLELPTEVTATAISFFRKFFLTNSVMELHPKNILWTTIFLA 158

Query: 147 CKVEECPQYIRTLVSEARSLWPEFIPPDPTKVTEFEFYLIEELQCYLIVHHPYKSMEQI- 205
           CK E    Y   + S +++   + +      + ++E+ L+E L+  L+ HHPYK++    
Sbjct: 159 CKSE---NYFLGIDSFSKATTRKEL------ILKYEYTLLESLKFTLMNHHPYKALHGFF 209

Query: 206 --VEALKEEPFKLTFTSDELQNCWSLINDSFINDVHLTYAPHIIAMACLFI 254
             ++++ +    L +      +    I D+ + D    Y P  I +A L I
Sbjct: 210 LDIQSVLKGKVDLDYMGLIYTSAKKKITDALLTDAVYMYTPPQITLAVLAI 260

>YPR119W (CLB2) [5540] chr16 (771649..773124) G2/M-phase-specific
           cyclin [1476 bp, 491 aa]
          Length = 491

 Score = 34.7 bits (78), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 81/181 (44%), Gaps = 19/181 (10%)

Query: 81  HRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIYLSRFLLKASVREVNLYLLVT 140
           HR++H ++D    I   +L+ K+  +  +    L  A   + RFL K  V+   L L+ T
Sbjct: 254 HRNIHQNRD----ILVNWLV-KIHNKFGLLPETLYLAINIMDRFLGKELVQLDKLQLVGT 308

Query: 141 TCVYLACKVEEC-PQYIRTLVSEARSLWPEFIPPDPTKVTEFEFYLIEELQCYLIVHHPY 199
           +C+++A K EE     I+   SE      E       ++ E E ++++ L+  L   +P 
Sbjct: 309 SCLFIASKYEEVYSPSIKHFASETDGACTE------DEIKEGEKFILKTLKFNLNYPNPM 362

Query: 200 KSMEQIVEALKEEPFKLTFTSDELQNCWSLINDSFINDVHLTYAPHIIAMACLFITVSIQ 259
             + +I +A   +    T     L+   SL++  FI        P + A A +F++  + 
Sbjct: 363 NFLRRISKADDYDIQSRTLAKFLLE--ISLVDFRFIG-----ILPSLCAAAAMFMSRKML 415

Query: 260 G 260
           G
Sbjct: 416 G 416

>YGR109C (CLB6) [2068] chr7 complement(705361..706503) B-type cyclin
           appearing late in G1, involved in initiation of DNA
           synthesis [1143 bp, 380 aa]
          Length = 380

 Score = 32.0 bits (71), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 121 LSRFLLKASVREVNLYLLVTTCVYLACKVEE 151
           L RFL +  V+   L LL  TC+++ACK EE
Sbjct: 184 LDRFLSQNVVKLNKLQLLCITCLFIACKFEE 214

>CAGL0D04620g 453500..454930 highly similar to sp|P24869
           Saccharomyces cerevisiae YPR119w CLB2, start by
           similarity
          Length = 476

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 63/141 (44%), Gaps = 14/141 (9%)

Query: 121 LSRFLLKASVREVNLYLLVTTCVYLACKVEEC-PQYIRTLVSEARSLWPEFIPPDPTKVT 179
           + RFL K  V+   L L+ T+C+++A K EE     I+   SE      E       ++ 
Sbjct: 274 MDRFLCKELVQLDKLQLVGTSCLFIASKYEEVYSPSIKHFASETDGACTE------DEIK 327

Query: 180 EFEFYLIEELQCYLIVHHPYKSMEQIVEALKEEPFKLTFTSDELQNCWSLINDSFINDVH 239
           E E ++++ L+  L   +P   + +I +A   +    T     L+   SL++  FI    
Sbjct: 328 EGEKFILKTLEFNLNYPNPMNFLRRISKADDYDIQSRTLAKFLLE--ISLVDFRFIG--- 382

Query: 240 LTYAPHIIAMACLFITVSIQG 260
               P + A A +F++  + G
Sbjct: 383 --VLPSLCAAAAMFLSRKMLG 401

>CAGL0M11044g 1090429..1091568 weakly similar to sp|P24869
           Saccharomyces cerevisiae YPR119w CLB2 cyclin,
           G2/M-specific, hypothetical start
          Length = 379

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 42/92 (45%), Gaps = 7/92 (7%)

Query: 100 IMKLGRRLNIRQYALATAHIYLSRFLLKASVREVNLYLLVTTCVYLACKVEEC-PQYIRT 158
           ++K+ + L +    L      + +FL+K  +      LL  TC+Y+A K EE  P  I  
Sbjct: 164 VIKIHQNLKLENETLYMTIDLIDKFLIKKKLPIEKFQLLGLTCLYIASKYEEVLPPSIFQ 223

Query: 159 LVSEARSLWPEFIPPDPTKVTEFEFYLIEELQ 190
              E+  ++      D  ++ E EF ++E L 
Sbjct: 224 FALESNGIF------DSEEIKESEFNILETLN 249

>Scas_684.18
          Length = 330

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 69/172 (40%), Gaps = 17/172 (9%)

Query: 102 KLGRRLNIRQYALATAHIYLSRFLLKASVREVNLYLLVTTCVYLACKVEECPQYIRTLVS 161
           +L  RLN  +  L TA  Y  R+ L  S      Y L T+C+ L+CK  E  + I  + +
Sbjct: 51  ELCTRLNFPRKTLETALYYYQRYHLFNSFETELCYTLATSCLVLSCKQVETMKKINEICN 110

Query: 162 EARSLWPEFIPPDPTKVTE-----------FEFYLIEELQCYLIVHHPYKSMEQIVEALK 210
            +  L    I  +P K  E            E  ++E       +++   + E IV+  K
Sbjct: 111 LSFVLRN--IKMNPMKNAEILNNFKKQLFHLELKILEACSFDYRINNYVHADEFIVKFGK 168

Query: 211 EEPFKLTFTSDELQNCWSLINDSFINDVHLTYAPHIIAMACLFITVSIQGSN 262
               KL F+       W +  D    ++ L    H I++A L I   + G +
Sbjct: 169 ----KLGFSYQVCHLAWLIGYDVLKLEIMLIVPQHCISLAVLKIATELIGQD 216

>Scas_705.15
          Length = 479

 Score = 30.4 bits (67), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 61/129 (47%), Gaps = 12/129 (9%)

Query: 81  HRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIYLSRFLLKASVREVNLYLLVT 140
           H++++ ++D    I   +L+ K+  +  +    L  A   + RFL K  V+   L L+ T
Sbjct: 241 HKNINQNRD----ILVNWLV-KIHNKFGLLPETLYLAINIMDRFLCKELVQLDKLQLVGT 295

Query: 141 TCVYLACKVEEC-PQYIRTLVSEARSLWPEFIPPDPTKVTEFEFYLIEELQCYLIVHHPY 199
           +C+++A K EE     I+   SE      E       ++ E E ++++ L+  L   +P 
Sbjct: 296 SCLFIASKYEEVYSPSIKHYASETDGACTE------EEIKEGEKFILKTLEFTLNYPNPM 349

Query: 200 KSMEQIVEA 208
             + +I +A
Sbjct: 350 NFLRRISKA 358

>AFR179C [3371] [Homologous to ScYBL024W (NCL1) - SH]
           (766461..768563) [2103 bp, 700 aa]
          Length = 700

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 3/42 (7%)

Query: 196 HHPYKSMEQIVEALKEEPFK-LTFTSDELQNCWSL--INDSF 234
           H P    E++     EEPF  ++ T  EL NCWS   ++D+F
Sbjct: 432 HEPAPKKERLPRDANEEPFVFVSPTHPELANCWSFYGVDDAF 473

>YGR070W (ROM1) [2031] chr7 (627808..631275) GDP-GTP exchange factor
           for Rho1p [3468 bp, 1155 aa]
          Length = 1155

 Score = 30.4 bits (67), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 53/117 (45%), Gaps = 15/117 (12%)

Query: 147 CKVEECPQYIRTLVSE-----ARSLWPEFIPPDPTKVTEFEFYLI-EELQCYLIVHHPYK 200
           C  E+ P  I+  V+E     A  L P++   +P     F +Y   ++ Q  L    P  
Sbjct: 746 CPAEDMPP-IKRYVTENPNCSAGVLLPQYQTSNPKNAIVFAYYGTKQQYQVTLYAPQP-A 803

Query: 201 SMEQIVEALKEEPFKL-------TFTSDELQNCWSLINDSFINDVHLTYAPHIIAMA 250
            ++ ++E +K+E  +L       TF     Q   S IN + +NDV + +A  I+ +A
Sbjct: 804 GLQTLIEKVKQEQKRLLDETKHITFKQMVGQFFHSYINTNRVNDVLICHAGKILLVA 860

>Scas_716.18d
          Length = 432

 Score = 28.9 bits (63), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 5/73 (6%)

Query: 79  ITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIYLSRFLLKASVREVNLYLL 138
           I H+++ +++D    I   +LI K+  +  +    L  A   L RFL K  V    L L+
Sbjct: 193 IKHKNITHNRD----ILINWLI-KVHNKFGLLPETLYLAINLLDRFLSKEEVTLNKLQLV 247

Query: 139 VTTCVYLACKVEE 151
            T C+++A K EE
Sbjct: 248 GTYCLFIASKYEE 260

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.137    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,649,894
Number of extensions: 354156
Number of successful extensions: 1161
Number of sequences better than 10.0: 34
Number of HSP's gapped: 1161
Number of HSP's successfully gapped: 34
Length of query: 334
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 232
Effective length of database: 13,065,073
Effective search space: 3031096936
Effective search space used: 3031096936
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 62 (28.5 bits)