Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M06545g58756327990.0
Scas_721.12657351314780.0
YKL124W (SSH4)57946714720.0
Sklu_2430.753945312861e-172
Kwal_26.766555144112861e-172
KLLA0B12760g54239412571e-168
ABL026W48034511741e-156
Sklu_2101.35683583284e-32
ADL279W4933513071e-29
Kwal_23.34885023582954e-28
YMR171C5502472841e-26
CAGL0F07799g5802312743e-25
KLLA0D10065g4662182688e-25
Scas_669.105851712486e-22
YNL257C (SIP3)122972683.7
Kwal_33.1413330162664.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M06545g
         (578 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M06545g 677238..679001 similar to sp|P32343 Saccharomyces c...  1082   0.0  
Scas_721.126                                                          573   0.0  
YKL124W (SSH4) [3142] chr11 (210239..211978) Protein that confer...   571   0.0  
Sklu_2430.7 YKL124W, Contig c2430 12905-14524                         499   e-172
Kwal_26.7665                                                          499   e-172
KLLA0B12760g 1114942..1116570 some similarities with sp|P32343 S...   488   e-168
ABL026W [566] [Homologous to ScYKL124W (SSH4) - SH] complement(3...   456   e-156
Sklu_2101.3 YMR171C, Contig c2101 5004-6710                           130   4e-32
ADL279W [1462] [Homologous to ScYMR171C - SH] complement(212401....   122   1e-29
Kwal_23.3488                                                          118   4e-28
YMR171C (YMR171C) [4126] chr13 complement(603867..605519) Protei...   114   1e-26
CAGL0F07799g complement(760681..762423) similar to sp|Q03212 Sac...   110   3e-25
KLLA0D10065g complement(851283..852683) similar to sp|Q03212 Sac...   107   8e-25
Scas_669.10                                                           100   6e-22
YNL257C (SIP3) [4350] chr14 complement(160630..164319) Protein t...    31   3.7  
Kwal_33.14133                                                          30   4.8  

>CAGL0M06545g 677238..679001 similar to sp|P32343 Saccharomyces
           cerevisiae YKL124w SSH4, hypothetical start
          Length = 587

 Score = 1082 bits (2799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/563 (94%), Positives = 533/563 (94%)

Query: 1   MPLIPDSIQSIGVFHVDDPFNPMPDPGDADPETXXXXXXXXXXXXXSLLLITLVCTAAYL 60
           MPLIPDSIQSIGVFHVDDPFNPMPDPGDADPET             SLLLITLVCTAAYL
Sbjct: 1   MPLIPDSIQSIGVFHVDDPFNPMPDPGDADPETVAFAFFIGIAVVFSLLLITLVCTAAYL 60

Query: 61  VCTSSYEGEYDEELANNGDGSRRGILNFRPLFGKKNSNGLLLDSNFTNPGEFDDNEEFIE 120
           VCTSSYEGEYDEELANNGDGSRRGILNFRPLFGKKNSNGLLLDSNFTNPGEFDDNEEFIE
Sbjct: 61  VCTSSYEGEYDEELANNGDGSRRGILNFRPLFGKKNSNGLLLDSNFTNPGEFDDNEEFIE 120

Query: 121 REREALIKMSPFEVDSYMRAKEFQIVSPPAVQEFGTYLDSKDLQMIKDRGIQSYYFIPSI 180
           REREALIKMSPFEVDSYMRAKEFQIVSPPAVQEFGTYLDSKDLQMIKDRGIQSYYFIPSI
Sbjct: 121 REREALIKMSPFEVDSYMRAKEFQIVSPPAVQEFGTYLDSKDLQMIKDRGIQSYYFIPSI 180

Query: 181 NDNVDKSGHFLPSFLVQDKLEVEFTRWNKSSSAVLNYPLPYNKKDAVYFEVKVYNHKPNS 240
           NDNVDKSGHFLPSFLVQDKLEVEFTRWNKSSSAVLNYPLPYNKKDAVYFEVKVYNHKPNS
Sbjct: 181 NDNVDKSGHFLPSFLVQDKLEVEFTRWNKSSSAVLNYPLPYNKKDAVYFEVKVYNHKPNS 240

Query: 241 NSIFSIGLVTVPYPYFRIPGMCKFSIAYESTGKLRINDPFFPSTLLPKLVEGDVVGFGYR 300
           NSIFSIGLVTVPYPYFRIPGMCKFSIAYESTGKLRINDPFFPSTLLPKLVEGDVVGFGYR
Sbjct: 241 NSIFSIGLVTVPYPYFRIPGMCKFSIAYESTGKLRINDPFFPSTLLPKLVEGDVVGFGYR 300

Query: 301 FKTGTIFITHNGKKLMDVTQNVSVELFIALGAMNASYTRTYTKDGLLEDPDNIELRNALA 360
           FKTGTIFITHNGKKLMDVTQNVSVELFIALGAMNASYTRTYTKDGLLEDPDNIELRNALA
Sbjct: 301 FKTGTIFITHNGKKLMDVTQNVSVELFIALGAMNASYTRTYTKDGLLEDPDNIELRNALA 360

Query: 361 EGRELKLSKDIQNPHNPMDETKWDIIDSDEIELHVNLGQTGFVFIEANVKKYGFGSVFGE 420
           EGRELKLSKDIQNPHNPMDETKWDIIDSDEIELHVNLGQTGFVFIEANVKKYGFGSVFGE
Sbjct: 361 EGRELKLSKDIQNPHNPMDETKWDIIDSDEIELHVNLGQTGFVFIEANVKKYGFGSVFGE 420

Query: 421 IGIPPAYNPNDIQKDKLIQKGEELPPQYPEDTENFGLFGNLKIKSHIKNPLKEVSSNPSA 480
           IGIPPAYNPNDIQKDKLIQKGEELPPQYPEDTENFGLFGNLKIKSHIKNPLKEVSSNPSA
Sbjct: 421 IGIPPAYNPNDIQKDKLIQKGEELPPQYPEDTENFGLFGNLKIKSHIKNPLKEVSSNPSA 480

Query: 481 PELIQKKLKTPIVKTPKVGIYEFTTPIDRKRETNMQPSINPPVYEINDTRQSSPXXXXXX 540
           PELIQKKLKTPIVKTPKVGIYEFTTPIDRKRETNMQPSINPPVYEINDTRQSSP      
Sbjct: 481 PELIQKKLKTPIVKTPKVGIYEFTTPIDRKRETNMQPSINPPVYEINDTRQSSPEITNET 540

Query: 541 XXXXXXXXXXXKAEPALQHGQSN 563
                      KAEPALQHGQSN
Sbjct: 541 ISNEETVSSSSKAEPALQHGQSN 563

>Scas_721.126
          Length = 573

 Score =  573 bits (1478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/513 (58%), Positives = 372/513 (72%), Gaps = 32/513 (6%)

Query: 28  DADPETXXXXXXXXXXXXXSLLLITLVCTAAYLVCTSSYEGEYDEELANNGDGSR-RGIL 86
           D+DPET             ++L++ L+  AAY+    + E EYDEE      G R RG  
Sbjct: 36  DSDPETVSLAFLISLSVTFAILMLLLMVMAAYITFCGADEAEYDEE-----SGQRPRGPP 90

Query: 87  NFRPLFGKKNSNGLLLDSNFTNPGEFDDNEEFIEREREALIKMSPFEVDSYMRAKEFQIV 146
            F  LF K++ +G+LLDS+FT+PG+FDD  E  ERE   L +MSPFE++ Y R+ EFQ V
Sbjct: 91  RFNILFSKRH-DGILLDSSFTSPGQFDDECEHQEREHTELNRMSPFELELYKRSNEFQEV 149

Query: 147 SPPAVQEFGTYLDSKDLQMIKDRGIQSYYFIPSINDNVDKSGHFLPSFLVQDKLEVEFTR 206
           +PP + EFGTYL + DLQ+IKDRGIQSY+ +PSINDNV+K G+FLPSFL+QDKL++ FT+
Sbjct: 150 APPHIDEFGTYLKATDLQVIKDRGIQSYFLLPSINDNVNKQGNFLPSFLIQDKLDMVFTK 209

Query: 207 WNKSSSAVLNYPLPYNKKDAVYFEVKVYNHKPNSNSIFSIGLVTVPYPYFRIPGMCKFSI 266
           +NKSSS V+NYPLPY K+DAVYFEVKV+ H+P SN+IFSIGLVTVPYPYFRIPGM KFSI
Sbjct: 210 YNKSSSTVMNYPLPYTKRDAVYFEVKVFKHQPVSNTIFSIGLVTVPYPYFRIPGMAKFSI 269

Query: 267 AYESTGKLRINDPFFPSTLLPKLVEGDVVGFGYRFKTGTIFITHNGKKLMDVTQNVSVEL 326
           AYESTGKLRIN+PF  STLLPKLVEGDVVGFGYR+ +GTIFITHNGKKLMDVTQNV V+L
Sbjct: 270 AYESTGKLRINNPFMASTLLPKLVEGDVVGFGYRYSSGTIFITHNGKKLMDVTQNVGVDL 329

Query: 327 FIALGAMNASYTRTYTKDGLLEDPDNIELRNALAEGRELKLSKDIQNPHNPMDETKWDII 386
           F+ LGA NASYTR+YTKDGLLEDPDNIELR AL+EGRE+ L  ++Q   +P +E   D I
Sbjct: 330 FVGLGAFNASYTRSYTKDGLLEDPDNIELREALSEGREIVLPDELQRVRDPHNEN--DQI 387

Query: 387 DSDEIELHVNLGQTGFVFIEANVKKYGFGSVFGEIGIPPAYNPNDIQKDKLIQKGEELPP 446
           DS+E+ELHVNLGQ GFVFIEANVKKY FG+V+G IGIPP+YN  +I+ DKL+QKG+ELPP
Sbjct: 388 DSEEVELHVNLGQVGFVFIEANVKKYAFGTVYGNIGIPPSYNGEEIKNDKLLQKGDELPP 447

Query: 447 QYPEDTENFGLFGNLKIKSHIKNPLKEVSSN----PSAPELIQKKLKTPIVKTPKVGIYE 502
            Y    ++ G FG++ I    +N   E ++N     S   L Q      + KTP+   YE
Sbjct: 448 NYGTLLDSNGFFGDIHINEGHRN--NEENANIIIGSSDTTLRQGAHNVLMRKTPETETYE 505

Query: 503 -FTTPIDR----------------KRETNMQPS 518
             ++  DR                +R+ NM+PS
Sbjct: 506 RISSRFDRENNLYDDNIPELAGLEERDINMEPS 538

>YKL124W (SSH4) [3142] chr11 (210239..211978) Protein that confers
           resistance to immunosuppressive drug leflunomide upon
           overproduction [1740 bp, 579 aa]
          Length = 579

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/467 (61%), Positives = 361/467 (77%), Gaps = 14/467 (2%)

Query: 14  FHVDDP-FNPMPDPGDADPETXXXXXXXXXXXXXSLLLITLVCTAAYLVCTSSYEGEYDE 72
           F V DP   P P P D+D                ++L++ LV  AAY+      E EYDE
Sbjct: 23  FKVGDPNMVPTP-PMDSDSAAISLAFLISLSITFAILMLILVVIAAYVTFCGDDESEYDE 81

Query: 73  ELANNGDGSR-RGILNFRPLFGKKNSNGLLLDSNFTNPGEFDDNEEFIEREREALIKMSP 131
           E   N  G+R  G L+   LFGKK+S G+LLDS+F +PG FDD     ERE E L KMS 
Sbjct: 82  E---NALGTRTSGTLH--SLFGKKHS-GILLDSSFASPGGFDDEIVLQERELEELPKMSA 135

Query: 132 FEVDSYMRAKEFQIVSPPAVQEFGTYLDSKDLQMIKDRGIQSYYFIPSINDNVDKSGHFL 191
           +EV+ Y+RAKEFQ++SPP V++FGTYLDS D Q IKDRGIQSY+ +PSINDN+D+ G+FL
Sbjct: 136 YEVELYIRAKEFQMMSPPMVKDFGTYLDSDDQQFIKDRGIQSYFLLPSINDNIDEYGNFL 195

Query: 192 PSFLVQDKLEVEFTRWNKSSSAVLNYPLPYNKKDAVYFEVKVYNHKPNSNSIFSIGLVTV 251
           PSF+VQDKL+++F+++NKSSS V+NYPLP+N+KDAVYFEVK++ H   SNSIFSIGL TV
Sbjct: 196 PSFIVQDKLDIQFSKFNKSSSTVMNYPLPHNRKDAVYFEVKIFRHIQKSNSIFSIGLTTV 255

Query: 252 PYPYFRIPGMCKFSIAYESTGKLRINDPFFPSTLLPKLVEGDVVGFGYRFKTGTIFITHN 311
           PYPYFR+PGM K+SIAYESTGKLRIN+PF  STLLPKL EGD VGFGYR+KTGTIFITHN
Sbjct: 256 PYPYFRVPGMAKYSIAYESTGKLRINNPFTASTLLPKLEEGDTVGFGYRYKTGTIFITHN 315

Query: 312 GKKLMDVTQNVSVELFIALGAMNASYTRTYTKDGLLEDPDNIELRNALAEGRELKLSKDI 371
           GKKLMDVTQN+ ++LFI +GA NA+YTRTYT+DGLLEDPDN+  R AL+EG++++++KD+
Sbjct: 316 GKKLMDVTQNIGIDLFIGIGAFNAAYTRTYTRDGLLEDPDNVSFREALSEGKDIEVAKDL 375

Query: 372 QNPHNPMDETKWDIIDSDEIELHVNLGQTGFVFIEANVKKYGFGSVFGEIGIPPAYNPND 431
           Q  H+P DE+  D + SDE+ELHVNLGQ GFVFIEANVKKY FGSV+G+IGIPPAYN  +
Sbjct: 376 QRVHDPHDES--DEMTSDEVELHVNLGQVGFVFIEANVKKYAFGSVYGQIGIPPAYNGTE 433

Query: 432 IQKDKLIQKGEELPPQYPEDTENFGLFGNLKIKSHIKNPLKEVSSNP 478
           I+KD ++QKGEELPP+Y  DT+NF  FG++K+K    + +   +S P
Sbjct: 434 IKKDTILQKGEELPPRYA-DTDNF--FGSMKVKEGSSSRITAQTSKP 477

>Sklu_2430.7 YKL124W, Contig c2430 12905-14524
          Length = 539

 Score =  499 bits (1286), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 256/453 (56%), Positives = 327/453 (72%), Gaps = 16/453 (3%)

Query: 18  DPFNPMPDPGDADPETXXXXXXXXXXXXXSLLLITLVCTAAYLVCTSSYEGEYDEEL-AN 76
           DP    P+  + D ET              +L++ L+  A Y+   ++ E +YDEE+ A 
Sbjct: 22  DPVFSPPEGNNGDSETLSLAFLISLSVTFGVLMVLLIIMAVYVTFCNADESDYDEEMGAT 81

Query: 77  NGDGSRRGILNFRPLFGKKNSNGLLLDSNFTNPGEFDDNEEFIEREREALI-KMSPFEVD 135
           +G G+          F +  ++ L LD +F  PG+FDD +   E+E E    K S FE++
Sbjct: 82  HGTGASS-------FFRRHKNSSLFLDGSFITPGKFDDEQAVQEQEDECFKDKFSKFEIE 134

Query: 136 SYMRAKEFQIVSPPAVQEFGTYLDSKDLQMIKDRGIQSYYFIPSINDNVDKSGHFLPSFL 195
            Y RAKEFQ V+PP V+ FGTY   KD Q+IKDRGIQSYYF+PSINDN+DK+G+FLPSFL
Sbjct: 135 LYQRAKEFQKVNPPIVKSFGTYTPLKDKQLIKDRGIQSYYFLPSINDNLDKAGNFLPSFL 194

Query: 196 VQDKLEVEFTRWNKSSSAVLNYPLPYNKKDAVYFEVKVYNHKPNSNSIFSIGLVTVPYPY 255
           +QDKL++EFT++NKSSSA++N+PLPYN+KDAVYFEVKV+ +   SNSIF+IGL+T PYPY
Sbjct: 195 IQDKLDIEFTKYNKSSSAIMNFPLPYNRKDAVYFEVKVFKYPSKSNSIFTIGLITPPYPY 254

Query: 256 FRIPGMCKFSIAYESTGKLRINDPFFPSTLLPKLVEGDVVGFGYRFKTGTIFITHNGKKL 315
           FR+PG  K SIAYESTGKLRI++PF+ +TLLPKL EGDVVGFGYRF++GTIFITHNGKKL
Sbjct: 255 FRMPGYNKHSIAYESTGKLRISNPFYANTLLPKLEEGDVVGFGYRFRSGTIFITHNGKKL 314

Query: 316 MDVTQNVSVELFIALGAMNASYTRTYTKDGLLEDPDNIELRNALAEGRELKLSKDIQNPH 375
           +D+T+N+ V+LFI LGAMNA YT++YT +GLL DPDN  L   L    +L    D     
Sbjct: 315 LDLTENIGVDLFIGLGAMNACYTKSYTLEGLLADPDNPGLHEQLV-AAQLTPESDTTAAI 373

Query: 376 NPMDETKWDI----IDSDEIELHVNLGQTGFVFIEANVKKYGFGSVFGEIGIPPAYNPND 431
           NP  E   D     I SDEIEL VNLGQ GFVFIEANVKKY FGSV+GEIGIPP+YN ++
Sbjct: 374 NPQLERVHDYTTEDIPSDEIELQVNLGQLGFVFIEANVKKYVFGSVYGEIGIPPSYNGDE 433

Query: 432 IQKDKLIQKGEELPPQYPEDTENFGLFGNLKIK 464
           I++D ++QKGEELPP+YP   E+ G FGN+K++
Sbjct: 434 IKQDTVLQKGEELPPEYP--AEDVGFFGNIKVR 464

>Kwal_26.7665
          Length = 551

 Score =  499 bits (1286), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 250/441 (56%), Positives = 317/441 (71%), Gaps = 12/441 (2%)

Query: 12  GVFHVDDPFNPMPDPGDADPETXXXXXXXXXXXXXSLLLITLVCTAAYLVCTSSYEGEYD 71
           G+ H  +P    P     D E              ++L++ L+  A Y+    + E EYD
Sbjct: 52  GLQHFREPIFEPPIGESQDGEAISLVFLISLSVTFAILMVMLIVIAVYVTFCGADESEYD 111

Query: 72  EELANNGDGSRRGILNFRPLFGKKNSNGLLLDSNFTNPGEFDDNEEFIEREREALIKMSP 131
           EE+A+        I N   +F KK S G+LLD +F  PG+FDD    +E+E   L +MS 
Sbjct: 112 EEVAS-------AIPN---MFRKKRS-GVLLDGSFLTPGQFDDEHALLEQEAVELPRMSR 160

Query: 132 FEVDSYMRAKEFQIVSPPAVQEFGTYLDSKDLQMIKDRGIQSYYFIPSINDNVDKSGHFL 191
           FEV+ Y R +EFQ + PP V EFGTY  + D Q IKDRG+QSYYF+PSINDNVD  G+FL
Sbjct: 161 FEVELYQRCREFQKMCPPNVTEFGTYTSASDKQFIKDRGVQSYYFLPSINDNVDHYGNFL 220

Query: 192 PSFLVQDKLEVEFTRWNKSSSAVLNYPLPYNKKDAVYFEVKVYNHKPNSNSIFSIGLVTV 251
           PSF+VQDKL+V FT++N+S+S ++NYPLP NKK+AVYFEVKV+     SNSIFS GLVT 
Sbjct: 221 PSFIVQDKLDVLFTKFNRSASTIMNYPLPQNKKEAVYFEVKVFKFPAKSNSIFSCGLVTC 280

Query: 252 PYPYFRIPGMCKFSIAYESTGKLRINDPFFPSTLLPKLVEGDVVGFGYRFKTGTIFITHN 311
           PYPYFRIPGM +FSIAYESTGKLR+N+PF+ +TLLPKL EGDV+GFGYR+KTGTI ITHN
Sbjct: 281 PYPYFRIPGMAQFSIAYESTGKLRMNNPFYANTLLPKLQEGDVIGFGYRYKTGTILITHN 340

Query: 312 GKKLMDVTQNVSVELFIALGAMNASYTRTYTKDGLLEDPDNIELR-NALAEGRELKLSKD 370
           GKKLMD+T NV ++LF+ +GAMNA+YTRTYT++GLLED DN+ LR   LA   + K  + 
Sbjct: 341 GKKLMDLTHNVGIDLFVGIGAMNAAYTRTYTREGLLEDCDNVSLRERILASDADQKAPRA 400

Query: 371 IQNPHNPMDETKWDIIDSDEIELHVNLGQTGFVFIEANVKKYGFGSVFGEIGIPPAYNPN 430
           I +    + +   D I SDEIELHVNLGQ GFV++EANVKKY FGSV+G+IG+PPAYN +
Sbjct: 401 INDQLETIHDPHNDDITSDEIELHVNLGQLGFVYVEANVKKYAFGSVYGDIGVPPAYNGD 460

Query: 431 DIQKDKLIQKGEELPPQYPED 451
           +I+KD ++QKGEELPP YP +
Sbjct: 461 EIKKDVVLQKGEELPPMYPTE 481

>KLLA0B12760g 1114942..1116570 some similarities with sp|P32343
           Saccharomyces cerevisiae YKL124w SSH4 suppressor of
           SHR3, hypothetical start
          Length = 542

 Score =  488 bits (1257), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 246/394 (62%), Positives = 297/394 (75%), Gaps = 22/394 (5%)

Query: 91  LFGKKNSNGLLLDSNFTNPGEFDDNEEFIEREREALIKMSPFEVDSYMRAKEFQIVSPPA 150
            F K+NS  LLLDS+F  PG+FDD+E    RE + L KMS FEV+ Y R KEFQ +SPP 
Sbjct: 89  FFRKRNS--LLLDSSFMTPGKFDDDESLKVREAKELPKMSSFEVELYERTKEFQKMSPPM 146

Query: 151 VQEFGTYLDSKDLQMIKDRGIQSYYFIPSINDNVDKSGHFLPSFLVQDKLEVEFTRWNKS 210
           V+  G++L+S+D Q+IKDRGIQSY+F+PSINDNVD +G FLPSF V+DKL V FT++N S
Sbjct: 147 VKPLGSFLNSQDKQVIKDRGIQSYFFLPSINDNVDINGAFLPSFFVEDKLNVSFTKFNIS 206

Query: 211 SSAVLNYPLPYNKKDAVYFEVKVYNHKPNSNSIFSIGLVTVPYPYFRIPGMCKFSIAYES 270
           SSA++NYPLP NKKDAVYFEVKVY  K  SNSIFSIGL+T PYPYFRIPG   +SIAYES
Sbjct: 207 SSAIMNYPLPMNKKDAVYFEVKVYKFKTCSNSIFSIGLMTCPYPYFRIPGTAAYSIAYES 266

Query: 271 TGKLRINDPFFPSTLLPKLVEGDVVGFGYRFKTGTIFITHNGKKLMDVTQNVSVELFIAL 330
           TGKLRIN+ F   TLLPKL EGDVVGFGYR+ +GTIFITHNGKK+MDVT  V ++LF+ L
Sbjct: 267 TGKLRINNAFGADTLLPKLEEGDVVGFGYRYSSGTIFITHNGKKMMDVTHKVGIDLFVGL 326

Query: 331 GAMNASYTRTYTKDGLLEDPDNIELRNALAEGRELK--------------LSKDIQNPHN 376
           GAMNA+YTRTYTKDGL EDPDN+  R   +E +                 +SKD+   H+
Sbjct: 327 GAMNAAYTRTYTKDGLFEDPDNVSFRQKWSELQAFNNGESSSDYIDARNVISKDLLQVHD 386

Query: 377 PMDETKWDIIDSDEIELHVNLGQTGFVFIEANVKKYGFGSVFGEIGIPPAYNPNDIQKDK 436
           P    K D + SD IELHVNLGQ GFVFIEANVKKY FGSV+G+IGIPPAYN +DI++D 
Sbjct: 387 P----KEDTVSSDNIELHVNLGQLGFVFIEANVKKYAFGSVYGDIGIPPAYNGDDIKQDM 442

Query: 437 LIQKGEELPPQYPEDTENFGLFGNLKIKSHIKNP 470
           L+QKG+ELPP+YP+D  +F  FG++   +    P
Sbjct: 443 LLQKGDELPPEYPDDAVDF--FGDIHSPASTSEP 474

>ABL026W [566] [Homologous to ScYKL124W (SSH4) - SH]
           complement(350985..352427) [1443 bp, 480 aa]
          Length = 480

 Score =  456 bits (1174), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 217/345 (62%), Positives = 281/345 (81%), Gaps = 15/345 (4%)

Query: 128 KMSPFEVDSYMRAKEFQIVSPPAVQEFGTYLDSKDLQMIKDRGIQSYYFIPSINDNVDKS 187
           +MS FEV+ Y+RAKEFQ ++PP V+ FGTY+  +D Q ++DRGIQ+YY +PSINDNVD+ 
Sbjct: 61  RMSRFEVELYLRAKEFQAMNPPLVKAFGTYMCPEDRQCVRDRGIQAYYLLPSINDNVDRR 120

Query: 188 GHFLPSFLVQDKLEVEFTRWNKSSSAVLNYPLPYNKKDAVYFEVKVYNHKP--NSNSIFS 245
           G+FLPSFLVQDKL V FT++NKSSS ++NYPLP+NK+DAVYFEVKVY  +    SNSIFS
Sbjct: 121 GNFLPSFLVQDKLNVTFTKYNKSSSTIMNYPLPHNKRDAVYFEVKVYKFRNYLASNSIFS 180

Query: 246 IGLVTVPYPYFRIPGMCKFSIAYESTGKLRINDPFFPSTLLPKLVEGDVVGFGYRFKTGT 305
           IGLVT PYPYF +PGMC++SIAYESTGKLRIN+ F+ STLLPKL EGDVVG GYR++TGT
Sbjct: 181 IGLVTCPYPYFVMPGMCQYSIAYESTGKLRINNSFYASTLLPKLQEGDVVGLGYRYRTGT 240

Query: 306 IFITHNGKKLMDVTQNVSVELFIALGAMNASYTRTYTKDGLLEDPDNIELRNALA----- 360
           +FITHNGKK+MD+T N+ ++LF+ +GAMNA+YTRTYTK+GLL+D DN+ELR  +      
Sbjct: 241 VFITHNGKKMMDLTHNIGIDLFVGIGAMNAAYTRTYTKEGLLDDIDNVELRKQIQDLEAD 300

Query: 361 EGRELK--LSKDIQNPHNPMDETKWDIIDSDEIELHVNLGQTGFVFIEANVKKYGFGSVF 418
           + R++   +++ +  PH+P    +   I+SDEIEL VNLG  GFVF+EANVKKY FGS++
Sbjct: 301 QKRDITEVMNEQLLRPHDP----RTRHINSDEIELQVNLGGVGFVFVEANVKKYAFGSLY 356

Query: 419 GEIGIPPAYNPNDIQKDKLIQKGEELPPQYPEDTENFGLFGNLKI 463
           GEIGIPPAYN ++ + D ++QKG++LPP+YPED  NF  FGN+K+
Sbjct: 357 GEIGIPPAYNGDETKTDVILQKGDDLPPKYPEDELNF--FGNIKV 399

>Sklu_2101.3 YMR171C, Contig c2101 5004-6710
          Length = 568

 Score =  130 bits (328), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 106/358 (29%), Positives = 165/358 (46%), Gaps = 88/358 (24%)

Query: 109 PGEFDDNEEFIEREREALIKMSPFEVDSYMRAKEFQIVSPPAV-----QEFGTYLD---- 159
           P   DD E      ++ L+K+SP E   Y + +E+   +PP +     ++    LD    
Sbjct: 157 PSSLDDEEAV----KDKLVKLSPEEQFYYKQGEEYIKQNPPLLIPHRSEDSQGMLDPIIN 212

Query: 160 SKDLQMIKDRGIQSYYFIPSINDNVDKSGHFLP--SFLVQDKLEVEFTRWNKSSSAVLNY 217
            + ++ I++ G+ ++ F P  N         LP  + L+++K E+ F  +N  +S + N 
Sbjct: 213 DQTIRFIEEEGVHAWEFQPDPN---------LPNDTILIENKTEITFLNYNYDASVMTNL 263

Query: 218 PLPYNKKDAVYFEVKVY--------NHKPNSNSIFSIGLVTVPYPYFRIPGMCKFSIAYE 269
           P+P   +   YFE K++        N+  + N + S GL + PYPYFR+PG    SIAY+
Sbjct: 264 PVPRVNR-VYYFECKIFELNTSRSDNNYLSDNEMISFGLSSSPYPYFRLPGRHHHSIAYD 322

Query: 270 STGKLRINDPFFPS----TLLPKLVEGDVVGFGYRFKTGTIFITHNGKKLMDVTQNVSVE 325
           STG  R ND F  S    ++ P+  +GD++G GYR  +GT+F T NGKK           
Sbjct: 323 STGGRRFNDSFELSAELASIFPRYQKGDIIGIGYRTNSGTVFFTRNGKK----------- 371

Query: 326 LFIALGAMNASYTRTYTKDGLLEDPDNIELRNALAEGRELKLSKDIQNPHNPMDETKWDI 385
                               L E P    ++     G +LK    I   + P        
Sbjct: 372 --------------------LNEKPIGGHIK-----GWKLKYLYPIVGANVP-------- 398

Query: 386 IDSDEIELHVNLGQTGFVFIEANVKKYGFGSVFGEIGIPPAYNPNDIQKDKLIQKGEE 443
                 ++HVN G  GFVFIEANVKK+G+    G    PP+Y  ++  +D L++   E
Sbjct: 399 -----CKVHVNFGSYGFVFIEANVKKWGYAKSHGVKLPPPSY--DEYGQDVLLESSYE 449

>ADL279W [1462] [Homologous to ScYMR171C - SH]
           complement(212401..213882) [1482 bp, 493 aa]
          Length = 493

 Score =  122 bits (307), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 103/351 (29%), Positives = 157/351 (44%), Gaps = 90/351 (25%)

Query: 123 REALIKMSPFEVDSYMRAKEFQIVSPPAVQEFGTY----------------LDSKDLQMI 166
           R  L ++SP E   Y + +EF   +PPA+  + T                 ++ + L+ I
Sbjct: 103 RHKLAQLSPEEQFYYKQGEEFIKQNPPALMPYQTVAGGGSHGEPADVFDPVINDQTLRYI 162

Query: 167 KDRGIQSYYFIPSINDNVDKSGHFLPSFL-VQDKLEVEFTRWNKSSSAVLNYPLPYNKKD 225
           ++ G Q++ F PS +          P F+ V+++ E+ F   N   S   N P+P   K 
Sbjct: 163 EEEGAQAWEFQPSPS--------LPPDFVKVENRTELTFMNSNSDVSVATNLPIPLANK- 213

Query: 226 AVYFEVKVYN-----HKPNS----NSIFSIGLVTVPYPYFRIPGMCKFSIAYESTGKLRI 276
             YFE K++       +P S    N I S GL T PYPYFR+PG    S+AY+S G  R+
Sbjct: 214 VYYFECKIFELCDRLGRPVSHLSENQIVSFGLATSPYPYFRLPGRHHHSVAYDSNGARRL 273

Query: 277 NDPF-FP---STLLPKLVEGDVVGFGYRFKTGTIFITHNGKKLMDVTQNVSVELFIALGA 332
           N+ F  P   S+L P+  +GDV+G GYR ++GT+F                         
Sbjct: 274 NNSFKLPQELSSLFPRCEKGDVIGIGYRTRSGTVF------------------------- 308

Query: 333 MNASYTRTYTKDGLLEDPDNIELRNALAEGRELKLSKDIQNPHNPMDETKWDIIDSDEIE 392
                   +T++G   +   I       +G ++K    I   + P              +
Sbjct: 309 --------FTRNGKKLNEKRI---GGHIKGWKIKYLYPIVGANVP-------------CK 344

Query: 393 LHVNLGQTGFVFIEANVKKYGFGSVFGEIGIPPAYNPNDIQKDKLIQKGEE 443
           +HVN G  GFV+IEANVKK+G+  + G    PPAY   D  +D L++   E
Sbjct: 345 IHVNFGTYGFVYIEANVKKWGYAKLNGMKLPPPAY--EDYDRDVLLESSYE 393

>Kwal_23.3488
          Length = 502

 Score =  118 bits (295), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 103/358 (28%), Positives = 154/358 (43%), Gaps = 89/358 (24%)

Query: 109 PGEFDDNEEFIEREREALIKMSPFEVDSYMRAKEFQIVSPP---------AVQEFGTYLD 159
           P   DD +      R+ L +MS  E   Y + +EF   +PP           +     ++
Sbjct: 109 PSALDDADAV----RDKLARMSAEEQFYYKQGEEFIKQNPPLLLPDRSPVGAETVDPIIN 164

Query: 160 SKDLQMIKDRGIQSYYFIPSI---NDNVDKSGHFLPSFLVQDKLEVEFTRWNKSSSAVLN 216
            + LQ I + G  ++ F P     ND+V          LV++K E+ F  +N   S + N
Sbjct: 165 EQTLQFIDEEGAHAWEFQPDPKLPNDSV----------LVENKSEITFLNYNYDVSVMTN 214

Query: 217 YPLPYNKKDAVYFEVKVY-------NHKPNSNSIFSIGLVTVPYPYFRIPGMCKFSIAYE 269
            P+P   +   Y E K++       N+  + N + S GL T PYPYFR+PG    SIAY+
Sbjct: 215 LPIPRLNR-VYYCEFKIFELNTAGSNNNSSQNEMLSFGLSTSPYPYFRLPGRHHHSIAYD 273

Query: 270 STGKLRINDPFFPS----TLLPKLVEGDVVGFGYRFKTGTIFITHNGKKLMDVTQNVSVE 325
           STG  R ND F  S    ++ P+  +GDV+G GYR  +GT+F                  
Sbjct: 274 STGGRRFNDSFELSPELASIFPRCEKGDVIGIGYRTNSGTVF------------------ 315

Query: 326 LFIALGAMNASYTRTYTKDGLLEDPDNIELRNALAEGRELKLSKDIQNPHNPMDETKWDI 385
                          +T++G   +  +I       +G + K    I   + P        
Sbjct: 316 ---------------FTRNGKKLNEKSI---GGHIKGWKFKYVYPIVGSNIP-------- 349

Query: 386 IDSDEIELHVNLGQTGFVFIEANVKKYGFGSVFGEIGIPPAYNPNDIQKDKLIQKGEE 443
                 ++HVN G  GFVFIEANVKK+G+    G    PP+Y   D  +D L++   E
Sbjct: 350 -----CKVHVNFGTYGFVFIEANVKKWGYAKSNGMKLPPPSY--EDYSQDVLLESSYE 400

>YMR171C (YMR171C) [4126] chr13 complement(603867..605519) Protein
           containing a SPRY (SPla and RYanodine Receptor) domain,
           has moderate similarity to uncharacterized C. albicans
           Orf6.5491p [1653 bp, 550 aa]
          Length = 550

 Score =  114 bits (284), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 84/247 (34%), Positives = 121/247 (48%), Gaps = 39/247 (15%)

Query: 96  NSNGLLLDSNFTNPGEFDDNEEFIEREREALIKMSPFEVDSYMRAKEFQIVSPPAVQEFG 155
           +S  L+ + +   P   DD +E     R+ L ++SP E   Y + +E+   +PP +   G
Sbjct: 103 HSRRLMENMSLRWPNNLDDADEV----RDKLAQLSPEEQFYYKQGEEYIKQNPPFLLNQG 158

Query: 156 TYLDSKD----------------LQMIKDRGIQSYYFIPSINDNVDKSGHFLPSFLVQDK 199
               S+D                 Q I++ G  ++ F P    N D   H   + +V++K
Sbjct: 159 LLQQSEDSNPDTTREDPIMNEQTRQYIQEEGAYAWEFSP----NPDMPNH---TVIVENK 211

Query: 200 LEVEFTRWNKSSSAVLNYPLPYNKKDAVYFEVKVY------NHKPN-SNSIFSIGLVTVP 252
            EV F  +N  +S   N P+P   K   Y E K++      N   N S  + S GL T P
Sbjct: 212 TEVSFLNYNYDASISTNLPIPCINK-VYYCEFKIFETDGPLNSDENVSKGVISFGLSTQP 270

Query: 253 YPYFRIPGMCKFSIAYESTGKLRINDPFFPS----TLLPKLVEGDVVGFGYRFKTGTIFI 308
           YPYFR+PG    SIAY+S G  R ND F  +    TL P+  +GD+VG GYR ++GT+F 
Sbjct: 271 YPYFRLPGRHHHSIAYDSNGARRFNDSFKLNEQLRTLFPQCEKGDIVGIGYRSRSGTVFF 330

Query: 309 THNGKKL 315
           T NGKKL
Sbjct: 331 TRNGKKL 337

>CAGL0F07799g complement(760681..762423) similar to sp|Q03212
           Saccharomyces cerevisiae YMR171c, hypothetical start
          Length = 580

 Score =  110 bits (274), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 75/231 (32%), Positives = 112/231 (48%), Gaps = 38/231 (16%)

Query: 109 PGEFDDNEEFIEREREALIKMSPFEVDSYMRAKEFQIVSPPAVQEFGT-----------Y 157
           P   DD  E     +  L K+SP E   Y + +E+   +PP +   G+            
Sbjct: 134 PSALDDENEV----KSKLQKLSPEEQFYYKQGEEYIKQNPPLIISTGSRSGDQNTVNDPI 189

Query: 158 LDSKDLQMIKDRGIQSYYFIPSINDNVDKSGHFLP--SFLVQDKLEVEFTRWNKSSSAVL 215
           ++ +  Q I++ G  ++ F P+ N         LP  + +V++K E+ F  +N  +S   
Sbjct: 190 INDQTRQFIEEEGALAWEFQPNPN---------LPNDTIIVENKTEISFLNYNYDASVTT 240

Query: 216 NYPLPYNKKDAVYFEVKVY-------NHKPNSNSIFSIGLVTVPYPYFRIPGMCKFSIAY 268
           N P+P   +   Y E K++             N I S GL T PYPYFR+PG    SIAY
Sbjct: 241 NLPIPCINR-VYYCEFKIFELSITDDQTTLKDNEIISFGLSTSPYPYFRLPGRHHHSIAY 299

Query: 269 ESTGKLRINDPFF----PSTLLPKLVEGDVVGFGYRFKTGTIFITHNGKKL 315
           +S G  R ND F      + L PK  +GD++G GYR ++GT+F T NGKK+
Sbjct: 300 DSNGARRFNDSFKLEPELADLFPKCQKGDIIGIGYRTRSGTVFFTRNGKKI 350

>KLLA0D10065g complement(851283..852683) similar to sp|Q03212
           Saccharomyces cerevisiae YMR171c, start by similarity
          Length = 466

 Score =  107 bits (268), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 73/218 (33%), Positives = 113/218 (51%), Gaps = 36/218 (16%)

Query: 123 REALIKMSPFEVDSYMRAKEFQIVSPPAVQEF-------------GTYLDSKDLQMIKDR 169
           +E L  +SP E   Y + +E+   +PP +  +                ++ + LQ I++ 
Sbjct: 101 KEFLQNLSPKEQFYYKQGEEYVKQNPPLLVPYLPNDPENREEVIPDPIVNEQTLQFIEEE 160

Query: 170 GIQSYYFIPSINDNVDKSGHFLP--SFLVQDKLEVEFTRWNKSSSAVLNYPLPYNKKDAV 227
           G  ++ F    N         LP  + ++Q++ E+ F  ++  +S +   P+P   K   
Sbjct: 161 GAAAWEFQADPN---------LPNDTVMIQERTELTFLNFSYDASVMTTLPIPRLNK-VY 210

Query: 228 YFEVKVY------NHKPNSNSIFSIGLVTVPYPYFRIPGMCKFSIAYESTGKLRINDPFF 281
           Y+E K++      NH  + N + SIGL T PYPYFR+PG    SI+Y+S G  R+N  F 
Sbjct: 211 YYECKIFELNQGKNHLSD-NEMISIGLSTSPYPYFRLPGRHHHSISYDSDGCRRMNSSFP 269

Query: 282 PS----TLLPKLVEGDVVGFGYRFKTGTIFITHNGKKL 315
            S    TL P+  +GDV+G GYR ++GTIF THNGKKL
Sbjct: 270 MSAELQTLFPRFEKGDVIGIGYRTRSGTIFFTHNGKKL 307

>Scas_669.10
          Length = 585

 Score =  100 bits (248), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 61/171 (35%), Positives = 91/171 (53%), Gaps = 23/171 (13%)

Query: 158 LDSKDLQMIKDRGIQSYYFIPSINDNVDKSGHFLP--SFLVQDKLEVEFTRWNKSSSAVL 215
           ++ +  Q I++ G  ++ F    N         LP  + L+++K E+ F  +N  +S + 
Sbjct: 189 MNHQTKQFIEEEGASAWEFQADPN---------LPNDTILIENKTEITFLNYNYDASVMT 239

Query: 216 NYPLPYNKKDAVYFEVKVY--NHKPNS-----NSIFSIGLVTVPYPYFRIPGMCKFSIAY 268
           N P+P   +   Y E K++  N+ P       N + S+GL T PYPYFR+PG    SIAY
Sbjct: 240 NLPIPCINR-VYYCEFKIFELNNSPEQTNLSPNEVISMGLATSPYPYFRLPGRHHHSIAY 298

Query: 269 ESTGKLRIND--PFFP--STLLPKLVEGDVVGFGYRFKTGTIFITHNGKKL 315
           +S G  R ND  P  P  + L P    GD++G GYR ++GT F T NGKK+
Sbjct: 299 DSNGARRFNDSFPLDPELANLFPVCERGDIIGVGYRTRSGTFFFTRNGKKV 349

>YNL257C (SIP3) [4350] chr14 complement(160630..164319) Protein that
           interacts with Snf1p, contains a PH (pleckstrin
           homology) domain [3690 bp, 1229 aa]
          Length = 1229

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 33/72 (45%), Gaps = 11/72 (15%)

Query: 407 ANVKKYGFGSVFGEIGIPPA----YNPNDIQKDKLIQKGEELPPQYPEDTENFGLFGNLK 462
           +N KK  +      I  P +    YN   I   KL+ K  ++PP+ PE +      G L 
Sbjct: 265 SNAKKQAYRYTLKRIT-PSSDTSDYNIRSIHSSKLLSKDTQVPPKSPEKS------GWLY 317

Query: 463 IKSHIKNPLKEV 474
           +K+ +  P +E+
Sbjct: 318 MKTQVGKPTREI 329

>Kwal_33.14133
          Length = 301

 Score = 30.0 bits (66), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 26/62 (41%), Gaps = 8/62 (12%)

Query: 328 IALGAMNASYTRTYTKDGLLED--------PDNIELRNALAEGRELKLSKDIQNPHNPMD 379
           + +G       R Y K G+LED          NI+     + G  +KL  D+ +   PM 
Sbjct: 197 LVMGVSTIGTRRVYLKSGILEDLLDWALVRTKNIQNSGKYSAGNSMKLLVDVYSFDKPMK 256

Query: 380 ET 381
           ET
Sbjct: 257 ET 258

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.137    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,118,150
Number of extensions: 970748
Number of successful extensions: 1995
Number of sequences better than 10.0: 28
Number of HSP's gapped: 1993
Number of HSP's successfully gapped: 35
Length of query: 578
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 471
Effective length of database: 12,891,983
Effective search space: 6072123993
Effective search space used: 6072123993
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 64 (29.3 bits)