Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M05533g1834180695190.0
Sklu_2124.11830180065940.0
YBR208C (DUR1,2)1835179864250.0
KLLA0E08107g1829180264120.0
Scas_721.401834180863200.0
Kwal_27.119511869180862830.0
ADR051C1819180855380.0
CAGL0K06787g11754588153e-89
YBR218C (PYC2)11804568003e-87
Scas_686.1711764587799e-85
YGL062W (PYC1)11784517772e-84
CAGL0F06941g11804537754e-84
Kwal_14.180311744537728e-84
KLLA0C05764g11734597567e-82
AAR162C11714887415e-80
Scas_563.1212164347114e-76
Sklu_1458.111324276989e-75
Scas_720.7422315166151e-63
KLLA0F06072g22315176096e-63
Kwal_23.615722305195981e-61
AAR071W22315135971e-61
YNR016C (ACC1)22335175971e-61
YMR207C (HFA1)21234535972e-61
CAGL0L10780g22335525943e-61
CAGL0M13585g4671692482e-21
Kwal_23.42494652022472e-21
YMR293C4644272454e-21
KLLA0A09845g4692012437e-21
Scas_684.254821672438e-21
ABR140C4632032366e-20
Kwal_56.222955831791932e-14
Sklu_2417.115911791852e-13
Sklu_2417.105911791852e-13
Scas_582.4*21933091738e-12
CAGL0L05676g22113091657e-11
YJL130C (URA2)22143091641e-10
Sklu_2331.122203091631e-10
Scas_721.665731291502e-09
Sklu_2413.411222281504e-09
KLLA0E15444g22283091461e-08
ACR263C22403091433e-08
Sklu_2136.36171371395e-08
Sklu_1884.25461371377e-08
Kwal_33.1406122213091371e-07
KLLA0F03190g11173061333e-07
YDR242W (AMD2)5491291298e-07
Kwal_55.1978311213221272e-06
KLLA0B08800g5701251262e-06
CAGL0C04917g11133111262e-06
Sklu_2072.34503721242e-06
ABR157W11131901218e-06
Kwal_34.157245561261181e-05
Scas_691.1911172071182e-05
KLLA0D12628g5781381111e-04
YJR109C (CPA2)11181931121e-04
Kwal_27.104385691251010.001
Sklu_777.130299860.071
CAGL0K11792g884168830.22
Kwal_27.1148547161770.91
CAGL0K10340g570226771.2
CAGL0M03245g56297724.2
ADL345C74673706.8
Kwal_47.16696143078708.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M05533g
         (1806 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M05533g complement(588667..594171) similar to sp|P32528 Sac...  3671   0.0  
Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement         2544   0.0  
YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea amid...  2479   0.0  
KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharo...  2474   0.0  
Scas_721.40                                                          2439   0.0  
Kwal_27.11951                                                        2424   0.0  
ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH] (796213..8...  2137   0.0  
CAGL0K06787g complement(659290..662817) highly similar to sp|P32...   318   3e-89
YBR218C (PYC2) [399] chr2 complement(658664..662206) Pyruvate ca...   312   3e-87
Scas_686.17                                                           304   9e-85
YGL062W (PYC1) [1917] chr7 (385197..388733) Pyruvate carboxylase...   303   2e-84
CAGL0F06941g 679960..683502 highly similar to sp|P11154 Saccharo...   303   4e-84
Kwal_14.1803                                                          301   8e-84
KLLA0C05764g complement(512470..515991) highly similar to sp|P32...   295   7e-82
AAR162C [350] [Homologous to ScYGL062W (PYC1) - SH; ScYBR218C (P...   290   5e-80
Scas_563.12                                                           278   4e-76
Sklu_1458.1 YGL062W, Contig c1458 155-3553 reverse complement         273   9e-75
Scas_720.74                                                           241   1e-63
KLLA0F06072g 583276..589971 highly similar to sp|Q00955 Saccharo...   239   6e-63
Kwal_23.6157                                                          234   1e-61
AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C (H...   234   1e-61
YNR016C (ACC1) [4599] chr14 complement(654672..661373) Acetyl-Co...   234   1e-61
YMR207C (HFA1) [4163] chr13 complement(677192..683563) Protein w...   234   2e-61
CAGL0L10780g complement(1149588..1156289) highly similar to sp|Q...   233   3e-61
CAGL0M13585g complement(1335488..1336891) similar to sp|Q03557 S...   100   2e-21
Kwal_23.4249                                                          100   2e-21
YMR293C (YMR293C) [4247] chr13 complement(855398..856792) Protei...    99   4e-21
KLLA0A09845g complement(862467..863876) similar to sp|Q03557 Sac...    98   7e-21
Scas_684.25                                                            98   8e-21
ABR140C [732] [Homologous to ScYMR293C - SH] (662185..663576) [1...    96   6e-20
Kwal_56.22295                                                          79   2e-14
Sklu_2417.11 , Contig c2417 20071-21846                                76   2e-13
Sklu_2417.10 , Contig c2417 20071-21846                                76   2e-13
Scas_582.4*                                                            71   8e-12
CAGL0L05676g 619734..626369 highly similar to sp|P07259 Saccharo...    68   7e-11
YJL130C (URA2) [2788] chr10 complement(165641..172285) Multifunc...    68   1e-10
Sklu_2331.1 YJL130C, Contig c2331 2029-8691                            67   1e-10
Scas_721.66                                                            62   2e-09
Sklu_2413.4 YJR109C, Contig c2413 10886-14254                          62   4e-09
KLLA0E15444g 1370741..1377427 highly similar to sp|P07259 Saccha...    61   1e-08
ACR263C [1310] [Homologous to ScYJL130C (URA2) - SH] (827830..83...    60   3e-08
Sklu_2136.3 , Contig c2136 3336-5189 reverse complement                58   5e-08
Sklu_1884.2 YDR242W, Contig c1884 1484-3124 reverse complement         57   7e-08
Kwal_33.14061                                                          57   1e-07
KLLA0F03190g complement(296883..300236) highly similar to sp|P03...    56   3e-07
YDR242W (AMD2) [1076] chr4 (946799..948448) Protein with similar...    54   8e-07
Kwal_55.19783                                                          54   2e-06
KLLA0B08800g complement(772732..774444) similar to ca|CA4426|CaA...    53   2e-06
CAGL0C04917g 457506..460847 highly similar to sp|P03965 Saccharo...    53   2e-06
Sklu_2072.3 , Contig c2072 3010-4362 reverse complement                52   2e-06
ABR157W [750] [Homologous to ScYJR109C (CPA2) - SH] complement(6...    51   8e-06
Kwal_34.15724                                                          50   1e-05
Scas_691.19                                                            50   2e-05
KLLA0D12628g 1071637..1073373 weakly similar to sp|P22580 Saccha...    47   1e-04
YJR109C (CPA2) [3001] chr10 complement(629500..632856) Carbamoyl...    48   1e-04
Kwal_27.10438                                                          44   0.001
Sklu_777.1 YJL126W, Contig c777 867-1775                               38   0.071
CAGL0K11792g complement(1134215..1136869) similar to tr|Q12071 S...    37   0.22 
Kwal_27.11485                                                          34   0.91 
CAGL0K10340g complement(1006791..1008503) sp|O74197 Candida glab...    34   1.2  
CAGL0M03245g complement(372122..373810) similar to sp|P39994 Sac...    32   4.2  
ADL345C [1395] [Homologous to ScYBR114W (RAD16) - SH] (100332..1...    32   6.8  
Kwal_47.16696                                                          32   8.8  

>CAGL0M05533g complement(588667..594171) similar to sp|P32528
            Saccharomyces cerevisiae YBR208c DUR1 urea amidolyase,
            hypothetical start
          Length = 1834

 Score = 3671 bits (9519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1779/1806 (98%), Positives = 1779/1806 (98%)

Query: 1    MTATNICPSIGWSIQDWIDFHFKSTPKDSYESLLELVKNQRIAPEDPAWISVATXXXXXX 60
            MTATNICPSIGWSIQDWIDFHFKSTPKDSYESLLELVKNQRIAPEDPAWISVAT      
Sbjct: 1    MTATNICPSIGWSIQDWIDFHFKSTPKDSYESLLELVKNQRIAPEDPAWISVATESLLEQ 60

Query: 61   XXXXXXXRHEKEKLPLYGVPIAVKDNIDAKGFPTTAACPSFSYMPTRDSTVVELLKQAGA 120
                   RHEKEKLPLYGVPIAVKDNIDAKGFPTTAACPSFSYMPTRDSTVVELLKQAGA
Sbjct: 61   QWQLLQSRHEKEKLPLYGVPIAVKDNIDAKGFPTTAACPSFSYMPTRDSTVVELLKQAGA 120

Query: 121  IIIGKTNLDQFATGLVGTRSPYGRTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTA 180
            IIIGKTNLDQFATGLVGTRSPYGRTPCVFSDKH              RGIVPIALGTDTA
Sbjct: 121  IIIGKTNLDQFATGLVGTRSPYGRTPCVFSDKHVSGGSSAGSASVVARGIVPIALGTDTA 180

Query: 181  GSGRVPAALNNIIGLKPTRGIFSCSGVVPACKSLDCVSVFSMNLSDAEKCLKIMTKLDIE 240
            GSGRVPAALNNIIGLKPTRGIFSCSGVVPACKSLDCVSVFSMNLSDAEKCLKIMTKLDIE
Sbjct: 181  GSGRVPAALNNIIGLKPTRGIFSCSGVVPACKSLDCVSVFSMNLSDAEKCLKIMTKLDIE 240

Query: 241  NDEYSRSFPANPLQSFNKNLTVAIPKNVMWYGEKENPLLYDRAIDNFKQLGAQIKIIDFE 300
            NDEYSRSFPANPLQSFNKNLTVAIPKNVMWYGEKENPLLYDRAIDNFKQLGAQIKIIDFE
Sbjct: 241  NDEYSRSFPANPLQSFNKNLTVAIPKNVMWYGEKENPLLYDRAIDNFKQLGAQIKIIDFE 300

Query: 301  PLLELARCLYEGTWVAERYAATRKFLETSPQQSTLDPVVYGIIKSATKFDAADAFEYEYK 360
            PLLELARCLYEGTWVAERYAATRKFLETSPQQSTLDPVVYGIIKSATKFDAADAFEYEYK
Sbjct: 301  PLLELARCLYEGTWVAERYAATRKFLETSPQQSTLDPVVYGIIKSATKFDAADAFEYEYK 360

Query: 361  RQGILRKVEVLLQDIDVLCVPTCPLNPSFEEVDKEPILVNSRQGTWTNFVNLADLSALAI 420
            RQGILRKVEVLLQDIDVLCVPTCPLNPSFEEVDKEPILVNSRQGTWTNFVNLADLSALAI
Sbjct: 361  RQGILRKVEVLLQDIDVLCVPTCPLNPSFEEVDKEPILVNSRQGTWTNFVNLADLSALAI 420

Query: 421  PVGFRSDGLPNGVTLIAKKFEDYALLQLAKRFLAQLYPSGTRPYGMFLDRYVGLKDDSLE 480
            PVGFRSDGLPNGVTLIAKKFEDYALLQLAKRFLAQLYPSGTRPYGMFLDRYVGLKDDSLE
Sbjct: 421  PVGFRSDGLPNGVTLIAKKFEDYALLQLAKRFLAQLYPSGTRPYGMFLDRYVGLKDDSLE 480

Query: 481  GPIVSSDDSIVLAVVGAHLRGLPLHWQLEKVNATFICSTKTAKKYELYALPKNGPVLKPG 540
            GPIVSSDDSIVLAVVGAHLRGLPLHWQLEKVNATFICSTKTAKKYELYALPKNGPVLKPG
Sbjct: 481  GPIVSSDDSIVLAVVGAHLRGLPLHWQLEKVNATFICSTKTAKKYELYALPKNGPVLKPG 540

Query: 541  LRRITSGTGSQIELELYSVPKEKFGEFISFVPEPLGIGSVELENGKWVKSFICEESGYNS 600
            LRRITSGTGSQIELELYSVPKEKFGEFISFVPEPLGIGSVELENGKWVKSFICEESGYNS
Sbjct: 541  LRRITSGTGSQIELELYSVPKEKFGEFISFVPEPLGIGSVELENGKWVKSFICEESGYNS 600

Query: 601  TGSIDISHYGGFRAYIESIIPSNESKKGHFKTVLVANRGEIAVRIIKTLKSMQIKSLAIY 660
            TGSIDISHYGGFRAYIESIIPSNESKKGHFKTVLVANRGEIAVRIIKTLKSMQIKSLAIY
Sbjct: 601  TGSIDISHYGGFRAYIESIIPSNESKKGHFKTVLVANRGEIAVRIIKTLKSMQIKSLAIY 660

Query: 661  SATDKYSQHVLDVDMAQALDGHTVEETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFA 720
            SATDKYSQHVLDVDMAQALDGHTVEETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFA
Sbjct: 661  SATDKYSQHVLDVDMAQALDGHTVEETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFA 720

Query: 721  DRCEQEGIQFIGPRGETIRKLGLKHSAREVAKSAGVPLVPGSPLVKNADEAFTIAKNIGY 780
            DRCEQEGIQFIGPRGETIRKLGLKHSAREVAKSAGVPLVPGSPLVKNADEAFTIAKNIGY
Sbjct: 721  DRCEQEGIQFIGPRGETIRKLGLKHSAREVAKSAGVPLVPGSPLVKNADEAFTIAKNIGY 780

Query: 781  PVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQI 840
            PVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQI
Sbjct: 781  PVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQI 840

Query: 841  MGDGKGKTLALGERDCSLQRRNQKVIEETPAPNLPRETRQKMLTAAERLGAYLNYRGAGT 900
            MGDGKGKTLALGERDCSLQRRNQKVIEETPAPNLPRETRQKMLTAAERLGAYLNYRGAGT
Sbjct: 841  MGDGKGKTLALGERDCSLQRRNQKVIEETPAPNLPRETRQKMLTAAERLGAYLNYRGAGT 900

Query: 901  VEFIYDEQRDQFYFLEVNTRLQVEHPITEMVTGLDLVEWMIKISAGVMPSLDEFNISQNG 960
            VEFIYDEQRDQFYFLEVNTRLQVEHPITEMVTGLDLVEWMIKISAGVMPSLDEFNISQNG
Sbjct: 901  VEFIYDEQRDQFYFLEVNTRLQVEHPITEMVTGLDLVEWMIKISAGVMPSLDEFNISQNG 960

Query: 961  ASIEVRVYAENPLKDFRPSPGELVDVQFPNDCRVDTWVKKGTKISPEFDPTLAKIIVHGK 1020
            ASIEVRVYAENPLKDFRPSPGELVDVQFPNDCRVDTWVKKGTKISPEFDPTLAKIIVHGK
Sbjct: 961  ASIEVRVYAENPLKDFRPSPGELVDVQFPNDCRVDTWVKKGTKISPEFDPTLAKIIVHGK 1020

Query: 1021 DRNEAILKMKKALNETKIYGCVTNVDYLKSLISSEMFRNAQLSTNYLNTYEYSPSAVEII 1080
            DRNEAILKMKKALNETKIYGCVTNVDYLKSLISSEMFRNAQLSTNYLNTYEYSPSAVEII
Sbjct: 1021 DRNEAILKMKKALNETKIYGCVTNVDYLKSLISSEMFRNAQLSTNYLNTYEYSPSAVEII 1080

Query: 1081 EPGALTTIQDYPGRVNYWRIGVPPCGPMDNYSFRLANRIVGNDERTPGIEITLTGPTIKF 1140
            EPGALTTIQDYPGRVNYWRIGVPPCGPMDNYSFRLANRIVGNDERTPGIEITLTGPTIKF
Sbjct: 1081 EPGALTTIQDYPGRVNYWRIGVPPCGPMDNYSFRLANRIVGNDERTPGIEITLTGPTIKF 1140

Query: 1141 YSDSLVSIAGGEVCCKLDEKKIPMFEPISVKTGSVLSIGKIVKGSRAYLAIRGGIDVPKY 1200
            YSDSLVSIAGGEVCCKLDEKKIPMFEPISVKTGSVLSIGKIVKGSRAYLAIRGGIDVPKY
Sbjct: 1141 YSDSLVSIAGGEVCCKLDEKKIPMFEPISVKTGSVLSIGKIVKGSRAYLAIRGGIDVPKY 1200

Query: 1201 MGSFSTFTMGNLGGFNGRALKRGDVLSLPQQFDSEHGIPSPCFSPEKAPIYVRPDIPNDG 1260
            MGSFSTFTMGNLGGFNGRALKRGDVLSLPQQFDSEHGIPSPCFSPEKAPIYVRPDIPNDG
Sbjct: 1201 MGSFSTFTMGNLGGFNGRALKRGDVLSLPQQFDSEHGIPSPCFSPEKAPIYVRPDIPNDG 1260

Query: 1261 VWTIGVLAGPHGAPDIFESEGMMEFFKSEWKVHYNSNRFGVRLIGPKPKWSRTDGGEGGL 1320
            VWTIGVLAGPHGAPDIFESEGMMEFFKSEWKVHYNSNRFGVRLIGPKPKWSRTDGGEGGL
Sbjct: 1261 VWTIGVLAGPHGAPDIFESEGMMEFFKSEWKVHYNSNRFGVRLIGPKPKWSRTDGGEGGL 1320

Query: 1321 HPSNTHDYVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVSEAEMWKVGQLKPGDTINF 1380
            HPSNTHDYVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVSEAEMWKVGQLKPGDTINF
Sbjct: 1321 HPSNTHDYVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVSEAEMWKVGQLKPGDTINF 1380

Query: 1381 TPIDWQSARNLKENQDVIINDMSSCALQKLSDQPLLKSPEDPILFQKDGQELQSPKVVYR 1440
            TPIDWQSARNLKENQDVIINDMSSCALQKLSDQPLLKSPEDPILFQKDGQELQSPKVVYR
Sbjct: 1381 TPIDWQSARNLKENQDVIINDMSSCALQKLSDQPLLKSPEDPILFQKDGQELQSPKVVYR 1440

Query: 1441 QAGDRYILIEYGDDIFELNLCYRIKSLIDIISQRNTKGIKEMSQGVRSVLVEYDGYEISQ 1500
            QAGDRYILIEYGDDIFELNLCYRIKSLIDIISQRNTKGIKEMSQGVRSVLVEYDGYEISQ
Sbjct: 1441 QAGDRYILIEYGDDIFELNLCYRIKSLIDIISQRNTKGIKEMSQGVRSVLVEYDGYEISQ 1500

Query: 1501 KELLKTLIAYEEQLPQEKNWSVKSRIFRLPMAFEDKETLACVKRYQETIRSKAPWLPNNV 1560
            KELLKTLIAYEEQLPQEKNWSVKSRIFRLPMAFEDKETLACVKRYQETIRSKAPWLPNNV
Sbjct: 1501 KELLKTLIAYEEQLPQEKNWSVKSRIFRLPMAFEDKETLACVKRYQETIRSKAPWLPNNV 1560

Query: 1561 DFVAEVNNLTHDDIRQLIYTTRYMVLGVGDVFLGSPCAIPLDPRNRLLGSKYNPSRTFTK 1620
            DFVAEVNNLTHDDIRQLIYTTRYMVLGVGDVFLGSPCAIPLDPRNRLLGSKYNPSRTFTK
Sbjct: 1561 DFVAEVNNLTHDDIRQLIYTTRYMVLGVGDVFLGSPCAIPLDPRNRLLGSKYNPSRTFTK 1620

Query: 1621 RGVVGIGGSYMCIYAADSPGGYQLVGRTIPIWDRLMLQSKKDEPWLLSPFDQIEFYPVSE 1680
            RGVVGIGGSYMCIYAADSPGGYQLVGRTIPIWDRLMLQSKKDEPWLLSPFDQIEFYPVSE
Sbjct: 1621 RGVVGIGGSYMCIYAADSPGGYQLVGRTIPIWDRLMLQSKKDEPWLLSPFDQIEFYPVSE 1680

Query: 1681 EQIDEYTDEWDNGNYKIDVDDVVFDHGSYLKWVQDNIEAIEEHQRAQRGDNYSKFAQKIQ 1740
            EQIDEYTDEWDNGNYKIDVDDVVFDHGSYLKWVQDNIEAIEEHQRAQRGDNYSKFAQKIQ
Sbjct: 1681 EQIDEYTDEWDNGNYKIDVDDVVFDHGSYLKWVQDNIEAIEEHQRAQRGDNYSKFAQKIQ 1740

Query: 1741 EANADLKQTTTEVIEQNILEDDCEYIFSEYAGRFWKPIVEIGASIEKDQGVAVIEAMKTE 1800
            EANADLKQTTTEVIEQNILEDDCEYIFSEYAGRFWKPIVEIGASIEKDQGVAVIEAMKTE
Sbjct: 1741 EANADLKQTTTEVIEQNILEDDCEYIFSEYAGRFWKPIVEIGASIEKDQGVAVIEAMKTE 1800

Query: 1801 MIVSSS 1806
            MIVSSS
Sbjct: 1801 MIVSSS 1806

>Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement
          Length = 1830

 Score = 2544 bits (6594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1192/1800 (66%), Positives = 1438/1800 (79%), Gaps = 4/1800 (0%)

Query: 9    SIGWSIQDWIDFHFKSTPKDSYESLLELVKNQRIAPEDPAWISVATXXXXXXXXXXXXXR 68
            ++GWS QDWIDFH KSTP+ SY +LL L+K+Q+ APEDPAWIS+               +
Sbjct: 5    TLGWSAQDWIDFHGKSTPEHSYNTLLSLLKSQKSAPEDPAWISLINEANLAHQWKVLQSK 64

Query: 69   HEKEKLPLYGVPIAVKDNIDAKGFPTTAACPSFSYMPTRDSTVVELLKQAGAIIIGKTNL 128
              K++LPLYGVPIAVKDNID+KG PTTAACP+F Y P+ DSTVV LLK AGAI+IGKTNL
Sbjct: 65   ANKQQLPLYGVPIAVKDNIDSKGSPTTAACPAFEYNPSADSTVVALLKDAGAIVIGKTNL 124

Query: 129  DQFATGLVGTRSPYGRTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAA 188
            DQFATGLVGTRSPYG+TPCVFSDKH              RGIVPIALGTDTAGSGRVPAA
Sbjct: 125  DQFATGLVGTRSPYGKTPCVFSDKHVSGGSSAGSASAVGRGIVPIALGTDTAGSGRVPAA 184

Query: 189  LNNIIGLKPTRGIFSCSGVVPACKSLDCVSVFSMNLSDAEKCLKIMTKLDIENDEYSRSF 248
            LNN+IGLKPT+G+FSCSGVVPACKSLDCVSVF+MNLSDAE+C K+M K D+ENDEYSR  
Sbjct: 185  LNNLIGLKPTKGLFSCSGVVPACKSLDCVSVFAMNLSDAERCFKVMAKPDLENDEYSRPL 244

Query: 249  PANPLQSFNKNLTVAIPKNVMWYGEKENPLLYDRAIDNFKQLGAQIKIIDFEPLLELARC 308
            P+NPLQ + KN+T+AIPK V WYGE ENP LY +AI+N K  GA I  IDFEPLL LARC
Sbjct: 245  PSNPLQKYPKNVTIAIPKEVPWYGETENPKLYAKAIENLKVAGASIVTIDFEPLLALARC 304

Query: 309  LYEGTWVAERYAATRKFLETSPQQSTLDPVVYGIIKSATKFDAADAFEYEYKRQGILRKV 368
            LYEG WVAERY AT+ F  T+P +S+LDP V  IIK+ATK+DAAD+F YEY+RQGIL+KV
Sbjct: 305  LYEGAWVAERYEATKDFFATNPPESSLDPTVTSIIKTATKYDAADSFRYEYQRQGILQKV 364

Query: 369  EVLLQDIDVLCVPTCPLNPSFEEVDKEPILVNSRQGTWTNFVNLADLSALAIPVGFRSDG 428
            +  L+DIDVLCVPTCPLNP+FEEV  EP+LVNSRQGTWTNFVNLAD++ALA+P GFR DG
Sbjct: 365  DQTLKDIDVLCVPTCPLNPTFEEVAAEPVLVNSRQGTWTNFVNLADMAALAVPAGFRPDG 424

Query: 429  LPNGVTLIAKKFEDYALLQLAKRFLAQLYPSGTRPYGMFLDRYVGLKDDSLEGPIVSSDD 488
            LP GVTLI KKF D+ALL+LA R+    +P G+R +G F+DR V  KDD L GP +S +D
Sbjct: 425  LPQGVTLIGKKFTDFALLELANRYFKVAFPQGSRTFGKFIDRQVTTKDDELRGPDISPED 484

Query: 489  SIVLAVVGAHLRGLPLHWQLEKVNATFICSTKTAKKYELYALPKNGPVLKPGLRRITSGT 548
            S+ LAVVGAHL+GLPL+WQLEKVNAT++ S KT+K Y+LYALPK GP+LKPGLRR+   T
Sbjct: 485  SVKLAVVGAHLKGLPLYWQLEKVNATYLGSPKTSKNYKLYALPKTGPILKPGLRRVGEET 544

Query: 549  GSQIELELYSVPKEKFGEFISFVPEPLGIGSVELENGKWVKSFICEESGYNSTGSIDISH 608
            GSQI+LE+YSVPKE FGEFIS VPEPLGIGSVELE+G+WVKSFICEE GY   G++DI+ 
Sbjct: 545  GSQIQLEVYSVPKENFGEFISMVPEPLGIGSVELESGEWVKSFICEEFGYTQKGTVDITK 604

Query: 609  YGGFRAYIESIIPSNESKKGHFKTVLVANRGEIAVRIIKTLKSMQIKSLAIYSATDKYSQ 668
            YGGF+ YI+ +       K  F+TVL+ANRGEIAVRIIKTLK + I+S+A+YS  DKYSQ
Sbjct: 605  YGGFKKYIDFLKQEEAKVKKPFETVLIANRGEIAVRIIKTLKKLNIRSVAVYSDPDKYSQ 664

Query: 669  HVLDVDMAQALDGHTVEETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFADRCEQEGI 728
            HV+D D+  AL+G T  ETYL ++KII  AK  +  AIIPGYGFLSENA FAD+C +EGI
Sbjct: 665  HVIDADLGVALNGRTAAETYLDIDKIIKAAKDTNAQAIIPGYGFLSENAEFADKCVEEGI 724

Query: 729  QFIGPRGETIRKLGLKHSAREVAKSAGVPLVPGSPLVKNADEAFTIAKNIGYPVMVKSTA 788
             F+GP GE IRKLGLKHSARE+A+ AGVPLVPGS LV +A EA  IA  + YPVMVKSTA
Sbjct: 725  VFVGPSGEAIRKLGLKHSAREIAEKAGVPLVPGSGLVTSAKEAKEIANKLEYPVMVKSTA 784

Query: 789  GGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQIMGDGKGKT 848
            GGGGIGLQKVD+E ++ + FETV+HQG +YFGDSGVF+E+F++NARHVE+Q+MGDG GK 
Sbjct: 785  GGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGYGKA 844

Query: 849  LALGERDCSLQRRNQKVIEETPAPNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQ 908
            +A+GERDCSLQRRNQK+IEETPAPNL   TR KM  AAE LG+ L Y+ AGTVEFIYDE+
Sbjct: 845  IAIGERDCSLQRRNQKIIEETPAPNLGETTRTKMRQAAESLGSLLKYKCAGTVEFIYDER 904

Query: 909  RDQFYFLEVNTRLQVEHPITEMVTGLDLVEWMIKISAGVMPSLDEFNISQNGASIEVRVY 968
            RD+FYFLEVN RLQVEHPITEMVTGLDLVEWM++I+A   P  +  NI   GASIE R+Y
Sbjct: 905  RDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAADDAPDFESANIVVTGASIEARLY 964

Query: 969  AENPLKDFRPSPGELVDVQFPNDCRVDTWVKKGTKISPEFDPTLAKIIVHGKDRNEAILK 1028
            AENP KDFRPSPG L DV FP   RVDTWV KGT +S E+DPTLAKIIVHGKDRN+AI+K
Sbjct: 965  AENPAKDFRPSPGLLTDVHFPEWARVDTWVSKGTTVSAEYDPTLAKIIVHGKDRNDAIMK 1024

Query: 1029 MKKALNETKIYGCVTNVDYLKSLISSEMFRNAQLSTNYLNTYEYSPSAVEIIEPGALTTI 1088
            M KALNET +YGC+TN+DYL+S+ SSEMF+ A+++T  L++Y+Y P A E+  PGA TT+
Sbjct: 1025 MNKALNETVVYGCITNIDYLRSIASSEMFKTAKVATKILDSYDYKPCAFEVTSPGAYTTV 1084

Query: 1089 QDYPGRVNYWRIGVPPCGPMDNYSFRLANRIVGNDERTPGIEITLTGPTIKFYSDSLVSI 1148
            QDYPGRV YWRIGVPP GPMD YSFRLANRIVGN  + P IE+TL GP I F+++++++I
Sbjct: 1085 QDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGNHYKAPAIELTLNGPKILFHTETIIAI 1144

Query: 1149 AGGEVCCKLDEKKIPMFEPISVKTGSVLSIGKIVKGSRAYLAIRGGIDVPKYMGSFSTFT 1208
            +GG   C L++K I   +PI V  G  L+IGK+  G RAYLAIRGGIDVP+Y+GS STF 
Sbjct: 1145 SGGIAACSLNDKPIEQNKPIQVNRGDHLAIGKLSVGCRAYLAIRGGIDVPEYLGSRSTFA 1204

Query: 1209 MGNLGGFNGRALKRGDVLSLPQQFDSEHGIPSPCFSPEKAPIYVRPDIPNDGVWTIGVLA 1268
            +GN+GG+NGR LK GDVL L Q   +   +P P + P+  P  + P I +D  WTIGV  
Sbjct: 1205 LGNMGGYNGRVLKLGDVLFLNQPELASSSLPGPAYEPQAPPANLLPKISDDKEWTIGVTC 1264

Query: 1269 GPHGAPDIFESEGMMEFFKSEWKVHYNSNRFGVRLIGPKPKWSRTDGGEGGLHPSNTHDY 1328
            GPHG+PD F+ E + EFF  +WKVHYNSNRFGVRLIGPKPKW+R DGGEGGLHPSN HDY
Sbjct: 1265 GPHGSPDFFKPESVEEFFSEKWKVHYNSNRFGVRLIGPKPKWARKDGGEGGLHPSNAHDY 1324

Query: 1329 VYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVSEAEMWKVGQLKPGDTINFTPIDWQSA 1388
            VYSLGAINFTGDEPVIIT DGPSLGGFVCQAVV EAE+WKVGQ+KPGD+I F PI +Q A
Sbjct: 1325 VYSLGAINFTGDEPVIITSDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFVPISYQVA 1384

Query: 1389 RNLKENQDVIINDMSSCALQKLSDQPLLKSPEDPILFQKDGQELQSPKVVYRQAGDRYIL 1448
            R LKE+QD  I  +    LQ L+   +L + EDP+L Q   +   SPKV YRQAGDRYIL
Sbjct: 1385 RQLKESQDAAIETLEDGKLQTLTSDLILPTYEDPVLVQLPKKSNLSPKVTYRQAGDRYIL 1444

Query: 1449 IEYGDDIFELNLCYRIKSLIDIISQRNTKGIKEMSQGVRSVLVEYDGYEISQKELLKTLI 1508
            +EYG++  +LN+ YRI  LI+++ +  T GI EMSQGVRSVL+EYDGY+ISQ  LL TL+
Sbjct: 1445 VEYGENQMDLNIAYRINQLINLVGKHKTVGIVEMSQGVRSVLIEYDGYKISQGALLDTLV 1504

Query: 1509 AYEEQLPQEKNWSVKSRIFRLPMAFEDKETLACVKRYQETIRSKAPWLPNNVDFVAEVNN 1568
            AYE ++  +KNWS+KS+IF+LP+AFED +TL CV RYQETIRSKAPWLPNNVDFVAEVN+
Sbjct: 1505 AYESEIQFDKNWSIKSKIFKLPLAFEDSKTLECVTRYQETIRSKAPWLPNNVDFVAEVND 1564

Query: 1569 LTHDDIRQLIYTTRYMVLGVGDVFLGSPCAIPLDPRNRLLGSKYNPSRTFTKRGVVGIGG 1628
            +TH D+  ++Y+ R++VLG+GDVFLG+PCA+PLDPR+R LGSKYNPSRT+TK GVVGIGG
Sbjct: 1565 ITHKDVENMLYSARFLVLGLGDVFLGAPCAVPLDPRHRFLGSKYNPSRTYTKNGVVGIGG 1624

Query: 1629 SYMCIYAADSPGGYQLVGRTIPIWDRLMLQSKKDE-PWLLSPFDQIEFYPVSEEQIDEYT 1687
             YMCIYA DSPGGYQLVGRTIPIWD+L L S   E PWLL+PFDQ+EFYPVSEE++D +T
Sbjct: 1625 MYMCIYAMDSPGGYQLVGRTIPIWDKLKLGSHSQEHPWLLTPFDQVEFYPVSEEELDRFT 1684

Query: 1688 DEWDNGNYKIDVDDVVFDHGSYLKWVQDNIEAIEEHQRAQRGDNYSKFAQKIQEANADLK 1747
            ++ +NG + + V++ VFDH +YLKW+ +NIE+I E Q++Q G    +FA+ IQ AN +L+
Sbjct: 1685 EDCENGKFPVQVEESVFDHKNYLKWINENIESITEFQKSQGGAKADEFARLIQVANQELE 1744

Query: 1748 QTTT--EVIEQNILEDDCEYIFSEYAGRFWKPIVEIGASIEKDQGVAVIEAMKTEMIVSS 1805
             +TT    +E+   E D E ++SEY+GRFWKP+V  G ++ K  G+ ++EAMKTEM+V +
Sbjct: 1745 SSTTNKSAVEEEYPE-DAEMVYSEYSGRFWKPMVSAGDTVTKGDGLVIVEAMKTEMVVPA 1803

>YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea
            amidolyase, contains urea carboxylase and allophanate
            hydrolase activities fused together in a single
            polypeptide [5508 bp, 1835 aa]
          Length = 1835

 Score = 2479 bits (6425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1157/1798 (64%), Positives = 1421/1798 (79%), Gaps = 5/1798 (0%)

Query: 9    SIGWSIQDWIDFHFKSTPKDSYESLLELVKNQRIAPEDPAWISVATXXXXXXXXXXXXXR 68
            S+GWSIQDWIDFH  S+ + S   L  L+ +Q +AP D AWIS+ +             R
Sbjct: 12   SLGWSIQDWIDFHKSSSSQASLRLLESLLDSQNVAPVDNAWISLISKENLLHQFQILKSR 71

Query: 69   HEKEKLPLYGVPIAVKDNIDAKGFPTTAACPSFSYMPTRDSTVVELLKQAGAIIIGKTNL 128
              KE LPLYGVPIAVKDNID +G PTTAACPSF+Y P++DS VVELL+ AGAII+GKTNL
Sbjct: 72   ENKETLPLYGVPIAVKDNIDVRGLPTTAACPSFAYEPSKDSKVVELLRNAGAIIVGKTNL 131

Query: 129  DQFATGLVGTRSPYGRTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAA 188
            DQFATGLVGTRSPYG+TPC FS +H              RGIVPIALGTDTAGSGRVPAA
Sbjct: 132  DQFATGLVGTRSPYGKTPCAFSKEHVSGGSSAGSASVVARGIVPIALGTDTAGSGRVPAA 191

Query: 189  LNNIIGLKPTRGIFSCSGVVPACKSLDCVSVFSMNLSDAEKCLKIMTKLDIENDEYSRSF 248
            LNN+IGLKPT+G+FSC GVVPACKSLDCVS+F++NLSDAE+C +IM + D +NDEYSR +
Sbjct: 192  LNNLIGLKPTKGVFSCQGVVPACKSLDCVSIFALNLSDAERCFRIMCQPDPDNDEYSRPY 251

Query: 249  PANPLQSFNKNLTVAIPKNVMWYGEKENPLLYDRAIDNFKQLGAQIKIIDFEPLLELARC 308
             +NPL+ F+ N+T+AIPKN+ WYGE +NP+L+  A++N  + GA +  IDFEPLLELARC
Sbjct: 252  VSNPLKKFSSNVTIAIPKNIPWYGETKNPVLFSNAVENLSRTGANVIEIDFEPLLELARC 311

Query: 309  LYEGTWVAERYAATRKFLETSPQQSTLDPVVYGIIKSATKFDAADAFEYEYKRQGILRKV 368
            LYEGTWVAERY A + FL++ P + +LDP V  II+ A K+ A D F +EYKRQGIL+KV
Sbjct: 312  LYEGTWVAERYQAIQSFLDSKPPKESLDPTVISIIEGAKKYSAVDCFSFEYKRQGILQKV 371

Query: 369  EVLLQDIDVLCVPTCPLNPSFEEVDKEPILVNSRQGTWTNFVNLADLSALAIPVGFRSDG 428
              LL+ +DVLCVPTCPLNP+ ++V  EP+LVNSRQGTWTNFVNLADL+ALA+P GFR DG
Sbjct: 372  RRLLESVDVLCVPTCPLNPTMQQVADEPVLVNSRQGTWTNFVNLADLAALAVPAGFRDDG 431

Query: 429  LPNGVTLIAKKFEDYALLQLAKRFLAQLYPSGTRPYGMFLDRYVGLKDDSLEGPIVSSDD 488
            LPNG+TLI KKF DYALL+LA R+   ++P+G+R YG F    V   +D L GP      
Sbjct: 432  LPNGITLIGKKFTDYALLELANRYFQNIFPNGSRTYGTFTSSSVKPANDQLVGPDYDPST 491

Query: 489  SIVLAVVGAHLRGLPLHWQLEKVNATFICSTKTAKKYELYALPKNGPVLKPGLRRITSGT 548
            SI LAVVGAHL+GLPLHWQLEKVNAT++C+TKT+K Y+L+ALPKNGPVLKPGLRR+    
Sbjct: 492  SIKLAVVGAHLKGLPLHWQLEKVNATYLCTTKTSKAYQLFALPKNGPVLKPGLRRVQDSN 551

Query: 549  GSQIELELYSVPKEKFGEFISFVPEPLGIGSVELENGKWVKSFICEESGYNSTGSIDISH 608
            GSQIELE+YSVPKE FG FIS VPEPLGIGSVELE+G+W+KSFICEESGY + G++DI+ 
Sbjct: 552  GSQIELEVYSVPKELFGAFISMVPEPLGIGSVELESGEWIKSFICEESGYKAKGTVDITK 611

Query: 609  YGGFRAYIESIIPSNESKKGHFKTVLVANRGEIAVRIIKTLKSMQIKSLAIYSATDKYSQ 668
            YGGFRAY E +      KK  F TVL+ANRGEIAVRIIKTLK + I+S+A+YS  DKYSQ
Sbjct: 612  YGGFRAYFEMLKKKESQKKKLFDTVLIANRGEIAVRIIKTLKKLGIRSVAVYSDPDKYSQ 671

Query: 669  HVLDVDMAQALDGHTVEETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFADRCEQEGI 728
            HV D D++  L G T  +TYL + KII  AK+ +  AIIPGYGFLSENA F+D C   GI
Sbjct: 672  HVTDADVSVPLHGTTAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSDACTSAGI 731

Query: 729  QFIGPRGETIRKLGLKHSAREVAKSAGVPLVPGSPLVKNADEAFTIAKNIGYPVMVKSTA 788
             F+GP G+ IR LGLKHSAR++A+ AGVPLVPGS L+ + +EA  +A  + YPVMVKSTA
Sbjct: 732  TFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPGSLLITSVEEAKKVAAELEYPVMVKSTA 791

Query: 789  GGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQIMGDGKGKT 848
            GGGGIGLQKVD+E+D+   FETVKHQG ++FGD+GVF+E+FI+NARHVEVQ+MGDG GK 
Sbjct: 792  GGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQLMGDGFGKA 851

Query: 849  LALGERDCSLQRRNQKVIEETPAPNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQ 908
            +ALGERDCSLQRRNQKVIEETPAPNLP +TR  +  AAE LG+ LNY+ AGTVEFIYDE+
Sbjct: 852  IALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLNYKCAGTVEFIYDEK 911

Query: 909  RDQFYFLEVNTRLQVEHPITEMVTGLDLVEWMIKISAGVMPSLDEFNISQNGASIEVRVY 968
            +D+FYFLEVNTRLQVEHPITEMVTGLDLVEWMI+I+A   P  D   +  NG S+E R+Y
Sbjct: 912  KDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDAPDFDSTKVEVNGVSMEARLY 971

Query: 969  AENPLKDFRPSPGELVDVQFPNDCRVDTWVKKGTKISPEFDPTLAKIIVHGKDRNEAILK 1028
            AENPLK+FRPSPG LVDV+FP+  RVDTWVKKGT ISPE+DPTLAKIIVHGKDR++AI K
Sbjct: 972  AENPLKNFRPSPGLLVDVKFPDWARVDTWVKKGTNISPEYDPTLAKIIVHGKDRDDAISK 1031

Query: 1029 MKKALNETKIYGCVTNVDYLKSLISSEMFRNAQLSTNYLNTYEYSPSAVEIIEPGALTTI 1088
            + +AL ETK+YGC+TN+DYLKS+I+S+ F  A++STN LN+Y+Y P+A+EI  PGA T+I
Sbjct: 1032 LNQALEETKVYGCITNIDYLKSIITSDFFAKAKVSTNILNSYQYEPTAIEITLPGAHTSI 1091

Query: 1089 QDYPGRVNYWRIGVPPCGPMDNYSFRLANRIVGNDERTPGIEITLTGPTIKFYSDSLVSI 1148
            QDYPGRV YWRIGVPP GPMD YSFRLANRIVGND RTP IE+TLTGP+I F+ +++++I
Sbjct: 1092 QDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGNDYRTPAIEVTLTGPSIVFHCETVIAI 1151

Query: 1149 AGGEVCCKLDEKKIPMFEPISVKTGSVLSIGKIVKGSRAYLAIRGGIDVPKYMGSFSTFT 1208
             GG   C LD ++IP  +P+ VK GS LSIGK+  G RAYL IRGGIDVPKY+GS+STFT
Sbjct: 1152 TGGTALCTLDGQEIPQHKPVEVKRGSTLSIGKLTSGCRAYLGIRGGIDVPKYLGSYSTFT 1211

Query: 1209 MGNLGGFNGRALKRGDVLSLPQQFDSEHGIPSPCFSPEKAPIYVRPDIPNDGVWTIGVLA 1268
            +GN+GG+NGR LK GDVL LP    +E      C  P+  P  + P I     W IGV  
Sbjct: 1212 LGNVGGYNGRVLKLGDVLFLPS---NEENKSVECL-PQNIPQSLIPQISETKEWRIGVTC 1267

Query: 1269 GPHGAPDIFESEGMMEFFKSEWKVHYNSNRFGVRLIGPKPKWSRTDGGEGGLHPSNTHDY 1328
            GPHG+PD F+ E + EFF  +WKVHYNSNRFGVRLIGPKPKW+R++GGEGG+HPSNTHDY
Sbjct: 1268 GPHGSPDFFKPESIEEFFSEKWKVHYNSNRFGVRLIGPKPKWARSNGGEGGMHPSNTHDY 1327

Query: 1329 VYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVSEAEMWKVGQLKPGDTINFTPIDWQSA 1388
            VYSLGAINFTGDEPVIITCDGPSLGGFVCQAVV EAE+WKVGQ+KPGD+I F P+ ++S+
Sbjct: 1328 VYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFVPLSYESS 1387

Query: 1389 RNLKENQDVIINDMSSCALQKLSDQPLLKSPEDPILFQKDGQELQSPKVVYRQAGDRYIL 1448
            R+LKE+QDV I  +    L++L    +L S E PIL Q +     SPKVVYRQAGDRY+L
Sbjct: 1388 RSLKESQDVAIKSLDGTKLRRLDSVSILPSFETPILAQMEKVNELSPKVVYRQAGDRYVL 1447

Query: 1449 IEYGDDIFELNLCYRIKSLIDIISQRNTKGIKEMSQGVRSVLVEYDGYEISQKELLKTLI 1508
            +EYGD+    N+ YRI+ LI ++ +  T GI EMSQGVRSVL+E+DGY+++QKELLK L+
Sbjct: 1448 VEYGDNEMNFNISYRIECLISLVKKNKTIGIVEMSQGVRSVLIEFDGYKVTQKELLKVLV 1507

Query: 1509 AYEEQLPQEKNWSVKSRIFRLPMAFEDKETLACVKRYQETIRSKAPWLPNNVDFVAEVNN 1568
            AYE ++  ++NW + S I RLPMAFED +TLACV+RYQETIRS APWLPNNVDF+A VN 
Sbjct: 1508 AYETEIQFDENWKITSNIIRLPMAFEDSKTLACVQRYQETIRSSAPWLPNNVDFIANVNG 1567

Query: 1569 LTHDDIRQLIYTTRYMVLGVGDVFLGSPCAIPLDPRNRLLGSKYNPSRTFTKRGVVGIGG 1628
            ++ +++  ++Y+ R+MVLG+GDVFLGSPCA+PLDPR+R LGSKYNPSRT+T+RG VGIGG
Sbjct: 1568 ISRNEVYDMLYSARFMVLGLGDVFLGSPCAVPLDPRHRFLGSKYNPSRTYTERGAVGIGG 1627

Query: 1629 SYMCIYAADSPGGYQLVGRTIPIWDRLMLQSKKDEPWLLSPFDQIEFYPVSEEQIDEYTD 1688
             YMCIYAA+SPGGYQLVGRTIPIWD+L L +  + PWL++PFDQ+EFYPVSEE +D+ T+
Sbjct: 1628 MYMCIYAANSPGGYQLVGRTIPIWDKLCLAASSEVPWLMNPFDQVEFYPVSEEDLDKMTE 1687

Query: 1689 EWDNGNYKIDVDDVVFDHGSYLKWVQDNIEAIEEHQRAQRGDNYSKFAQKIQEANADLKQ 1748
            + DNG YK++++  VFDH  YL+W+  N ++I   Q  Q G+   +FA+ IQ AN++LK+
Sbjct: 1688 DCDNGVYKVNIEKSVFDHQEYLRWINANKDSITAFQEGQLGERAEEFAKLIQNANSELKE 1747

Query: 1749 T-TTEVIEQNILEDDCEYIFSEYAGRFWKPIVEIGASIEKDQGVAVIEAMKTEMIVSS 1805
            + T +  E+    +  E ++SEY+GRFWK I  +G  IE  QG+ +IEAMK EMI+S+
Sbjct: 1748 SVTVKPDEEEDFPEGAEIVYSEYSGRFWKSIASVGDVIEAGQGLLIIEAMKAEMIISA 1805

>KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharomyces
            cerevisiae YBR208c DUR1_2 urea amidolyase, start by
            similarity
          Length = 1829

 Score = 2474 bits (6412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1162/1802 (64%), Positives = 1438/1802 (79%), Gaps = 6/1802 (0%)

Query: 9    SIGWSIQDWIDFHFKSTPKDSYESLLELVKNQRIAPEDPAWISVATXXXXXXXXXXXXXR 68
            ++GWS+QDW+ FH KSTP  S E L  L+K+Q+ APEDPAWIS+               +
Sbjct: 4    TLGWSVQDWLSFHSKSTPTKSLELLENLLKSQKPAPEDPAWISLIPVEDLHHQWNILQSK 63

Query: 69   HEKEKLPLYGVPIAVKDNIDAKGFPTTAACPSFSYMPTRDSTVVELLKQAGAIIIGKTNL 128
              KE+LPLYGVPIAVKDNID KG PTTAACPS+ Y PTRDS VVELL+ AGA++IGKTNL
Sbjct: 64   SNKEELPLYGVPIAVKDNIDYKGLPTTAACPSYLYQPTRDSYVVELLRDAGAVVIGKTNL 123

Query: 129  DQFATGLVGTRSPYGRTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAA 188
            DQFATGLVGTRSPYG+TPCVF+DK+              RGIVP++LGTDTAGSGRVPAA
Sbjct: 124  DQFATGLVGTRSPYGKTPCVFNDKYVSGGSSAGSASVVGRGIVPLSLGTDTAGSGRVPAA 183

Query: 189  LNNIIGLKPTRGIFSCSGVVPACKSLDCVSVFSMNLSDAEKCLKIMTKLDIENDEYSRSF 248
            LNN+IGLKPT+G FSC GVVPACKSLDCVSVF++NLSDAE   K+M K D+  DEYSR F
Sbjct: 184  LNNLIGLKPTKGAFSCRGVVPACKSLDCVSVFALNLSDAEIAFKVMNKPDLLEDEYSREF 243

Query: 249  PANPLQSFNKNLTVAIPKNVMWYGEKENPLLYDRAIDNFKQLGAQIKIIDFEPLLELARC 308
            P NP+  + K+LT+AIPK V W+GE ENP LY +A+ + K  GA+I ++DFEPLLELARC
Sbjct: 244  PKNPISQYPKDLTIAIPKEVPWFGETENPKLYTKAVASLKNTGAKIVVVDFEPLLELARC 303

Query: 309  LYEGTWVAERYAATRKFLETSPQQSTLDPVVYGIIKSATKFDAADAFEYEYKRQGILRKV 368
            LYEG WVAERY ATR FL T+P +S+LD  V  IIK A KFDAADAF++EYKRQGIL+KV
Sbjct: 304  LYEGAWVAERYCATRDFLATNPPESSLDETVVNIIKGAVKFDAADAFKFEYKRQGILQKV 363

Query: 369  EVLLQDIDVLCVPTCPLNPSFEEVDKEPILVNSRQGTWTNFVNLADLSALAIPVGFRSDG 428
             +LL+DIDVLCVPTCPLNP  EEV +EP+LVNSRQGTWTNFVNLADL+ALA+P GFRSDG
Sbjct: 364  NLLLKDIDVLCVPTCPLNPKLEEVAQEPVLVNSRQGTWTNFVNLADLAALAVPSGFRSDG 423

Query: 429  LPNGVTLIAKKFEDYALLQLAKRFLAQLYPSGTRPYGMFLDRYVGLKDDSLEGPIVSSDD 488
            LPNG+TLI KKF DYALL LAKRF +  +P+ +R YG F+DR + ++D+ L+GP   + +
Sbjct: 424  LPNGITLIGKKFSDYALLDLAKRFFSVAFPNNSRTYGKFVDRRITVEDE-LDGPSKDTLN 482

Query: 489  SIVLAVVGAHLRGLPLHWQLEKVNATFICSTKTAKKYELYALPKNGPVLKPGLRRITSGT 548
             + LAVVGAHL+GLPLHWQL+K NAT++ S KT+  Y+LYALPK GPVLKPGLRR+  GT
Sbjct: 483  GVKLAVVGAHLKGLPLHWQLQKCNATYLSSPKTSNNYKLYALPKVGPVLKPGLRRVNDGT 542

Query: 549  GSQIELELYSVPKEKFGEFISFVPEPLGIGSVELENGKWVKSFICEESGYNSTGSIDISH 608
            GSQI+LE+YSVP ++FG+FI+ VPEPLGIGSVELE+G+WVKSFICEE GY   G++DI+ 
Sbjct: 543  GSQIQLEVYSVPYDRFGDFIAMVPEPLGIGSVELESGEWVKSFICEEFGYTQQGTVDITK 602

Query: 609  YGGFRAYIESIIPSNESKKGHFKTVLVANRGEIAVRIIKTLKSMQIKSLAIYSATDKYSQ 668
            +GGF+ YIE I  +   KK  F+TVL+ANRGEIAVRI+KTLK M IKS+A+YS  DKYSQ
Sbjct: 603  FGGFKPYIEHIQVTEAQKKKPFETVLIANRGEIAVRIMKTLKRMGIKSVAVYSDPDKYSQ 662

Query: 669  HVLDVDMAQALDGHTVEETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFADRCEQEGI 728
            HV D D + AL G T  ETYL ++KII+ AKK    AIIPGYGFLSENA F+DRC QE I
Sbjct: 663  HVTDADFSVALHGRTAAETYLDIDKIINAAKKTGAQAIIPGYGFLSENADFSDRCSQENI 722

Query: 729  QFIGPRGETIRKLGLKHSAREVAKSAGVPLVPGSPLVKNADEAFTIAKNIGYPVMVKSTA 788
             F+GP G+ IRKLGLKHSARE+A+ A VPLVPGS L+K+A EA  +AK + YPVMVKSTA
Sbjct: 723  VFVGPSGDAIRKLGLKHSAREIAERAKVPLVPGSGLIKDAKEAKEVAKKLEYPVMVKSTA 782

Query: 789  GGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQIMGDGKGKT 848
            GGGGIGLQKVD+E D+ + FETV+HQG SYFGD+GVFME+F++NARHVE+Q+MGDG GK 
Sbjct: 783  GGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNARHVEIQMMGDGFGKA 842

Query: 849  LALGERDCSLQRRNQKVIEETPAPNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQ 908
            +A+GERDCSLQRRNQKVIEETPAPNLP  TR KM  A+ERLG+ L Y+ AGTVEFIYDEQ
Sbjct: 843  IAIGERDCSLQRRNQKVIEETPAPNLPEATRAKMRAASERLGSLLKYKCAGTVEFIYDEQ 902

Query: 909  RDQFYFLEVNTRLQVEHPITEMVTGLDLVEWMIKISAGVMPSLDEFNISQNGASIEVRVY 968
            RD+FYFLEVN RLQVEHPITEMVTGLDLVEWM++I+A   P  D   I  +GASIE R+Y
Sbjct: 903  RDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAANDSPDFDNTKIEVSGASIEARLY 962

Query: 969  AENPLKDFRPSPGELVDVQFPNDCRVDTWVKKGTKISPEFDPTLAKIIVHGKDRNEAILK 1028
            AENP+KDFRPSPG+L  V FP+  RVDTWVKKGT +S E+DPTLAKIIVHGKDRN+AI+K
Sbjct: 963  AENPVKDFRPSPGQLTSVSFPSWARVDTWVKKGTNVSAEYDPTLAKIIVHGKDRNDAIMK 1022

Query: 1029 MKKALNETKIYGCVTNVDYLKSLISSEMFRNAQLSTNYLNTYEYSPSAVEIIEPGALTTI 1088
            + +ALNET +YGC+TN+DYL+S+ SS+MF+ A+++T  L++++Y P A E++ PGA T++
Sbjct: 1023 LNQALNETAVYGCITNIDYLRSIASSKMFKEAKVATKVLDSFDYKPCAFEVLAPGANTSV 1082

Query: 1089 QDYPGRVNYWRIGVPPCGPMDNYSFRLANRIVGNDERTPGIEITLTGPTIKFYSDSLVSI 1148
            QDYPGR  YWRIGVPP GPMD+YSFRLANR+VGN+ ++P +EITL GP + F++++++++
Sbjct: 1083 QDYPGRTGYWRIGVPPSGPMDSYSFRLANRVVGNNSKSPALEITLNGPKLLFHTETVIAV 1142

Query: 1149 AGGEVCCKLDEKKIPMFEPISVKTGSVLSIGKIVKGSRAYLAIRGGIDVPKYMGSFSTFT 1208
            +GG V C L++ +I   EPI VK G +LS+GK+  G RAYL+IRGGIDVP+Y+GS STF 
Sbjct: 1143 SGGTVSCTLNDAQIAQNEPIEVKRGDILSVGKVTVGCRAYLSIRGGIDVPEYLGSRSTFA 1202

Query: 1209 MGNLGGFNGRALKRGDVLSLPQQFDSEHGIPSPCFSPEKAPIYVRPDIPNDGVWTIGVLA 1268
            MGN+GG+NGR LK GDVL L Q   S   +P+P F P+ AP  + P +  +  W IGV  
Sbjct: 1203 MGNMGGYNGRILKLGDVLFLNQPELSVSSLPAPDFEPQAAPKSLLPTLSTNKDWKIGVTC 1262

Query: 1269 GPHGAPDIFESEGMMEFFKSEWKVHYNSNRFGVRLIGPKPKWSRTDGGEGGLHPSNTHDY 1328
            GPHG+ D+F+ E + +FF  +WKVHYNSNRFGVRLIGPKPKW+R+DGGE GLHPSN HDY
Sbjct: 1263 GPHGSIDLFKEEYIEQFFNDKWKVHYNSNRFGVRLIGPKPKWARSDGGEAGLHPSNAHDY 1322

Query: 1329 VYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVSEAEMWKVGQLKPGDTINFTPIDWQSA 1388
            VYSLGAINFTGDEPVIITCDGPSLGGFVCQAVV+EAE+WKVGQL PGDTI F P+ +  A
Sbjct: 1323 VYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVAEAELWKVGQLTPGDTIQFVPLSYGVA 1382

Query: 1389 RNLKENQDVIINDMSSCALQKLSDQPLLKSPEDPILFQKDGQELQSPKVVYRQAGDRYIL 1448
            R LKE+QD  I++    +L +LSD  +L   E+PIL     +   SPKV YRQAGDRYIL
Sbjct: 1383 RQLKESQDKSIDNFEEGSLLELSDDKILPKYENPILAVLPKKSDLSPKVTYRQAGDRYIL 1442

Query: 1449 IEYGDDIFELNLCYRIKSLIDIISQRNTKGIKEMSQGVRSVLVEYDGYEISQKELLKTLI 1508
            +EYG+  F+LN+CYRI  LI  + +  T GI EMSQGVRSVL+E+DG +I+QK LLK LI
Sbjct: 1443 VEYGELEFDLNICYRINRLIHQVERHQTVGIVEMSQGVRSVLIEFDGSKINQKALLKCLI 1502

Query: 1509 AYEEQLPQEKNWSVKSRIFRLPMAFEDKETLACVKRYQETIRSKAPWLPNNVDFVAEVNN 1568
            AYE ++  +KNW+VKS+IF+LPMAFED +TL CV RY+ETIRS+APWLPNNVDF+A+VN+
Sbjct: 1503 AYESEIQFDKNWNVKSKIFKLPMAFEDSKTLDCVTRYRETIRSEAPWLPNNVDFIADVND 1562

Query: 1569 LTHDDIRQLIYTTRYMVLGVGDVFLGSPCAIPLDPRNRLLGSKYNPSRTFTKRGVVGIGG 1628
            +  +D++ ++Y+ ++MVLG+GDVFLGSPCA+PLDPR+R LG+KYNPSRT+T RGVVGIGG
Sbjct: 1563 IDRNDVKNMLYSAKFMVLGLGDVFLGSPCAVPLDPRHRYLGTKYNPSRTYTARGVVGIGG 1622

Query: 1629 SYMCIYAAD-SPGGYQLVGRTIPIWDRLMLQSKK-DEPWLLSPFDQIEFYPVSEEQIDEY 1686
             YMCIY A+ SPGGYQLVGRTI  WD+L++     D PWLL+PFDQ+EFYPV+EE+++  
Sbjct: 1623 MYMCIYNAEGSPGGYQLVGRTITAWDKLVIGDHPIDHPWLLTPFDQVEFYPVTEEELEVI 1682

Query: 1687 TDEWDNGNYKIDVDDVVFDHGSYLKWVQDNIEAIEEHQRAQRGDNYSKFAQKIQEANADL 1746
             ++ DNG +KIDV++ +FDH  YL W+ +NI++I   Q AQ G+   +FA+ IQ ANA+L
Sbjct: 1683 IEDNDNGKFKIDVEESIFDHKEYLAWINENIDSIVAFQEAQGGEKADEFARLIQVANAEL 1742

Query: 1747 KQTTTEVIEQNILE--DDCEYIFSEYAGRFWKPIVEIGASIEKDQGVAVIEAMKTEMIVS 1804
            K++  +   Q++ E  DD E ++SEY GRFWKP+  +G  +E   GV +IEAMKTEM+V 
Sbjct: 1743 KKSGDDK-PQDVEEYPDDAELLYSEYTGRFWKPVAAVGDHVEAGDGVIIIEAMKTEMVVG 1801

Query: 1805 SS 1806
            ++
Sbjct: 1802 AT 1803

>Scas_721.40
          Length = 1834

 Score = 2439 bits (6320), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1153/1808 (63%), Positives = 1428/1808 (78%), Gaps = 8/1808 (0%)

Query: 1    MTATNICPSIGWSIQDWIDFHFKSTPKDSYESLLELVKNQRIAPEDPAWISVATXXXXXX 60
            MT      ++GWSI+DWI+FH   T  +S++ L  LV+ Q+IAP DPAW+S+ +      
Sbjct: 1    MTNNIAKKTLGWSIKDWIEFHQSVTADESFKQLQYLVECQQIAPTDPAWLSLCSADTLKK 60

Query: 61   XXXXXXXRHEKEKLPLYGVPIAVKDNIDAKGFPTTAACPSFSYMPTRDSTVVELLKQAGA 120
                   R  KE LPLYGVP+A+KDNIDA+GFPTTAACPSF Y P +DS VV+LL+ AGA
Sbjct: 61   QWQILQHRSGKESLPLYGVPVAIKDNIDARGFPTTAACPSFLYEPEKDSKVVKLLRNAGA 120

Query: 121  IIIGKTNLDQFATGLVGTRSPYGRTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTA 180
            IIIGKTNLDQFATGLVGTRSPYG+TPCVFSDKH              RGIVPIALGTDTA
Sbjct: 121  IIIGKTNLDQFATGLVGTRSPYGKTPCVFSDKHVSGGSSAGSASVVARGIVPIALGTDTA 180

Query: 181  GSGRVPAALNNIIGLKPTRGIFSCSGVVPACKSLDCVSVFSMNLSDAEKCLKIMTKLDIE 240
            GSGRVPAALNN+IGLKPT+G FSC GVVPACKSLDCVSVFS+NLSDAE C KI+ + D+E
Sbjct: 181  GSGRVPAALNNLIGLKPTKGTFSCQGVVPACKSLDCVSVFSLNLSDAECCFKILCESDLE 240

Query: 241  NDEYSRSFPANPLQSFNKNLTVAIPKNVMWYGEKENPLLYDRAIDNFKQLGAQIKIIDFE 300
            NDEYSR++P +PL+ F+ ++T+ IPK+++WYGE+ENP+LYD AI   ++ GA I  IDFE
Sbjct: 241  NDEYSRTYPRSPLRKFSDSVTIGIPKDLLWYGEEENPVLYDNAIKQLEKSGANITKIDFE 300

Query: 301  PLLELARCLYEGTWVAERYAATRKFLETSPQQSTLDPVVYGIIKSATKFDAADAFEYEYK 360
            PLLELARCLYEG WVAERY+A + FL+ +P     D VV  II SA KF A DAF++EYK
Sbjct: 301  PLLELARCLYEGPWVAERYSAVKDFLQKNPSSKGFDHVVKSIIDSAKKFSAVDAFQFEYK 360

Query: 361  RQGILRKVEVLLQDIDVLCVPTCPLNPSFEEVDKEPILVNSRQGTWTNFVNLADLSALAI 420
            RQG+L+K++ LL++ID LCVPTCPLNP+FE+V  EPILVNSRQGTWTNFVNLAD++ALAI
Sbjct: 361  RQGLLQKIDKLLENIDALCVPTCPLNPTFEDVSNEPILVNSRQGTWTNFVNLADMAALAI 420

Query: 421  PVGFRSDGLPNGVTLIAKKFEDYALLQLAKRFLAQLYPSGTRPYGMFLDRYVGLKDDSLE 480
            P GFRSDGLP G+TLI KKF D+ALL LA+ +    YP+ +R +G+F +  V + DD + 
Sbjct: 421  PSGFRSDGLPTGITLIGKKFTDFALLDLAQMYFQIAYPNNSRTFGIFTEG-VEINDDKVS 479

Query: 481  GPIVSSDDSIVLAVVGAHLRGLPLHWQLEKVNATFICSTKTAKKYELYALPKNGPVLKPG 540
            GP++SS DSI LAVVGAHL+GLPLHWQLEKVNATFI STKT+K YELYALP+ GP+LKPG
Sbjct: 480  GPVISSSDSIKLAVVGAHLKGLPLHWQLEKVNATFISSTKTSKNYELYALPRTGPILKPG 539

Query: 541  LRRITSGTGSQIELELYSVPKEKFGEFISFVPEPLGIGSVELENGKWVKSFICEESGYNS 600
            LRR+    G  I++E YS+P E FG FIS VPEPLGIGSVELENG+WVKSFICEESGY +
Sbjct: 540  LRRVNE-EGFAIQVETYSIPVENFGTFISMVPEPLGIGSVELENGEWVKSFICEESGYTA 598

Query: 601  TGSIDISHYGGFRAYIESIIPSNESKKGHFKTVLVANRGEIAVRIIKTLKSMQIKSLAIY 660
             GS++I+ YGGF+ Y++  + +N   K  F TVLVANRGEIAVRIIKTLK M+I+S+AI+
Sbjct: 599  KGSVNITKYGGFKTYLK-FLETNTKTKKPFTTVLVANRGEIAVRIIKTLKKMEIQSVAIF 657

Query: 661  SATDKYSQHVLDVDMAQALDGHTVEETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFA 720
            S  D+YSQHV+D D+   L G +  +TYL++EKII  AKK    AIIPGYGFLSENA F+
Sbjct: 658  STPDRYSQHVIDADLTVDLKGVSAADTYLNIEKIIDAAKKTGAQAIIPGYGFLSENADFS 717

Query: 721  DRCEQEGIQFIGPRGETIRKLGLKHSAREVAKSAGVPLVPGSPLVKNADEAFTIAKNIGY 780
            +RC+ EGI F+GP G+ +R LGLKHSARE+AK A VPLVPGS L+  A EA  IA  + Y
Sbjct: 718  ERCDAEGITFVGPSGDVMRGLGLKHSAREIAKKANVPLVPGSSLITTAHEAKEIAAKLEY 777

Query: 781  PVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQI 840
            P+MVKSTAGGGGIGLQKV++E D+ + FETVKHQG++YFGDSGVFME+FI+NARHVEVQI
Sbjct: 778  PIMVKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGDSGVFMERFIENARHVEVQI 837

Query: 841  MGDGKGKTLALGERDCSLQRRNQKVIEETPAPNLPRETRQKMLTAAERLGAYLNYRGAGT 900
            MGDG G  LA+GERDCSLQRRNQK+IEETPAPNLP  TRQK+  AA+RLG+ L Y+ AGT
Sbjct: 838  MGDGLGNALAIGERDCSLQRRNQKIIEETPAPNLPETTRQKLREAAQRLGSLLKYKCAGT 897

Query: 901  VEFIYDEQRDQFYFLEVNTRLQVEHPITEMVTGLDLVEWMIKISAGVMPSLDEFNISQNG 960
            VEFIYDE RD+FYFLEVNTRLQVEHPITEMVTG+DLVEWM+ I+A + P  ++  I  NG
Sbjct: 898  VEFIYDEIRDEFYFLEVNTRLQVEHPITEMVTGIDLVEWMLVIAADMAPDFNQLKIDVNG 957

Query: 961  ASIEVRVYAENPLKDFRPSPGELVDVQFPNDCRVDTWVKKGTKISPEFDPTLAKIIVHGK 1020
             ++E R+YAENP+ DF+PSPG+LV+V+FP   R+DTWV KGT ++PE+DPTLAKIIVHGK
Sbjct: 958  VAMEARLYAENPVHDFKPSPGQLVEVEFPKWARIDTWVSKGTIVTPEYDPTLAKIIVHGK 1017

Query: 1021 DRNEAILKMKKALNETKIYGCVTNVDYLKSLISSEMFRNAQLSTNYLNTYEYSPSAVEII 1080
            DR++A+ K+ KAL ETK+ GC+TN+DYL+S+ SSEMFR+A++STN LN+Y+Y PSA+EII
Sbjct: 1018 DRHDALEKLNKALVETKVSGCITNIDYLRSISSSEMFRDAKVSTNILNSYDYKPSAMEII 1077

Query: 1081 EPGALTTIQDYPGRVNYWRIGVPPCGPMDNYSFRLANRIVGNDERTPGIEITLTGPTIKF 1140
             PG+ T+IQDYPGR   WRIGVPP GPMD +SFRLAN+IVGN+ + P  EITL GPTI F
Sbjct: 1078 LPGSHTSIQDYPGRKGCWRIGVPPSGPMDAFSFRLANKIVGNNHKAPAFEITLNGPTILF 1137

Query: 1141 YSDSLVSIAGGEVCCKLDEKKIPMFEPISVKTGSVLSIGKIVKGSRAYLAIRGGIDVPKY 1200
            + D+++ I GG   C+L+  +I  F+PI V +G  LSIGK++ G RAYLAIRGG+DVP+Y
Sbjct: 1138 HIDAIIGITGGACVCQLNNTQIEQFKPIHVTSGDKLSIGKLLTGCRAYLAIRGGVDVPEY 1197

Query: 1201 MGSFSTFTMGNLGGFNGRALKRGDVLSLPQQFDSEHGIPSPCFSPEKAPIYVRPDIPNDG 1260
            +GS STFT+GN GG++GR LK GD L + Q   +++ +P   +S +     + PD+P D 
Sbjct: 1198 LGSKSTFTLGNFGGYSGRCLKMGDTLFIDQNKLNKYVLPGHNYSDQPLSYSLLPDMPTDK 1257

Query: 1261 VWTIGVLAGPHGAPDIFESEGMMEFFKSEWKVHYNSNRFGVRLIGPKPKWSRTDGGEGGL 1320
             W IGVL GPHG+PD F+ E +  FF  +WKVHYNSNRFGVRL GPKP W+R DGGEGGL
Sbjct: 1258 QWKIGVLCGPHGSPDFFKPEYVDSFFSEKWKVHYNSNRFGVRLSGPKPVWARKDGGEGGL 1317

Query: 1321 HPSNTHDYVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVSEAEMWKVGQLKPGDTINF 1380
            HPSN HDYVYSLGAINFTGDEPVI+TCDGPSLGGFVC AVV+E+E+WKVGQ+KPGD I F
Sbjct: 1318 HPSNAHDYVYSLGAINFTGDEPVIVTCDGPSLGGFVCHAVVAESELWKVGQVKPGDYIQF 1377

Query: 1381 TPIDWQSARNLKENQDVIINDMSSCALQKLSDQPLLKSPEDPILFQKDGQELQSPKVVYR 1440
             PI ++SAR L ++QDV IN +   +L+ L D   L +PEDP+L     +   SP++ YR
Sbjct: 1378 VPISFESARELMKSQDVAINTLEPKSLKTLDDIITLPTPEDPVLRLLPERPGISPRITYR 1437

Query: 1441 QAGDRYILIEYGDDIFELNLCYRIKSLIDIISQRNTKGIKEMSQGVRSVLVEYDGYEISQ 1500
            QAGDRYIL+EYG++I +LN+CYRI SLI ++   NT GI EMSQGVRSVL+E+D Y ISQ
Sbjct: 1438 QAGDRYILVEYGENIMDLNICYRIHSLIGLVDDYNTAGIVEMSQGVRSVLIEFDPYVISQ 1497

Query: 1501 KELLKTLIAYEEQLPQEKNWSVKSRIFRLPMAFEDKETLACVKRYQETIRSKAPWLPNNV 1560
             +LL  L+AYEE+LP  +NW+V S++ RLPMAFED +T+ACV RYQETIRS APWLPNN 
Sbjct: 1498 TQLLTLLLAYEEELPYTENWTVNSKVIRLPMAFEDSKTMACVARYQETIRSSAPWLPNNA 1557

Query: 1561 DFVAEVNNLTHDDIRQLIYTTRYMVLGVGDVFLGSPCAIPLDPRNRLLGSKYNPSRTFTK 1620
            DFVA +N +TH D+  L+Y+ R+MVLG+GDVFLGSPCA+PLDPR+RLLGSKYNPSRTFT+
Sbjct: 1558 DFVANINGITHKDVYDLVYSARFMVLGLGDVFLGSPCAVPLDPRHRLLGSKYNPSRTFTE 1617

Query: 1621 RGVVGIGGSYMCIYAADSPGGYQLVGRTIPIWDRLMLQSKKDEPWLLSPFDQIEFYPVSE 1680
            RG VG+GG +MCIYAA SPGGYQL+GRTIPIWD+L+L S  ++PWLL+PFDQIEFYPVSE
Sbjct: 1618 RGAVGLGGMFMCIYAASSPGGYQLMGRTIPIWDKLLLLSSSEQPWLLNPFDQIEFYPVSE 1677

Query: 1681 EQIDEYTDEWDNGNYKIDVDDVVFDHGSYLKWVQDNIEAIEEHQRAQRGDNYSKFAQKIQ 1740
            +++D  TD++D G Y +D     F+H  YLKWV +N ++I E Q  Q G+N  KFA+ I+
Sbjct: 1678 KELDRLTDDFDYGKYIVDSRKEKFNHMDYLKWVDENSKSITEFQLLQEGENAEKFAKLIE 1737

Query: 1741 EANADLKQTTTEVIEQNILEDDCE---YIFSEYAGRFWKPIVEIGASIEKDQGVAVIEAM 1797
             +NA+L +   + IE++ + D  E    I+SEY+GRFWKP+V  G  ++  QG+ +IEAM
Sbjct: 1738 LSNAELDE--NDEIEKDQVNDYPENSVMIYSEYSGRFWKPLVTEGEFVKSGQGLIIIEAM 1795

Query: 1798 KTEMIVSS 1805
            KTEM+V +
Sbjct: 1796 KTEMLVPT 1803

>Kwal_27.11951
          Length = 1869

 Score = 2424 bits (6283), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1141/1808 (63%), Positives = 1421/1808 (78%), Gaps = 8/1808 (0%)

Query: 1    MTATNICPSIGWSIQDWIDFHFKSTPKDSYESLLELVKNQRIAPEDPAWISVATXXXXXX 60
            M++ N   ++GWS+QDW+ FH ++TP+ S  +L  L+  Q+ APEDPAWIS+ +      
Sbjct: 40   MSSVN---TLGWSVQDWLGFHAEATPEASLAALSALIGAQKSAPEDPAWISLVSQEHLEH 96

Query: 61   XXXXXXXRHEKEKLPLYGVPIAVKDNIDAKGFPTTAACPSFSYMPTRDSTVVELLKQAGA 120
                   + +K++LPLYGVPIAVKDNIDA G  TTAACP F+Y P+ DSTVV LL+ AGA
Sbjct: 97   QWRILQSKGDKKELPLYGVPIAVKDNIDATGCETTAACPEFAYTPSNDSTVVALLRDAGA 156

Query: 121  IIIGKTNLDQFATGLVGTRSPYGRTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTA 180
            I+IGKTNLDQFATGLVGTRSPYG+TPCVFS++H              RGIVP+ALGTDTA
Sbjct: 157  IVIGKTNLDQFATGLVGTRSPYGKTPCVFSNEHVSGGSSAGSASVVGRGIVPLALGTDTA 216

Query: 181  GSGRVPAALNNIIGLKPTRGIFSCSGVVPACKSLDCVSVFSMNLSDAEKCLKIMTKLDIE 240
            GSGRVPAALNN+IGLKP++G+FSCSGVVPACKSLDCVS+F++NL DAE+C K+M + D E
Sbjct: 217  GSGRVPAALNNLIGLKPSKGVFSCSGVVPACKSLDCVSIFALNLGDAERCFKVMAQPDTE 276

Query: 241  NDEYSRSFPANPLQSFNKNLTVAIPKNVMWYGEKENPLLYDRAIDNFKQLGAQIKIIDFE 300
             DEYSR+ PANPLQ + K+ T+A+P  + WY E EN + Y  AI+N K+ GA++  +DFE
Sbjct: 277  KDEYSRAMPANPLQKYAKDATIAVPTKLPWYDETENFVHYAAAIENLKKTGAKVVEVDFE 336

Query: 301  PLLELARCLYEGTWVAERYAATRKFLETSPQQSTLDPVVYGIIKSATKFDAADAFEYEYK 360
            PLLELARCLYEG WVAERY ATR F   +P +S+LDP V  IIK    +DAADAF YEYK
Sbjct: 337  PLLELARCLYEGAWVAERYEATRDFFAKNPSESSLDPTVTKIIKGGANYDAADAFRYEYK 396

Query: 361  RQGILRKVEVLLQDIDVLCVPTCPLNPSFEEVDKEPILVNSRQGTWTNFVNLADLSALAI 420
            RQGIL+KV  LL+ IDVLCVPTCP NP+F +++  P+ +NSRQGTWTNFVNLADL+ALA+
Sbjct: 397  RQGILQKVSKLLETIDVLCVPTCPHNPTFAQLEAMPVEMNSRQGTWTNFVNLADLAALAV 456

Query: 421  PVGFRSDGLPNGVTLIAKKFEDYALLQLAKRFLAQLYPSGTRPYGMFLDRYVGLKDDSLE 480
            P GFRSDGLP G+TLI K F DYALL+LA R+    +P+ +R YG FL+  +  +D+ L+
Sbjct: 457  PCGFRSDGLPTGITLIGKTFTDYALLELANRYFQIAFPNNSRTYGKFLETPITTQDN-LQ 515

Query: 481  GPIVSSDDSIVLAVVGAHLRGLPLHWQLEKVNATFICSTKTAKKYELYALPKNGPVLKPG 540
            GP  S++DSI LAVVGAHL+GLPLHWQLEKVNA +I S KT+  Y LYALPK GPVLKPG
Sbjct: 516  GPPFSTEDSIKLAVVGAHLKGLPLHWQLEKVNAQYIGSPKTSPNYRLYALPKTGPVLKPG 575

Query: 541  LRRITSGTGSQIELELYSVPKEKFGEFISFVPEPLGIGSVELENGKWVKSFICEESGYNS 600
            LRR+ S  G+QI+LE+YSVPK++FG FIS VPEPLGIGSVELE+G+WVKSFICEE GY  
Sbjct: 576  LRRVDSEGGAQIQLEVYSVPKDQFGTFISMVPEPLGIGSVELESGEWVKSFICEEFGYTQ 635

Query: 601  TGSIDISHYGGFRAYIESIIPSNESKKGHFKTVLVANRGEIAVRIIKTLKSMQIKSLAIY 660
             G+ DI+  G F+ Y++ +      KK  F+TVLVANRGEIAVRIIKTLK ++IKS+A+Y
Sbjct: 636  DGTKDITELGSFKTYVDQLAREESEKKKPFETVLVANRGEIAVRIIKTLKKLKIKSVAVY 695

Query: 661  SATDKYSQHVLDVDMAQALDGHTVEETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFA 720
            S  DKYSQHV D D+A AL G T  ETYL ++KII+ AK+   +AIIPGYGFLSENA F+
Sbjct: 696  SDPDKYSQHVTDADVAVALKGRTAAETYLDIDKIIAAAKETGTEAIIPGYGFLSENADFS 755

Query: 721  DRCEQEGIQFIGPRGETIRKLGLKHSAREVAKSAGVPLVPGSPLVKNADEAFTIAKNIGY 780
            DRC  EGI F+GP G+ IRKLGLKHSARE+A+ AGVPLVPGS LVK   EA  IAK + Y
Sbjct: 756  DRCASEGIVFVGPAGDAIRKLGLKHSAREIAEKAGVPLVPGSGLVKTPQEAREIAKALEY 815

Query: 781  PVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQI 840
            PVMVKSTAGGGGIGLQKVD+E+D+ + FETV+HQG +YFGDSGVF+E+F++NARHVE+Q+
Sbjct: 816  PVMVKSTAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQM 875

Query: 841  MGDGKGKTLALGERDCSLQRRNQKVIEETPAPNLPRETRQKMLTAAERLGAYLNYRGAGT 900
            MGDGKGK +A+GERDCSLQRRNQKVIEETPAPNL  +TR +M  A+E LG+ L YR AGT
Sbjct: 876  MGDGKGKAIAIGERDCSLQRRNQKVIEETPAPNLSEKTRARMREASENLGSLLKYRCAGT 935

Query: 901  VEFIYDEQRDQFYFLEVNTRLQVEHPITEMVTGLDLVEWMIKISAGVMPSLDEFNISQNG 960
            VEFIYDE+RD+FYFLEVN RLQVEHPITEMVTGLDLVEWM+ I+AG  P  D   I+  G
Sbjct: 936  VEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLLIAAGTPPDFDATKITVTG 995

Query: 961  ASIEVRVYAENPLKDFRPSPGELVDVQFPNDCRVDTWVKKGTKISPEFDPTLAKIIVHGK 1020
            ASIE R+YAENP+KDFRPSPG+L DV FP   RVDTWV KGT IS E+DPTLAKIIVHGK
Sbjct: 996  ASIEARLYAENPVKDFRPSPGQLTDVSFPEWARVDTWVSKGTTISAEYDPTLAKIIVHGK 1055

Query: 1021 DRNEAILKMKKALNETKIYGCVTNVDYLKSLISSEMFRNAQLSTNYLNTYEYSPSAVEII 1080
            DR+EAI K+ +ALNET IYGC+TN+DYL+S+ SSEMF+ A+++T  L++Y+Y PSA EI 
Sbjct: 1056 DRDEAIQKLNQALNETSIYGCITNIDYLRSIASSEMFKTAKVATKVLDSYDYRPSAFEIT 1115

Query: 1081 EPGALTTIQDYPGRVNYWRIGVPPCGPMDNYSFRLANRIVGNDERTPGIEITLTGPTIKF 1140
             PGA TT+QDYPGRV +WRIGVPP GPMD+YSFRLANRIVGN  + P IEITL GP + F
Sbjct: 1116 SPGAYTTVQDYPGRVRHWRIGVPPSGPMDSYSFRLANRIVGNHYKAPAIEITLNGPKLLF 1175

Query: 1141 YSDSLVSIAGGEVCCKLDEKKIPMFEPISVKTGSVLSIGKIVKGSRAYLAIRGGIDVPKY 1200
            ++D++++I G +  C ++   +   +P+SVK G  L++GK+  G RAYLAIRGGIDVP+Y
Sbjct: 1176 HTDAVIAITGAKAPCTINGSDVSQNKPLSVKKGDQLTVGKLSDGCRAYLAIRGGIDVPEY 1235

Query: 1201 MGSFSTFTMGNLGGFNGRALKRGDVLSLPQQFDSEHGIPSPCFSPEKAPIYVRPDIPNDG 1260
            +GS STF +GN+GG+NGR LK GDVL L Q      GIP+P + P + P  + P I    
Sbjct: 1236 LGSRSTFALGNMGGYNGRVLKLGDVLFLNQPELPSSGIPAPVYDPSEPPASLLPAISGSK 1295

Query: 1261 VWTIGVLAGPHGAPDIFESEGMMEFFKSEWKVHYNSNRFGVRLIGPKPKWSRTDGGEGGL 1320
             W IGV  GPHG+PD F+ E + EFF  +WKVHYNSNRFGVRLIGPKPKW+R DGGEGGL
Sbjct: 1296 EWKIGVTCGPHGSPDFFKPESVEEFFSEQWKVHYNSNRFGVRLIGPKPKWARKDGGEGGL 1355

Query: 1321 HPSNTHDYVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVSEAEMWKVGQLKPGDTINF 1380
            HPSN HDYVYSLGAINFTGDEPVIIT DGPSLGGFVCQAVV E E+WKVGQ+KPGD I F
Sbjct: 1356 HPSNAHDYVYSLGAINFTGDEPVIITADGPSLGGFVCQAVVPEGELWKVGQVKPGDLIQF 1415

Query: 1381 TPIDWQSARNLKENQDVIINDMSSCALQKLSDQPLLKSPEDPILFQKDGQELQSPKVVYR 1440
             P+ +++AR LKE+QD  I    + +L+ L+ + +L + E+P+L Q       SPKV YR
Sbjct: 1416 VPVSYETARVLKESQDQAIETFENGSLRTLTSELVLPAAENPVLAQLPRYSEFSPKVTYR 1475

Query: 1441 QAGDRYILIEYGDDIFELNLCYRIKSLIDIISQRNTKGIKEMSQGVRSVLVEYDGYEISQ 1500
            QAGDRY+L+EYG++  +LN+ YR+  LI+++ +  T GI EMSQGVRSVLVE+DGY+ISQ
Sbjct: 1476 QAGDRYVLVEYGENEMDLNISYRVNRLINLVEKNKTIGIVEMSQGVRSVLVEFDGYKISQ 1535

Query: 1501 KELLKTLIAYEEQLPQEKNWSVKSRIFRLPMAFEDKETLACVKRYQETIRSKAPWLPNNV 1560
            K LL+TLIAYE ++  ++NWS+KS++F+LP+AFED ETL CVKRYQETIRSKAPWLPNNV
Sbjct: 1536 KALLETLIAYEGEIKFDRNWSIKSKVFKLPLAFEDSETLECVKRYQETIRSKAPWLPNNV 1595

Query: 1561 DFVAEVNNLTHDDIRQLIYTTRYMVLGVGDVFLGSPCAIPLDPRNRLLGSKYNPSRTFTK 1620
            DF+A+VN ++H D+  ++Y  R++VLG+GDVFLG+PCA+PL+P +R LGSKYNPSRT+TK
Sbjct: 1596 DFIADVNGISHSDVEDMLYQARFLVLGLGDVFLGAPCAVPLNPTHRFLGSKYNPSRTYTK 1655

Query: 1621 RGVVGIGGSYMCIYAADSPGGYQLVGRTIPIWDRLMLQSKKDE-PWLLSPFDQIEFYPVS 1679
             G VGIGG YMCIYA DSPGGYQLVGRTIPIWD+L L +   + PWLL+PFDQ+E+Y V+
Sbjct: 1656 NGTVGIGGMYMCIYAMDSPGGYQLVGRTIPIWDKLQLGAHSSQHPWLLTPFDQVEYYQVT 1715

Query: 1680 EEQIDEYTDEWDNGNYKIDVDDVVFDHGSYLKWVQDNIEAIEEHQRAQRGDNYSKFAQKI 1739
            E++++++T+E +NG + + V++  FDHG YLKW+  N E I+E Q  Q G+   +FA+ I
Sbjct: 1716 EDELNKFTEECENGQFPVQVEESTFDHGEYLKWIDANSEIIKEFQNKQNGEKAEEFAKLI 1775

Query: 1740 QEANADLKQT--TTEVIEQNILEDDCEYIFSEYAGRFWKPIVEIGASIEKDQGVAVIEAM 1797
            QE+NA+L++   +   +E+   E D E ++SEY+GRFWKP+V +G  ++   G+ V+EAM
Sbjct: 1776 QESNAELEKAPDSQGAVEEEFPE-DAEMVYSEYSGRFWKPLVSVGDVVKAGDGLIVVEAM 1834

Query: 1798 KTEMIVSS 1805
            KTEM+VS+
Sbjct: 1835 KTEMMVSA 1842

>ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH]
            (796213..801672) [5460 bp, 1819 aa]
          Length = 1819

 Score = 2137 bits (5538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1030/1808 (56%), Positives = 1328/1808 (73%), Gaps = 23/1808 (1%)

Query: 4    TNICPSIGWSIQDWIDFHFKSTPKDSYESLLELVKNQRIAPEDPAWISVATXXXXXXXXX 63
            T+   ++GW+ Q W +FH +++   S   LL L   +R A    AWISVA+         
Sbjct: 2    TDHSSTVGWTSQQWREFHRRASADASLARLLALAHAERDA--GAAWISVASDEHIEHQWR 59

Query: 64   XXXXRHEKEKLPLYGVPIAVKDNIDAKGFPTTAACPSFSYMPTRDSTVVELLKQAGAIII 123
                R ++++LPLYGVP+AVKDNID +G  TTAACPSF+Y   +D+T V LL+ AGA+I+
Sbjct: 60   VLQSRGDRQRLPLYGVPVAVKDNIDVRGLATTAACPSFAYTAAQDATAVRLLRDAGAVIL 119

Query: 124  GKTNLDQFATGLVGTRSPYGRTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSG 183
            GKTN+DQFATGLVGTRSPYG     FS  H              RG VP+ LGTDTAGSG
Sbjct: 120  GKTNMDQFATGLVGTRSPYGSVASAFSSAHAAGGSSSGSAVVVARGAVPLTLGTDTAGSG 179

Query: 184  RVPAALNNIIGLKPTRGIFSCSGVVPACKSLDCVSVFSMNLSDAEKCLKIMTKLDIENDE 243
            RVPAALNN++G+KPTRG  SC+GVVPAC+SLDCVSVF+ +++DA +CL+I+ + D  +D 
Sbjct: 180  RVPAALNNLVGVKPTRGTVSCTGVVPACRSLDCVSVFARDVADAHRCLRILARPD-GSDP 238

Query: 244  YSRSFPANPLQSFNKNLTVAIPKNVMWYGEKENPLLYDRAIDNFKQLGAQIKIIDFEPLL 303
            YSR  PA+  +  +    V +P+   W+GE +N  L+  A    +  GA++  +D +PLL
Sbjct: 239  YSRPSPADAPRRLSTCPVVGVPREPEWFGESQNAKLFATACQRMRATGARVVKVDPQPLL 298

Query: 304  ELARCLYEGTWVAERYAATRKFLETSPQQSTLDPVVYGIIKSATKFDAADAFEYEYKRQG 363
            +L R LYEG WVAERYAA R F    P + TLDP V GII SA  + AAD F++  +RQ 
Sbjct: 299  DLGRSLYEGPWVAERYAAMRAFYSGQPPRDTLDPTVTGIITSAGGYSAADVFDHGLRRQK 358

Query: 364  ILRKVEVLLQDIDVLCVPTCPLNPSFEEVDKEPILVNSRQGTWTNFVNLADLSALAIPVG 423
            ++  +E  L  +D L VPTCPLNP+   +  EP+LVN+RQG WTNFVNLADL+A+AIP G
Sbjct: 359  LVAAIEAELAGVDALLVPTCPLNPTLAAIAAEPLLVNARQGMWTNFVNLADLAAVAIPAG 418

Query: 424  FRSDGLPNGVTLIAKKFEDYALLQLAKRFL----AQLYPSGTRPYGMFLDRYVGLKDDSL 479
            FR DGLP GVTL+ +KF D ALL+L  R L    A+    G  P G  L      +D+ +
Sbjct: 419  FRRDGLPQGVTLVGRKFSDLALLELGSRLLRVEDAEPRRCGALPAGQAL-----CEDEVV 473

Query: 480  EGPIVSSDDSIVLAVVGAHLRGLPLHWQLEKVNATFICSTKTAKKYELYALPKNGPVLKP 539
             G     D +++LAVVGAHLRGL LHWQL++V A F+   +TA  Y LYALPK GPVLKP
Sbjct: 474  SGS-EERDSTVLLAVVGAHLRGLALHWQLDEVQAEFVREARTAPSYRLYALPKTGPVLKP 532

Query: 540  GLRRITSGTGSQIELELYSVPKEKFGEFISFVPEPLGIGSVELENGKWVKSFICEESGYN 599
             LRR+ +G G+ IELE YSVP+  FG F++ VP PL IGSVELE+G+++KSF+CEE GY 
Sbjct: 533  ALRRVCAGKGAAIELEAYSVPEATFGRFVAMVPAPLAIGSVELESGEYIKSFVCEEDGYI 592

Query: 600  STGSIDISHYGGFRAYIESIIPSNESKKGHFKTVLVANRGEIAVRIIKTLKSMQIKSLAI 659
              G++DI+H GGFR Y+E +    +  K  F TVLVANRGEIAVRII+TLK + I+S+A+
Sbjct: 593  QDGTVDITHLGGFRRYVEHLRRQRDVDK-PFDTVLVANRGEIAVRIIRTLKRLGIRSVAV 651

Query: 660  YSATDKYSQHVLDVDMAQALDGHTVEETYLHVEKIISIAKKYDVDAIIPGYGFLSENASF 719
            YS  D++SQHV D D+A AL G +  ETYL ++KI++ AKK D  AIIPGYGFLSENA+F
Sbjct: 652  YSDPDRHSQHVRDADVAVALGGSSAAETYLDIDKILAAAKKTDTQAIIPGYGFLSENATF 711

Query: 720  ADRCEQEGIQFIGPRGETIRKLGLKHSAREVAKSAGVPLVPGSPLVKNADEAFTIAKNIG 779
            A+RC  EGI F+GP G++IRKLGLKH ARE+A SAGVPL  G+ L+++A  A    + IG
Sbjct: 712  AERCGAEGIVFVGPSGDSIRKLGLKHWARELAASAGVPLTKGTGLLQSASAALEAGEEIG 771

Query: 780  YPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQ 839
            YP+MVKSTAGGGGIGLQ+VD+  ++  AFE V+ QG  YF DSGVF+E FI  ARHVEVQ
Sbjct: 772  YPLMVKSTAGGGGIGLQRVDSAAELAAAFEQVQRQGELYFTDSGVFLESFIARARHVEVQ 831

Query: 840  IMGDGKGKTLALGERDCSLQRRNQKVIEETPAPNLPRETRQKMLTAAERLGAYLNYRGAG 899
            IMGDG G+T+ALGERDCSLQRRNQK+IEETPAPNLP  TRQKM  AA+RL + + Y+ AG
Sbjct: 832  IMGDGHGRTVALGERDCSLQRRNQKIIEETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAG 891

Query: 900  TVEFIYDEQRDQFYFLEVNTRLQVEHPITEMVTGLDLVEWMIKISAGVMPSLDEFNISQN 959
            TVEF+YDEQ+D+FYFLEVNTRLQVEHPITEMVTGLDLVEWM++I+A   P  D   +   
Sbjct: 892  TVEFMYDEQKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMLRIAANTPPDFDA-GVEIE 950

Query: 960  GASIEVRVYAENPLKDFRPSPGELVDVQFPNDCRVDTWVKKGTKISPEFDPTLAKIIVHG 1019
            G S+E RVY ENP+K F PSPG L +V FP+  RVDTW+ KGT+++ E+DPTLAKIIVHG
Sbjct: 951  GVSMEARVYVENPVKGFTPSPGLLTEVVFPSWARVDTWILKGTRVAAEYDPTLAKIIVHG 1010

Query: 1020 KDRNEAILKMKKALNETKIYGCVTNVDYLKSLISSEMFRNAQLSTNYLNTYEYSPSAVEI 1079
            KDR +A+ K+  AL+ET+I GC+TN+DYLKS+ SSE FR A + T  LN +EY+P+A E+
Sbjct: 1011 KDREDAVSKLLLALSETRIAGCMTNLDYLKSIASSEEFRKASVFTRLLNDFEYTPTAFEV 1070

Query: 1080 IEPGALTTIQDYPGRVNYWRIGVPPCGPMDNYSFRLANRIVGNDERTPGIEITLTGPTIK 1139
              PGA TTIQDYPGRV YWRIGVPP GPMD+YSFRLANR+VGND +   +EITL GP +K
Sbjct: 1071 KIPGAYTTIQDYPGRVGYWRIGVPPSGPMDSYSFRLANRVVGNDSKAAALEITLNGPELK 1130

Query: 1140 FYSDSLVSIAGGEVCCKLDEKKIPMFEPISVKTGSVLSIGKIVKGSRAYLAIRGGIDVPK 1199
            F+SD+++++ GG V   L+ K +  + P++++ G VL IGK+  GSRAYLA+RGGIDVP+
Sbjct: 1131 FHSDAVIAVTGGAVPVTLNGKPVLQYVPLTLEKGDVLKIGKLESGSRAYLAVRGGIDVPE 1190

Query: 1200 YMGSFSTFTMGNLGGFNGRALKRGDVLSLPQQFDSEHGIPSPCFSPEKAPIYVRPDIPND 1259
            ++GS STF MG +GG NGR L  GDVL + +  DS   +      P      ++P IP +
Sbjct: 1191 FLGSRSTFAMGGIGGHNGRVLAPGDVLFINK--DSSVAVGDTVTIPSG----LQPVIPRE 1244

Query: 1260 GVWTIGVLAGPHGAPDIFESEGMMEFFKSEWKVHYNSNRFGVRLIGPKPKWSRTDGGEGG 1319
              W IG++ GPHG+PD F+ E + EFF S WKVHYNSNRFG+RLIGPKPKW+R+DGGE G
Sbjct: 1245 S-WKIGLVCGPHGSPDFFKREALEEFFSSPWKVHYNSNRFGIRLIGPKPKWARSDGGEAG 1303

Query: 1320 LHPSNTHDYVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVSEAEMWKVGQLKPGDTIN 1379
            LHPSNTHDYVYS+GAINFTGDEPVII  +GPSLGGFVC AVV EAE+WKVGQLKPGDTI 
Sbjct: 1304 LHPSNTHDYVYSVGAINFTGDEPVIIAAEGPSLGGFVCAAVVPEAELWKVGQLKPGDTIK 1363

Query: 1380 FTPIDWQSARNLKENQDVIINDMSSCALQKLSDQPLLKSPEDPILFQKDGQELQSPKVVY 1439
            F PI   +AR LK +QD  ++ +   +  KL D  +L S +DP+L +   +    PKV +
Sbjct: 1364 FVPISVDTARALKRSQDAAVDALDILSSIKLDDSMVLPSYQDPVLLRLAKRSGLCPKVTF 1423

Query: 1440 RQAGDRYILIEYGDDIFELNLCYRIKSLIDIISQRNTKGIKEMSQGVRSVLVEYDGYEIS 1499
            RQ+GDRYILIEYG++  ++N+ YRIK L +++++    GI EMSQG+RS+LVEY+GY IS
Sbjct: 1424 RQSGDRYILIEYGENEMDINISYRIKQLQEMVTKNKVTGIVEMSQGIRSLLVEYNGYTIS 1483

Query: 1500 QKELLKTLIAYEEQLPQEKNWSVKSRIFRLPMAFEDKETLACVKRYQETIRSKAPWLPNN 1559
            Q++LL  L AYE ++  + +W VK+++FRLPMAFED +TL  V+RYQETIRS APWLP+N
Sbjct: 1484 QEDLLSVLSAYELEINFDVDWKVKAKLFRLPMAFEDSKTLEAVRRYQETIRSDAPWLPSN 1543

Query: 1560 VDFVAEVNNLTHDDIRQLIYTTRYMVLGVGDVFLGSPCAIPLDPRNRLLGSKYNPSRTFT 1619
             DFVA VN +T  D+R L+Y+  +MVLG+GDVFLG+PCA+PLDPR RLLG+KYNPSRT+T
Sbjct: 1544 ADFVANVNGITRADVRDLLYSATFMVLGLGDVFLGAPCAVPLDPRQRLLGTKYNPSRTYT 1603

Query: 1620 KRGVVGIGGSYMCIYAADSPGGYQLVGRTIPIWDRLML-QSKKDEPWLLSPFDQIEFYPV 1678
              GVVGIGG YMCIY  DSPGGYQL+GRTIPIW+RL L ++ KD PWLL+PFDQ+EFYPV
Sbjct: 1604 PNGVVGIGGMYMCIYCTDSPGGYQLMGRTIPIWNRLQLGEAWKDHPWLLTPFDQVEFYPV 1663

Query: 1679 SEEQIDEYTDEWDNGNYKIDVDDVVFDHGSYLKWVQDNIEAIEEHQRAQRGDNYSKFAQK 1738
            SEE+I+E T+E +NG ++++V + VFD+G+Y +W++DN E+I+  +  Q G+  ++FA+ 
Sbjct: 1664 SEERINELTEEVENGTFELEVKETVFDNGAYNRWLEDNRESIQAFKEGQSGERAAEFARL 1723

Query: 1739 IQEANADLKQTTTEVIEQNILEDDCEYIFSEYAGRFWKPIVEIGASIEKDQGVAVIEAMK 1798
            I+ AN+DL+    +  E     +D   ++SEYAGRFWK +V +G  +++   + +IEAMK
Sbjct: 1724 IKVANSDLETAVRKEAEPVEYPEDAHMVYSEYAGRFWKQVVSVGDKVKEGDKLVIIEAMK 1783

Query: 1799 TEMIVSSS 1806
            TEM+VS++
Sbjct: 1784 TEMVVSAT 1791

>CAGL0K06787g complement(659290..662817) highly similar to sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2 Pyruvate
            carboxylase 2, start by similarity
          Length = 1175

 Score =  318 bits (815), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 191/458 (41%), Positives = 271/458 (59%), Gaps = 15/458 (3%)

Query: 623  NESKKGHFKTVLVANRGEIAVRIIKTLKSMQIKSLAIYSATDKYSQHVLDVDMAQALDG- 681
            N S  G    +LVANRGEI +RI ++   + ++++AIYS  D+ S H L  D A  +   
Sbjct: 13   NFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGKE 72

Query: 682  --HTVEETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFADRCEQEGIQFIGPRGETIR 739
              +T    YL +++II IAKK+ VD I PGYGFLSENA FAD+ ++ GI +IGP  E I 
Sbjct: 73   GEYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAGITWIGPPPEVIE 132

Query: 740  KLGLKHSAREVAKSAGVPLVPGSP-LVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKV 798
             +G K SAR +A  A VP VPG+P  ++  +EA       GYPV++K+  GGGG G++ V
Sbjct: 133  SVGDKVSARNLAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKAAYGGGGRGMRVV 192

Query: 799  DNEQDMRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQIMGDGKGKTLALGERDCSL 858
                D+  AF+  K +  + FG+   F+E+F+D  +H+EVQ++ D  G  + L ERDCS+
Sbjct: 193  REGDDVADAFQRAKSEAITAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSV 252

Query: 859  QRRNQKVIEETPAPNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVN 918
            QRR+QKV+E  PA  LPRE R  +LT A RL     YR AGT EF+ D Q ++ YF+E+N
Sbjct: 253  QRRHQKVVEVAPAKTLPREVRDSILTDAVRLAKEAGYRNAGTAEFLVDNQ-NRHYFIEIN 311

Query: 919  TRLQVEHPITEMVTGLDLVEWMIKISAGV-MPSLDEFN--ISQNGASIEVRVYAENPLKD 975
             R+QVEH ITE +TG+DLV   I+I+AG  +P L      I+  G +I+ R+  E+P K+
Sbjct: 312  PRIQVEHTITEEITGIDLVSAQIQIAAGASLPQLGLLQDRITTRGFAIQCRITTEDPAKN 371

Query: 976  FRPSPG--ELVDVQFPNDCRVDTWVK-KGTKISPEFDPTLAKIIVHGKDRNEAILKMKKA 1032
            F+P  G  E+      N  R+D      G  ISP +D  L K    G        KM +A
Sbjct: 372  FQPDTGRLEVYRSAGGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMLRA 431

Query: 1033 LNETKIYGCVTNVDYLKSLISSEMFRNAQLSTNYLNTY 1070
            L E +I G  TN+ +L +L++  +F    +S +Y  T+
Sbjct: 432  LIEFRIRGVKTNIPFLLTLLTHPVF----ISGDYWTTF 465

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (50%)

Query: 1744 ADLKQTTTEVIEQNILEDDCEYIFSEYAGRFWKPIVEIGASIEKDQGVAVIEAMKTEMIV 1803
            AD  Q    + +      D   I +  AG   +  V  G+ ++K Q VAV+ AMK EM++
Sbjct: 1081 ADKSQVVQTIAKPKADGHDPLQIGAPMAGVIVEVKVHKGSQVKKGQPVAVLSAMKMEMVI 1140

Query: 1804 SSS 1806
            SS+
Sbjct: 1141 SST 1143

>YBR218C (PYC2) [399] chr2 complement(658664..662206) Pyruvate
            carboxylase 2 [3543 bp, 1180 aa]
          Length = 1180

 Score =  312 bits (800), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 185/456 (40%), Positives = 267/456 (58%), Gaps = 11/456 (2%)

Query: 623  NESKKGHFKTVLVANRGEIAVRIIKTLKSMQIKSLAIYSATDKYSQHVLDVDMAQALD-- 680
            N S  G    +LVANRGEI +RI ++   + ++++AIYS  D+ S H L  D A  +   
Sbjct: 13   NFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTIAIYSHEDRLSMHRLKADEAYVIGEE 72

Query: 681  -GHTVEETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFADRCEQEGIQFIGPRGETIR 739
              +T    YL +++II IAKK+ VD I PGYGFLSEN+ FAD+  + GI +IGP  E I 
Sbjct: 73   GQYTPVGAYLAMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKAGITWIGPPAEVID 132

Query: 740  KLGLKHSAREVAKSAGVPLVPGSP-LVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKV 798
             +G K SAR +A  A VP VPG+P  ++   EA       GYPV++K+  GGGG G++ V
Sbjct: 133  SVGDKVSARHLAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKAAFGGGGRGMRVV 192

Query: 799  DNEQDMRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQIMGDGKGKTLALGERDCSL 858
                D+  AF+    +  + FG+   F+E+F+D  +H+EVQ++ D  G  + L ERDCS+
Sbjct: 193  REGDDVADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSV 252

Query: 859  QRRNQKVIEETPAPNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVN 918
            QRR+QKV+E  PA  LPRE R  +LT A +L     YR AGT EF+ D Q ++ YF+E+N
Sbjct: 253  QRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEFLVDNQ-NRHYFIEIN 311

Query: 919  TRLQVEHPITEMVTGLDLVEWMIKISAGVMPS---LDEFNISQNGASIEVRVYAENPLKD 975
             R+QVEH ITE +TG+D+V   I+I+AG   +   L +  I+  G SI+ R+  E+P K+
Sbjct: 312  PRIQVEHTITEEITGIDIVSAQIQIAAGATLTQLGLLQDKITTRGFSIQCRITTEDPSKN 371

Query: 976  FRPSPG--ELVDVQFPNDCRVDTW-VKKGTKISPEFDPTLAKIIVHGKDRNEAILKMKKA 1032
            F+P  G  E+      N  R+D      G  ISP +D  L K    G        KM +A
Sbjct: 372  FQPDTGRLEVYRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGSTYEIVRRKMIRA 431

Query: 1033 LNETKIYGCVTNVDYLKSLISSEMFRNAQLSTNYLN 1068
            L E +I G  TN+ +L +L+++ +F      T +++
Sbjct: 432  LIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFID 467

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 31/62 (50%)

Query: 1744 ADLKQTTTEVIEQNILEDDCEYIFSEYAGRFWKPIVEIGASIEKDQGVAVIEAMKTEMIV 1803
            AD  Q    V +      D   I +  AG   +  V  G+ ++K + +AV+ AMK EM+V
Sbjct: 1082 ADKSQNIQSVAKPKADVHDTHQIGAPMAGVIIEVKVHKGSLVKKGESIAVLSAMKMEMVV 1141

Query: 1804 SS 1805
            SS
Sbjct: 1142 SS 1143

>Scas_686.17
          Length = 1176

 Score =  304 bits (779), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 190/458 (41%), Positives = 274/458 (59%), Gaps = 15/458 (3%)

Query: 623  NESKKGHFKTVLVANRGEIAVRIIKTLKSMQIKSLAIYSATDKYSQHVLDVDMAQAL--D 680
            N S  G    +LVANRGEI +RI ++   + ++++AIYS  D+ S H L  D +  +  +
Sbjct: 12   NFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADESYVIGEE 71

Query: 681  GH-TVEETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFADRCEQEGIQFIGPRGETIR 739
            G  T    YL +++II+IAKK+ VD I PGYGFLSEN+ FAD+  + GI +IGP  E I 
Sbjct: 72   GQFTPVGAYLAIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVAKAGITWIGPPAEVID 131

Query: 740  KLGLKHSAREVAKSAGVPLVPGSP-LVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKV 798
             +G K SAR +A  A VP VPG+P  +K+  EA       GYPV++K+  GGGG G++ V
Sbjct: 132  SVGDKVSARYLAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAAFGGGGRGMRVV 191

Query: 799  DNEQDMRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQIMGDGKGKTLALGERDCSL 858
               +D+  AF+    +  + FGD   F+E+F+D+ +H+EVQ++GD  G  + L ERDCS+
Sbjct: 192  REGEDINDAFQRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGNVVHLFERDCSV 251

Query: 859  QRRNQKVIEETPAPNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVN 918
            QRR+QKV+E  PA N+PRE R  +LT A +L     YR AGT EF+ D Q ++ YF+E+N
Sbjct: 252  QRRHQKVVEVAPAKNIPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQ-NRHYFIEIN 310

Query: 919  TRLQVEHPITEMVTGLDLVEWMIKISAG---VMPSLDEFNISQNGASIEVRVYAENPLKD 975
             R+QVEH ITE +TG+DLV   I+I+AG       L +  I+  G +I+ R+  E+P K+
Sbjct: 311  PRIQVEHTITEEITGIDLVAAQIQIAAGASLAQLGLLQDRITTRGFAIQCRITTEDPAKN 370

Query: 976  FRPSPG--ELVDVQFPNDCRVDTW-VKKGTKISPEFDPTLAKIIVHGKDRNEAILKMKKA 1032
            F+P  G  E+      N  R+D      G  ISP +D  L K    G        KM +A
Sbjct: 371  FQPDTGRLEVYRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMIRA 430

Query: 1033 LNETKIYGCVTNVDYLKSLISSEMFRNAQLSTNYLNTY 1070
            L E +I G  TN+ +L +L++  +F    +S +Y  T+
Sbjct: 431  LIEFRIRGVKTNIPFLLTLLTHPVF----ISGDYWTTF 464

>YGL062W (PYC1) [1917] chr7 (385197..388733) Pyruvate carboxylase 1,
            catalyzes conversion of pyruvate to oxaloacetate in the
            gluconeogenesis pathway [3537 bp, 1178 aa]
          Length = 1178

 Score =  303 bits (777), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 185/451 (41%), Positives = 268/451 (59%), Gaps = 11/451 (2%)

Query: 628  GHFKTVLVANRGEIAVRIIKTLKSMQIKSLAIYSATDKYSQHVLDVDMAQALD---GHTV 684
            G    +LVANRGEI +RI +T   + ++++AIYS  D+ S H    D A  +     +T 
Sbjct: 17   GEKNKILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLSTHKQKADEAYVIGEVGQYTP 76

Query: 685  EETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFADRCEQEGIQFIGPRGETIRKLGLK 744
               YL +++IISIA+K+ VD I PGYGFLSEN+ FAD+  + GI +IGP  E I  +G K
Sbjct: 77   VGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGITWIGPPAEVIDSVGDK 136

Query: 745  HSAREVAKSAGVPLVPGSP-LVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQD 803
             SAR +A  A VP VPG+P  ++  +EA       GYPV++K+  GGGG G++ V    D
Sbjct: 137  VSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAAFGGGGRGMRVVREGDD 196

Query: 804  MRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQIMGDGKGKTLALGERDCSLQRRNQ 863
            +  AF+    +  + FG+   F+E+F+D  +H+EVQ++ D  G  + L ERDCS+QRR+Q
Sbjct: 197  VADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQ 256

Query: 864  KVIEETPAPNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQV 923
            KV+E  PA  LPRE R  +LT A +L     YR AGT EF+ D Q ++ YF+E+N R+QV
Sbjct: 257  KVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQ-NRHYFIEINPRIQV 315

Query: 924  EHPITEMVTGLDLVEWMIKISAGV-MPSLDEFN--ISQNGASIEVRVYAENPLKDFRPSP 980
            EH ITE +TG+D+V   I+I+AG  +P L  F   I+  G +I+ R+  E+P K+F+P  
Sbjct: 316  EHTITEEITGIDIVAAQIQIAAGASLPQLGLFQDKITTRGFAIQCRITTEDPAKNFQPDT 375

Query: 981  G--ELVDVQFPNDCRVDTW-VKKGTKISPEFDPTLAKIIVHGKDRNEAILKMKKALNETK 1037
            G  E+      N  R+D      GT ISP +D  L K    G        KM +AL E +
Sbjct: 376  GRIEVYRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFR 435

Query: 1038 IYGCVTNVDYLKSLISSEMFRNAQLSTNYLN 1068
            I G  TN+ +L +L+++ +F      T +++
Sbjct: 436  IRGVKTNIPFLLTLLTNPVFIEGTYWTTFID 466

 Score = 35.4 bits (80), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 32/62 (51%)

Query: 1744 ADLKQTTTEVIEQNILEDDCEYIFSEYAGRFWKPIVEIGASIEKDQGVAVIEAMKTEMIV 1803
            AD  Q    V +      D  +I +  AG   +  V  G+ I+K Q VAV+ AMK EMI+
Sbjct: 1081 ADRSQKVETVTKSKADMHDPLHIGAPMAGVIVEVKVHKGSLIKKGQPVAVLSAMKMEMII 1140

Query: 1804 SS 1805
            SS
Sbjct: 1141 SS 1142

>CAGL0F06941g 679960..683502 highly similar to sp|P11154 Saccharomyces
            cerevisiae YGL062w PYC1 pyruvate carboxylase or sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2, hypothetical start
          Length = 1180

 Score =  303 bits (775), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 184/453 (40%), Positives = 269/453 (59%), Gaps = 15/453 (3%)

Query: 628  GHFKTVLVANRGEIAVRIIKTLKSMQIKSLAIYSATDKYSQHVLDVDMAQALD---GHTV 684
            G    +LVANRGEI +RI +T   + ++++AIYS  D+ S H L  D A  +     +T 
Sbjct: 21   GEKDKILVANRGEIPIRIFRTAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGEEGQYTP 80

Query: 685  EETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFADRCEQEGIQFIGPRGETIRKLGLK 744
               YL +++II IAKK+ VD I PGYGFLSEN+ FAD+ ++ GI +IGP  E I  +G K
Sbjct: 81   VGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKAGITWIGPPPEVIESVGDK 140

Query: 745  HSAREVAKSAGVPLVPGSP-LVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQD 803
             SAR +A  A VP VPG+P  +K  +EA       GYPV++K+  GGGG G++ V   +D
Sbjct: 141  VSARNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVIIKAAYGGGGRGMRVVREGED 200

Query: 804  MRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQIMGDGKGKTLALGERDCSLQRRNQ 863
            +  AF+    +  + FG+   F+E+F+D  +H+EVQ++ D  G  + L ERDCS+QRR+Q
Sbjct: 201  IGDAFQRATSEAKTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVIHLFERDCSVQRRHQ 260

Query: 864  KVIEETPAPNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQV 923
            KV+E  PA  LPR+ R  +LT A +L     YR AGT EF+ D Q ++ YF+E+N R+QV
Sbjct: 261  KVVEVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQ-NRHYFIEINPRIQV 319

Query: 924  EHPITEMVTGLDLVEWMIKISAGVMPSLDEFNISQN-----GASIEVRVYAENPLKDFRP 978
            EH ITE +TG+D+V   I+I+A    SL E  + Q+     G +I+ R+  E+P K+F+P
Sbjct: 320  EHTITEEITGIDIVAAQIQIAA--GASLTELGLLQDRITTRGFAIQCRITTEDPAKNFQP 377

Query: 979  SPG--ELVDVQFPNDCRVDTW-VKKGTKISPEFDPTLAKIIVHGKDRNEAILKMKKALNE 1035
              G  E+      N  R+D      G  ISP +D  L K    G        K+ +AL E
Sbjct: 378  DTGRIEVYGSTGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKIIRALIE 437

Query: 1036 TKIYGCVTNVDYLKSLISSEMFRNAQLSTNYLN 1068
             +I G  TN+ +L +L++  +F + Q  T +++
Sbjct: 438  FRIRGVKTNIPFLLTLLTHPVFISGQYWTTFID 470

>Kwal_14.1803
          Length = 1174

 Score =  301 bits (772), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 179/453 (39%), Positives = 274/453 (60%), Gaps = 15/453 (3%)

Query: 628  GHFKTVLVANRGEIAVRIIKTLKSMQIKSLAIYSATDKYSQHVLDVDMAQALDG---HTV 684
            G    +LVANRGEI +RI ++   + +K++AIYS  D+ S H L  D A  +     +T 
Sbjct: 15   GEKNKILVANRGEIPIRIFRSAHELSMKTVAIYSHEDRLSMHRLKADEAYMIGKQGKYTP 74

Query: 685  EETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFADRCEQEGIQFIGPRGETIRKLGLK 744
               YL +++I+ IAK+++VD I PGYGFLSEN+ FA + E+ GI +IGP  E I  +G K
Sbjct: 75   VGAYLAIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEAGITWIGPSAEVIDSVGDK 134

Query: 745  HSAREVAKSAGVPLVPGSP-LVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQD 803
             SAR +A  A VP+VPG+P  + + +EA       GYPV++K+  GGGG G++ V    D
Sbjct: 135  VSARNLAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVIIKAAFGGGGRGMRVVREGDD 194

Query: 804  MRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQIMGDGKGKTLALGERDCSLQRRNQ 863
            +  AF+    +  + FG+   F+E+F++  +H+EVQ++ DG G  + L ERDCS+QRR+Q
Sbjct: 195  IADAFQRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLADGYGNVVHLFERDCSVQRRHQ 254

Query: 864  KVIEETPAPNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQV 923
            KV+E  PA  LP++ R  +LT A +L +  NY+ AGT EF+ D+Q ++ YF+E+N R+QV
Sbjct: 255  KVVEVAPAKTLPKDVRDAILTDAVKLASVANYKNAGTAEFLVDDQ-NRHYFIEINPRIQV 313

Query: 924  EHPITEMVTGLDLVEWMIKISAGVMPSLDEFNISQN-----GASIEVRVYAENPLKDFRP 978
            EH ITE +TG+D+V   I+I+A    SL +  + Q+     G +I+ R+  E+P K+F+P
Sbjct: 314  EHTITEEITGIDIVAAQIQIAA--GASLQQLGLLQDRITTRGFAIQCRITTEDPAKNFQP 371

Query: 979  SPG--ELVDVQFPNDCRVDTW-VKKGTKISPEFDPTLAKIIVHGKDRNEAILKMKKALNE 1035
              G  E+      N  R+D      G+ ISP +D  L K    G        KM +AL E
Sbjct: 372  DTGRIEVYRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEIVRRKMLRALIE 431

Query: 1036 TKIYGCVTNVDYLKSLISSEMFRNAQLSTNYLN 1068
             +I G  TN+ +L +L+++ +F +    T +++
Sbjct: 432  FRIRGVKTNIPFLLTLLTNPVFIDGTYWTTFID 464

>KLLA0C05764g complement(512470..515991) highly similar to sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2 pyruvate
            carboxylase 2, start by similarity
          Length = 1173

 Score =  295 bits (756), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 179/459 (38%), Positives = 273/459 (59%), Gaps = 17/459 (3%)

Query: 623  NESKKGHFKTVLVANRGEIAVRIIKTLKSMQIKSLAIYSATDKYSQHVLDVDMAQALD-- 680
            N +  G    +LVANRGEI +RI +T   + +K++AIYS  D+ S H L  D A  +   
Sbjct: 11   NSNLMGEKNKLLVANRGEIPIRIFRTAHELSMKTVAIYSHEDRLSMHRLKADEAYVIGEQ 70

Query: 681  -GHTVEETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFADRCEQEGIQFIGPRGETIR 739
              +T    YL +++II+IAK + V+ I PGYGFLSEN+ FA++    GI ++GP    I 
Sbjct: 71   GKYTPVGAYLAIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAASGITWVGPPAAVID 130

Query: 740  KLGLKHSAREVAKSAGVPLVPGSP-LVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKV 798
             +G K SAR +A+ A VP+VPG+P  ++  +EA       G+PV++K+  GGGG G++ V
Sbjct: 131  SVGDKVSARNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVIIKAAFGGGGRGMRVV 190

Query: 799  DNEQDMRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQIMGDGKGKTLALGERDCSL 858
                D+  AF+  K +  + FG+   F+E+F+D  +H+EVQ++ D  G  + L ERDCS+
Sbjct: 191  REGDDISDAFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADNYGNVVHLFERDCSV 250

Query: 859  QRRNQKVIEETPAPNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVN 918
            QRR+QKV+E  PA  LP E R  +LT A +L     YR AGT EF+ D Q ++ YF+E+N
Sbjct: 251  QRRHQKVVEVAPAKTLPEEVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQ-NRHYFIEIN 309

Query: 919  TRLQVEHPITEMVTGLDLVEWMIKISAGVMPSLDEFNISQN-----GASIEVRVYAENPL 973
             R+QVEH ITE +TG+D+V   I+I+A    +L++  + Q+     G +I+ R+  E+P 
Sbjct: 310  PRIQVEHTITEEITGIDIVAAQIQIAA--GATLEQLGLMQDKITTRGFAIQCRITTEDPS 367

Query: 974  KDFRPSPGELVDVQFP---NDCRVDTW-VKKGTKISPEFDPTLAKIIVHGKDRNEAILKM 1029
            K+F+P  G  +DV      N  R+D      G+ ISP +D  L K    G        KM
Sbjct: 368  KNFQPDTGR-IDVYRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTYEIVRRKM 426

Query: 1030 KKALNETKIYGCVTNVDYLKSLISSEMFRNAQLSTNYLN 1068
             +AL E +I G  TN+ +L +L++  +F++ +  T +++
Sbjct: 427  LRALIEFRIRGVKTNIPFLLTLLTHPVFKSGEYWTTFID 465

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 30/62 (48%)

Query: 1744 ADLKQTTTEVIEQNILEDDCEYIFSEYAGRFWKPIVEIGASIEKDQGVAVIEAMKTEMIV 1803
            AD  Q    V +      D   I S  AG   +  V  G+ I K Q VAV+ AMK EM++
Sbjct: 1079 ADRSQKVESVSKPKADAHDPFQIGSPMAGVVVEVKVHKGSLIAKGQPVAVLSAMKMEMVI 1138

Query: 1804 SS 1805
            SS
Sbjct: 1139 SS 1140

>AAR162C [350] [Homologous to ScYGL062W (PYC1) - SH; ScYBR218C (PYC2)
            - SH] (634067..637582) [3516 bp, 1171 aa]
          Length = 1171

 Score =  290 bits (741), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 188/488 (38%), Positives = 279/488 (57%), Gaps = 30/488 (6%)

Query: 607  SHYGGFRAYIESIIPSNESKKGHFKTVLVANRGEIAVRIIKTLKSMQIKSLAIYSATDKY 666
            S   GFR +   +        G    VLVANRGEI +RI +T   + + ++A+YS  D+ 
Sbjct: 3    SQLAGFRRHSNLL--------GEKNKVLVANRGEIPIRIFRTAHELSMATVAVYSYEDRL 54

Query: 667  SQHVLDVDMAQALD---GHTVEETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFADRC 723
            S H    D A  +     +T    YL +++I+ IA+ +DVD I PGYGFLSENA FA + 
Sbjct: 55   SMHRQKADEAYMIGREGQYTPVGAYLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAKV 114

Query: 724  EQEGIQFIGPRGETIRKLGLKHSAREVAKSAGVPLVPGSP-LVKNADEAFTIAKNIGYPV 782
            E  GI +IGP    I  +G K SAR +A  A VP VPG+   + + +EA    +  GYPV
Sbjct: 115  EGAGITWIGPPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISSVEEAEEFVQKYGYPV 174

Query: 783  MVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQIMG 842
            ++K+  GGGG G++ V    D+R AF+  + +  + FG+   F+E+F+D  +H+EVQ++ 
Sbjct: 175  IIKAAFGGGGRGMRVVREGDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQLLA 234

Query: 843  DGKGKTLALGERDCSLQRRNQKVIEETPAPNLPRETRQKMLTAAERLGAYLNYRGAGTVE 902
            D  G  + L ERDCS+QRR+QKV+E  PA  L +E R  +LT A +L     YR AGT E
Sbjct: 235  DNYGNVVHLFERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKLAKASGYRNAGTAE 294

Query: 903  FIYDEQRDQFYFLEVNTRLQVEHPITEMVTGLDLVEWMIKISAGVMPSLDEFNISQN--- 959
            F+ D+Q ++ YF+E+N R+QVEH ITE +TG+D+V   I+I+A    SL++  + Q+   
Sbjct: 295  FLVDKQ-NRHYFIEINPRIQVEHTITEEITGVDIVAAQIQIAA--GASLEQLGLMQDRIT 351

Query: 960  --GASIEVRVYAENPLKDFRPSPGELVDVQFP---NDCRVDTW-VKKGTKISPEFDPTLA 1013
              G +I+ R+  E+P K+F+P  G L DV      N  R+D      G  ISP +D  L 
Sbjct: 352  TRGFAIQCRITTEDPSKNFQPDTGRL-DVYRSAGGNGVRLDGGNAFAGAVISPHYDSMLV 410

Query: 1014 KIIVHGKDRNEAILKMKKALNETKIYGCVTNVDYLKSLISSEMFRNAQLSTNYLNTY-EY 1072
            K    G        KM +AL E +I G  TN+ +L +L++  +F    +S +Y  T+ + 
Sbjct: 411  KCSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVF----ISGDYWTTFIDD 466

Query: 1073 SPSAVEII 1080
            +P   E++
Sbjct: 467  TPQLFEMV 474

 Score = 32.0 bits (71), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 23/35 (65%)

Query: 1771 AGRFWKPIVEIGASIEKDQGVAVIEAMKTEMIVSS 1805
            AG   +  V  G+++ K Q VAV+ AMK EM++SS
Sbjct: 1106 AGVIIEVKVHKGSAVTKGQPVAVLSAMKMEMVISS 1140

>Scas_563.12
          Length = 1216

 Score =  278 bits (711), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 169/434 (38%), Positives = 257/434 (59%), Gaps = 15/434 (3%)

Query: 647  KTLKSMQIKSLAIYSATDKYSQHVLDVDMAQAL-DGH--TVEETYLHVEKIISIAKKYDV 703
            ++   + ++++AIYS  D+ S H L  D +  + + H  T    YL +++II+IAK++ V
Sbjct: 77   RSAHELSMQTVAIYSHEDRLSTHRLKADESYVIGEPHQFTPVGAYLAIDEIINIAKRHGV 136

Query: 704  DAIIPGYGFLSENASFADRCEQEGIQFIGPRGETIRKLGLKHSAREVAKSAGVPLVPGSP 763
            D I PGYGFLSEN+ FAD+  + GI +IGP    I  +G K SAR +A  A VP VPG+P
Sbjct: 137  DYIHPGYGFLSENSEFADKVAKAGITWIGPPASVIDSVGDKVSARNLATKANVPTVPGTP 196

Query: 764  -LVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGDS 822
              ++   +A       GYPV++K+  GGGG G++ V+   D+  AF+    +  + FGD 
Sbjct: 197  GPIRTVQDAQDFVNEYGYPVIIKAAFGGGGRGMRVVNEGDDLADAFQRASSEALTAFGDG 256

Query: 823  GVFMEKFIDNARHVEVQIMGDGKGKTLALGERDCSLQRRNQKVIEETPAPNLPRETRQKM 882
              F+E+F++  +H+EVQ++ D  G  + L ERDCS+QRR+QKV+E  PA  LPRE R  +
Sbjct: 257  TCFVERFLNKPKHIEVQLLADTHGNVIHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAI 316

Query: 883  LTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEHPITEMVTGLDLVEWMIK 942
            LT A +L     Y+ AGT EF+ D+Q ++ YF+E+N R+QVEH ITE +TG+D+V   I+
Sbjct: 317  LTDAVKLAKECGYQNAGTAEFLVDDQ-NRHYFIEINPRIQVEHTITEEITGIDIVAAQIQ 375

Query: 943  ISAGVMPSLDEFNISQN-----GASIEVRVYAENPLKDFRPSPG--ELVDVQFPNDCRVD 995
            I+AG   SL++  + Q+     G +I+ R+  E+P K+F+P  G  E+ D    N  R+D
Sbjct: 376  IAAGA--SLEQLGLLQDKITTRGFAIQCRITTEDPAKNFQPDTGRLEVYDSAGGNGVRLD 433

Query: 996  TW-VKKGTKISPEFDPTLAKIIVHGKDRNEAILKMKKALNETKIYGCVTNVDYLKSLISS 1054
                  G  ISP +D  L K    G        KM +AL E +I G  TN+ +L +L++ 
Sbjct: 434  GGNAYAGAIISPHYDSMLVKCSCSGSTYEVVRRKMIRALIEFRIRGVKTNIPFLLTLLTH 493

Query: 1055 EMFRNAQLSTNYLN 1068
             +F      T +++
Sbjct: 494  PVFIAGDYWTTFID 507

>Sklu_1458.1 YGL062W, Contig c1458 155-3553 reverse complement
          Length = 1132

 Score =  273 bits (698), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 170/427 (39%), Positives = 252/427 (59%), Gaps = 15/427 (3%)

Query: 654  IKSLAIYSATDKYSQHVLDVDMAQALD---GHTVEETYLHVEKIISIAKKYDVDAIIPGY 710
            +K++AIYS  D+ S H L  D A  +     +T    YL +++IISIAK++ V  I PGY
Sbjct: 1    MKTVAIYSNEDRLSMHRLKADEAYMIGEGGKYTPVGAYLAIDEIISIAKEHGVSFIHPGY 60

Query: 711  GFLSENASFADRCEQEGIQFIGPRGETIRKLGLKHSAREVAKSAGVPLVPGSP-LVKNAD 769
            GFLSENA FA +    GI +IGP  E I  +G K SAR++A  A VP VPG+P  +++ +
Sbjct: 61   GFLSENAEFAAKVIDAGITWIGPPPEVINSVGDKVSARDLAAKANVPTVPGTPGPIESVE 120

Query: 770  EAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGDSGVFMEKF 829
            EA       GYPV++K+  GGGG G++ V    D+  AF+    +  + FG+   F+E+F
Sbjct: 121  EAEAFVAEYGYPVIIKAAFGGGGRGMRVVREGDDIGDAFQRATSEAKTAFGNGTCFVERF 180

Query: 830  IDNARHVEVQIMGDGKGKTLALGERDCSLQRRNQKVIEETPAPNLPRETRQKMLTAAERL 889
            +D  +H+EVQ++ D  G  + L ERDCS+QRR+QKV+E  PA  LP+E R  +LT A +L
Sbjct: 181  LDKPKHIEVQLLADNYGNVIHLFERDCSVQRRHQKVVEVAPAKTLPKEVRDSILTDAVKL 240

Query: 890  GAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEHPITEMVTGLDLVEWMIKISAGVMP 949
                 YR AGT EF+ D Q ++ YF+E+N R+QVEH ITE +TG+D+V   I+I+A    
Sbjct: 241  AKEAKYRNAGTAEFLVDAQ-NRHYFIEINPRIQVEHTITEEITGVDVVAAQIQIAA--GA 297

Query: 950  SLDEFNISQN-----GASIEVRVYAENPLKDFRPSPG--ELVDVQFPNDCRVDTW-VKKG 1001
            SL +  + Q+     G +I+ R+  E+P K+F+P  G  E+      N  R+D      G
Sbjct: 298  SLQQLGLLQDKITTRGFAIQCRITTEDPSKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAG 357

Query: 1002 TKISPEFDPTLAKIIVHGKDRNEAILKMKKALNETKIYGCVTNVDYLKSLISSEMFRNAQ 1061
              ISP +D  L K    G        KM +AL E +I G  TN+ +L +L++  +F++ +
Sbjct: 358  AVISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHSVFKSGE 417

Query: 1062 LSTNYLN 1068
              T +++
Sbjct: 418  YWTTFID 424

>Scas_720.74
          Length = 2231

 Score =  241 bits (615), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 167/516 (32%), Positives = 258/516 (50%), Gaps = 76/516 (14%)

Query: 625  SKKGH--FKTVLVANRGEIAVRIIKTLK-----------SMQIKSLAIYSATDKYSQHVL 671
            S  GH     +L+AN G  AV+ I++++           ++Q  ++A     +  ++++ 
Sbjct: 52   SHGGHTVISKILIANNGIAAVKEIRSVRKWAYETFGNERTIQFVAMATPEDLEANAEYIR 111

Query: 672  DVDMAQALDGHTVEETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFADRC--EQEGIQ 729
              D    + G T  + Y +V+ I+ IA++ DVDA+  G+G  SEN    ++    +  + 
Sbjct: 112  MADQYVEVPGGTNNKNYANVDLIVDIAERADVDAVWAGWGHASENPHLPEKLAMSKRKVV 171

Query: 730  FIGPRGETIRKLGLKHSAREVAKSAGVPLVPGSP-------------LVKNADEAFT--- 773
            FIGP G  +R LG K S+  VA+SA VP +P S              LV  ADE +    
Sbjct: 172  FIGPPGSAMRSLGDKISSTIVAQSAHVPCIPWSGTGIDKVQVDKDTGLVSVADEVYAQGC 231

Query: 774  ---------IAKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGDSGV 824
                      AK IG+PVM+K++ GGGG G+++V+ E+D    F  + HQ ++    S +
Sbjct: 232  CSSPEDGLEKAKKIGFPVMIKASEGGGGKGIRQVEREED----FIALYHQAANEIPGSPI 287

Query: 825  FMEKFIDNARHVEVQIMGDGKGKTLALGERDCSLQRRNQKVIEETPAPNLPRETRQKMLT 884
            F+ K    ARH+EVQ++ D  G  ++L  RDCS+QRR+QK+IEE P      ET   M  
Sbjct: 288  FIMKLAGKARHLEVQLLADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAAPETFAMMEK 347

Query: 885  AAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEHPITEMVTGLDLVEWMIKIS 944
            +A RLG  + Y  AGTVE++Y  +  +FYFLE+N RLQVEHP TEMVTG++L    ++I+
Sbjct: 348  SAVRLGKLVGYVSAGTVEYLYSHEDKKFYFLELNPRLQVEHPTTEMVTGVNLPATQLQIA 407

Query: 945  AGV-----------------MPSLDEFNISQ------------NGASIEVRVYAENPLKD 975
             G+                   S  +F+ S              G     R+ +E+P + 
Sbjct: 408  MGIPMHRISDIRVFYGMNPHTASEIDFDFSTEESLKTQRKPVPKGHCTACRITSEDPDEG 467

Query: 976  FRPSPGELVDVQFPNDCRVDTWVKKGTK--ISPEFDPTLAKIIVHGKDRNEAILKMKKAL 1033
            F+PS G L ++ F +   V  +   G    I    D     I   G++R  +   M  AL
Sbjct: 468  FKPSGGSLHELNFRSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVAL 527

Query: 1034 NETKIYGCV-TNVDYLKSLISSEMFRNAQLSTNYLN 1068
             E  I G   T V+YL  L+ +E F +  ++T +L+
Sbjct: 528  KELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLD 563

>KLLA0F06072g 583276..589971 highly similar to sp|Q00955 Saccharomyces
            cerevisiae YNR016c ACC1 acetyl-CoA carboxylase, start by
            similarity
          Length = 2231

 Score =  239 bits (609), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 168/517 (32%), Positives = 256/517 (49%), Gaps = 76/517 (14%)

Query: 624  ESKKGH--FKTVLVANRGEIAVRIIKTLK-----------SMQIKSLAIYSATDKYSQHV 670
            +S  GH     VL+AN G  AV+ I++++           ++Q  ++A     +  ++++
Sbjct: 52   KSHGGHTVISKVLIANNGIAAVKEIRSVRKWAYETFGDERTVQFVAMATPEDLEANAEYI 111

Query: 671  LDVDMAQALDGHTVEETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFADR--CEQEGI 728
               D    + G T    Y +V+ I+ +A++ DVDA+  G+G  SEN    +R       I
Sbjct: 112  RMADQYIEVPGGTNNNNYANVDLIVEVAERADVDAVWAGWGHASENPLLPERLAASHRKI 171

Query: 729  QFIGPRGETIRKLGLKHSAREVAKSAGVPLVPGS-------------PLVKNADEAFT-- 773
             FIGP G  +R LG K S+  VA+ A VP +P S              LV   D+ +   
Sbjct: 172  IFIGPPGNAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDEVHVDKETNLVSVEDKVYQEG 231

Query: 774  ----------IAKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGDSG 823
                       AK IG+P+MVK++ GGGG G++KV+NE +    F ++  Q ++    S 
Sbjct: 232  CCSSPEDGLKKAKEIGFPIMVKASEGGGGKGIRKVENEDE----FLSLYQQAANEIPGSP 287

Query: 824  VFMEKFIDNARHVEVQIMGDGKGKTLALGERDCSLQRRNQKVIEETPAPNLPRETRQKML 883
            +F+ K    ARH+EVQ++ D  G  ++L  RDCS+QRR+QK+IEE P      +T  +M 
Sbjct: 288  IFIMKLAGKARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFTEME 347

Query: 884  TAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEHPITEMVTGLDLVEWMIKI 943
             AA RLG  + Y  AGTVE++Y    D+FYFLE+N RLQVEHP TEMVTG++L    ++I
Sbjct: 348  KAAVRLGQLVGYVSAGTVEYLYSHDEDKFYFLELNPRLQVEHPTTEMVTGVNLPSAQLQI 407

Query: 944  SAGV-----------------MPSLDEFNISQ------------NGASIEVRVYAENPLK 974
            + G+                   S  +FN S              G     R+ +E+P +
Sbjct: 408  AMGIPMHRIRDIRLLYGVDPKSASEIDFNFSTPESAKTQRKPTPKGHCTACRITSEDPNE 467

Query: 975  DFRPSPGELVDVQFPNDCRVDTWVKKGTK--ISPEFDPTLAKIIVHGKDRNEAILKMKKA 1032
             F+PS G L ++ F +   V  +   G    I    D     I   G++R  +   M  A
Sbjct: 468  GFKPSGGALHELNFRSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVA 527

Query: 1033 LNETKIYGCV-TNVDYLKSLISSEMFRNAQLSTNYLN 1068
            L E  I G   T V+YL  L+ +E F +  ++T +L+
Sbjct: 528  LKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLD 564

>Kwal_23.6157
          Length = 2230

 Score =  234 bits (598), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 169/519 (32%), Positives = 257/519 (49%), Gaps = 80/519 (15%)

Query: 624  ESKKGH--FKTVLVANRGEIAVRIIKTLK-----------SMQIKSLAIYSATDKYSQHV 670
            +S  GH     VL+AN G  AV+ I++++           ++Q  ++A     +  ++++
Sbjct: 52   KSHGGHTVISKVLIANNGIAAVKEIRSVRKWAYETFGNERAVQFVAMATPEDLEANAEYL 111

Query: 671  LDVDMAQALDGHTVEETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFADR--CEQEGI 728
               D    + G T    Y +V+ I+ +A++ DVDA+  G+G  SEN    +R       +
Sbjct: 112  RMADQYVEVPGGTNNNNYANVDLIVELAERADVDAVWAGWGHASENPLLPERLAASPRKV 171

Query: 729  QFIGPRGETIRKLGLKHSAREVAKSAGVPLVPGSP-------------LVKNADEAF--- 772
             FIGP G  +R LG K S+  VA+ A VP +P S              LV   D+ +   
Sbjct: 172  IFIGPPGNAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDQVHLDEENGLVSVTDDIYQKG 231

Query: 773  ---------TIAKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGDSG 823
                       AK IG+PVMVK++ GGGG G++KV+ EQD    F  +  Q ++    S 
Sbjct: 232  CCDSPEDGLAKAKKIGFPVMVKASEGGGGKGIRKVEREQD----FIPLYKQAANEIPGSP 287

Query: 824  VFMEKFIDNARHVEVQIMGDGKGKTLALGERDCSLQRRNQKVIEETPAPNLPRETRQKML 883
            +F+ K   NARH+EVQ++ D  G  ++L  RDCS+QRR+QK+IEE P      +T  +M 
Sbjct: 288  IFIMKLAGNARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFTEME 347

Query: 884  TAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEHPITEMVTGLDLVEWMIKI 943
             +A RLG  + Y  AGTVE++Y    D+FYFLE+N RLQVEHP TEMV+G++L    ++I
Sbjct: 348  RSAVRLGKLVGYVSAGTVEYLYSHDDDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQI 407

Query: 944  SAGV----------MPSLD-------EFNISQN------------GASIEVRVYAENPLK 974
            + G+          M  +D       +F+ S              G     R+ +E+P +
Sbjct: 408  AMGIPMHRIKDIRLMYGVDPHTATEIDFDFSSKDSTKIQRRPTPKGHCTACRITSEDPNE 467

Query: 975  DFRPSPGELVDVQFPNDCRVDTW----VKKGTKISPEFDPTLAKIIVHGKDRNEAILKMK 1030
             F+PS G L ++ F +   V  W    V     I    D     I   G++R  +   M 
Sbjct: 468  GFKPSGGSLHELNFRSSSNV--WGYFSVSSSGGIHSFSDSQFGHIFAFGENRQASRKHMV 525

Query: 1031 KALNETKIYGCV-TNVDYLKSLISSEMFRNAQLSTNYLN 1068
             AL E  I G   T V+YL  L+ +E F    ++T +L+
Sbjct: 526  VALKELSIRGDFRTTVEYLIKLLETEDFEGNSITTGWLD 564

>AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C (HFA1)
            - SH] complement(466791..473486) [6696 bp, 2231 aa]
          Length = 2231

 Score =  234 bits (597), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 165/513 (32%), Positives = 252/513 (49%), Gaps = 76/513 (14%)

Query: 628  GH--FKTVLVANRGEIAVRIIKTL-----------KSMQIKSLAIYSATDKYSQHVLDVD 674
            GH     +L+AN G  AV+ I+++           K +Q   +A     +  ++++   D
Sbjct: 55   GHTVISKILIANNGIAAVKEIRSVRKWAYETFGDGKVVQFVVMATPEDLEANTEYIRMAD 114

Query: 675  MAQALDGHTVEETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFADRC--EQEGIQFIG 732
                + G T    Y +V+ I+ +A++ DVDA+  G+G  SEN    ++    +  + FIG
Sbjct: 115  QYVEVPGGTNNNNYANVDLIVDVAERADVDAVWAGWGHASENPLLPEKLARSKRKVVFIG 174

Query: 733  PRGETIRKLGLKHSAREVAKSAGVPLVPGS-------------PLVKNADEAF------- 772
            P G  +R LG K S+  VA+ A VP +P S              LV  AD+ +       
Sbjct: 175  PPGSAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDQVEIDPHTKLVSVADDIYQKGCCLS 234

Query: 773  -----TIAKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGDSGVFME 827
                   AK IG+PVMVK++ GGGG G++KV  E+D    F ++  Q ++    S +F+ 
Sbjct: 235  PEDGLNKAKQIGFPVMVKASEGGGGKGIRKVVREED----FISLYQQAANEIPGSPIFIM 290

Query: 828  KFIDNARHVEVQIMGDGKGKTLALGERDCSLQRRNQKVIEETPAPNLPRETRQKMLTAAE 887
            K    ARH+EVQ++ D  G  ++L  RDCS+QRR+QK+IEE P      +T  +M  AA 
Sbjct: 291  KLAGKARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFAEMERAAV 350

Query: 888  RLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEHPITEMVTGLDLVEWMIKISAGV 947
            RLG  + Y  AGTVE++Y  + D+FYFLE+N RLQVEHP TEMVTG++L    ++I+ G+
Sbjct: 351  RLGKLVGYVSAGTVEYLYSHEEDKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGI 410

Query: 948  -------------------------MPSLDEFNISQ----NGASIEVRVYAENPLKDFRP 978
                                       S D     +     G     R+ +E+P + F+P
Sbjct: 411  PLHRIRDIRLFYGLDPHTATEIDFEFSSADALQTQRRPIPKGHCTACRITSEDPNEGFKP 470

Query: 979  SPGELVDVQFPNDCRVDTWVKKGTK--ISPEFDPTLAKIIVHGKDRNEAILKMKKALNET 1036
            S G L ++ F +   V  +   G    I    D     I   G++R  +   M  AL E 
Sbjct: 471  SGGSLHELNFRSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKEL 530

Query: 1037 KIYGCV-TNVDYLKSLISSEMFRNAQLSTNYLN 1068
             I G   T V+YL  L+ +E F +  ++T +L+
Sbjct: 531  SIRGDFRTTVEYLIKLLETEDFEDNTITTGWLD 563

>YNR016C (ACC1) [4599] chr14 complement(654672..661373) Acetyl-CoA
            carboxylase, first and rate-limiting step in fatty acid
            biosynthesis pathway [6702 bp, 2233 aa]
          Length = 2233

 Score =  234 bits (597), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 164/517 (31%), Positives = 257/517 (49%), Gaps = 76/517 (14%)

Query: 624  ESKKGH--FKTVLVANRGEIAVRIIKTLK-----------SMQIKSLAIYSATDKYSQHV 670
            +S  GH     +L+AN G  AV+ I++++           ++Q  ++A     +  ++++
Sbjct: 51   KSHGGHTVISKILIANNGIAAVKEIRSVRKWAYETFGDDRTVQFVAMATPEDLEANAEYI 110

Query: 671  LDVDMAQALDGHTVEETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFADRCEQ--EGI 728
               D    + G T    Y +V+ I+ IA++ DVDA+  G+G  SEN    ++  Q    +
Sbjct: 111  RMADQYIEVPGGTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLSQSKRKV 170

Query: 729  QFIGPRGETIRKLGLKHSAREVAKSAGVPLVPGSP-------------LVKNADEAFTI- 774
             FIGP G  +R LG K S+  VA+SA VP +P S              LV   D+ +   
Sbjct: 171  IFIGPPGNAMRSLGDKISSTIVAQSAKVPCIPWSGTGVDTVHVDEKTGLVSVDDDIYQKG 230

Query: 775  -----------AKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGDSG 823
                       AK IG+PVM+K++ GGGG G+++V+ E+D    F  + HQ ++    S 
Sbjct: 231  CCTSPEDGLQKAKRIGFPVMIKASEGGGGKGIRQVEREED----FIALYHQAANEIPGSP 286

Query: 824  VFMEKFIDNARHVEVQIMGDGKGKTLALGERDCSLQRRNQKVIEETPAPNLPRETRQKML 883
            +F+ K    ARH+EVQ++ D  G  ++L  RDCS+QRR+QK+IEE P      ET  +M 
Sbjct: 287  IFIMKLAGRARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKAETFHEME 346

Query: 884  TAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEHPITEMVTGLDLVEWMIKI 943
             AA RLG  + Y  AGTVE++Y     +FYFLE+N RLQVEHP TEMV+G++L    ++I
Sbjct: 347  KAAVRLGKLVGYVSAGTVEYLYSHDDGKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQI 406

Query: 944  SAGV----------MPSLDEFNISQ-------------------NGASIEVRVYAENPLK 974
            + G+          +  ++  + S+                    G     R+ +E+P  
Sbjct: 407  AMGIPMHRISDIRTLYGMNPHSASEIDFEFKTQDATKKQRRPIPKGHCTACRITSEDPND 466

Query: 975  DFRPSPGELVDVQFPNDCRVDTWVKKGT--KISPEFDPTLAKIIVHGKDRNEAILKMKKA 1032
             F+PS G L ++ F +   V  +   G    I    D     I   G++R  +   M  A
Sbjct: 467  GFKPSGGTLHELNFRSSSNVWGYFSVGNNGNIHSFSDSQFGHIFAFGENRQASRKHMVVA 526

Query: 1033 LNETKIYGCV-TNVDYLKSLISSEMFRNAQLSTNYLN 1068
            L E  I G   T V+YL  L+ +E F +  ++T +L+
Sbjct: 527  LKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLD 563

>YMR207C (HFA1) [4163] chr13 complement(677192..683563) Protein with
            similarity to acetyl-CoA carboxylase [6372 bp, 2123 aa]
          Length = 2123

 Score =  234 bits (597), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 154/453 (33%), Positives = 235/453 (51%), Gaps = 55/453 (12%)

Query: 667  SQHVLDVDMAQALDGHTVEETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFAD--RCE 724
            S+++   D    + G T    Y +++ I+ +A++ DVDA+  G+G  SEN    +     
Sbjct: 33   SEYIRMADQYVQVPGGTNNNNYANIDLILDVAEQTDVDAVWAGWGHASENPCLPELLASS 92

Query: 725  QEGIQFIGPRGETIRKLGLKHSAREVAKSAGVPLVP--GSPL------------------ 764
            Q  I FIGP G  +R LG K S+  VA+SA +P +P  GS +                  
Sbjct: 93   QRKILFIGPPGRAMRSLGDKISSTIVAQSAKIPCIPWSGSHIDTIHIDNKTNFVSVPDDV 152

Query: 765  -----VKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSSYF 819
                   + ++A   AK IG+PVM+K++ GGGG G+++VDNE D    F  +  Q  +  
Sbjct: 153  YVRGCCSSPEDALEKAKLIGFPVMIKASEGGGGKGIRRVDNEDD----FIALYRQAVNET 208

Query: 820  GDSGVFMEKFIDNARHVEVQIMGDGKGKTLALGERDCSLQRRNQKVIEETPAPNLPRETR 879
              S +F+ K + +ARH+EVQ++ D  G  + L  RDCS+QRR+QK+IEE P      ET 
Sbjct: 209  PGSPMFVMKVVTDARHLEVQLLADQYGTNITLFGRDCSIQRRHQKIIEEAPVTITKPETF 268

Query: 880  QKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEHPITEMVTGLDLVEW 939
            Q+M  AA RLG  + Y  AGTVE++Y  + D+FYFLE+N RLQVEHP TEM++G++L   
Sbjct: 269  QRMERAAIRLGELVGYVSAGTVEYLYSPKDDKFYFLELNPRLQVEHPTTEMISGVNLPAT 328

Query: 940  MIKISAGV------------------MPSLDEFNI---SQNGASIEVRVYAENPLKDFRP 978
             ++I+ G+                     +D  N+   S  G  I  R+ +E+P + F+P
Sbjct: 329  QLQIAMGIPMHMISDIRKLYGLDPTGTSYIDFKNLKRPSPKGHCISCRITSEDPNEGFKP 388

Query: 979  SPGELVDVQFPNDCRVDTWVKKGTK--ISPEFDPTLAKIIVHGKDRNEAILKMKKALNET 1036
            S G++ ++ F +   V  +   G    I    D     I   G DR +A   M  AL + 
Sbjct: 389  STGKIHELNFRSSSNVWGYFSVGNNGAIHSFSDSQFGHIFAVGNDRQDAKQNMVLALKDF 448

Query: 1037 KIYGCV-TNVDYLKSLISSEMFRNAQLSTNYLN 1068
             I G   T ++YL  L+ +  F +  +ST +L+
Sbjct: 449  SIRGEFKTPIEYLIELLETRDFESNNISTGWLD 481

>CAGL0L10780g complement(1149588..1156289) highly similar to sp|Q00955
            Saccharomyces cerevisiae YNR016c ACC1 or sp|P32874
            Saccharomyces cerevisiae YMR207c HFA1, start by
            similarity
          Length = 2233

 Score =  233 bits (594), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 176/552 (31%), Positives = 268/552 (48%), Gaps = 82/552 (14%)

Query: 594  EESGYNSTGSIDISHYGGFRAYIESI--IPSNESKKGH-----FKTVLVANRGEIAVRII 646
            E + Y+S   +  SH+ G    +E +   P  E  K H        VL+AN G  AV+ I
Sbjct: 17   EVTDYSSRHQVLPSHFVGLNT-VEKVEDSPLKEFVKAHGGHTVISKVLIANNGIAAVKEI 75

Query: 647  KTL-----------KSMQIKSLAIYSATDKYSQHVLDVDMAQALDGHTVEETYLHVEKII 695
            +++           K +Q  ++A     +  ++++   D    + G T    Y +V+ I+
Sbjct: 76   RSVRKWAYETFGDEKIVQFVAMATPEDLEANAEYIRMADQYVEVPGGTNNNNYANVDLIV 135

Query: 696  SIAKKYDVDAIIPGYGFLSENASFADRC--EQEGIQFIGPRGETIRKLGLKHSAREVAKS 753
             IA++ DVDA+  G+G  SEN    ++    +  I FIGP G  +R LG K S+  VA+ 
Sbjct: 136  DIAERADVDAVWAGWGHASENPLLPEKLARSKRKILFIGPPGNAMRSLGDKISSTIVAQH 195

Query: 754  AGVPLVPGSP-------------LVKNADEAFTI------------AKNIGYPVMVKSTA 788
            A VP +P S              LV   D+ +              AK IG+PVM+K++ 
Sbjct: 196  AKVPCIPWSGTGVDTVHIDEKNGLVSVDDDIYQKGCCSSPEDGLEKAKKIGFPVMIKASE 255

Query: 789  GGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQIMGDGKGKT 848
            GGGG G+++V  E+D    F  + HQ ++    S +F+ K    ARH+EVQ++ D  G  
Sbjct: 256  GGGGKGIRQVTREED----FINLYHQAANEIPGSPIFIMKLAGKARHLEVQLLADQYGTN 311

Query: 849  LALGERDCSLQRRNQKVIEETPAPNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQ 908
            ++L  RDCS+QRR+QK+IEE P      ET  +M  AA RLG  + Y  AGTVE++Y   
Sbjct: 312  ISLFGRDCSVQRRHQKIIEEAPVTIAGPETFGEMEKAAVRLGKLVGYVSAGTVEYLYSHD 371

Query: 909  RDQFYFLEVNTRLQVEHPITEMVTGLDLVEWMIKISAGV-MPSLDEFNI----------- 956
             ++FYFLE+N RLQVEHP TEMVTG++L    ++I+ G+ M  + +  I           
Sbjct: 372  DNKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGIPMHRISDIRIFYGLNPRGSSE 431

Query: 957  ------SQN-----------GASIEVRVYAENPLKDFRPSPGELVDVQFPNDCRVDTWVK 999
                  S++           G     R+ +E+P   F+PS G L ++ F +   V  +  
Sbjct: 432  IDFEFKSEDSLKTQRKPIPKGHCTACRITSEDPNDGFKPSGGTLNELNFRSSSNVWGYFS 491

Query: 1000 KGTK--ISPEFDPTLAKIIVHGKDRNEAILKMKKALNETKIYGCV-TNVDYLKSLISSEM 1056
             G    I    D     I   G++R  +   M  AL E  I G   T V+YL  L+ +E 
Sbjct: 492  VGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFRTTVEYLIKLLETED 551

Query: 1057 FRNAQLSTNYLN 1068
            F    ++T +L+
Sbjct: 552  FEENTITTGWLD 563

>CAGL0M13585g complement(1335488..1336891) similar to sp|Q03557
           Saccharomyces cerevisiae YMR293c, hypothetical start
          Length = 467

 Score =  100 bits (248), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 64/169 (37%), Positives = 85/169 (50%), Gaps = 8/169 (4%)

Query: 76  LYGVPIAVKDNIDAKGFPTTAACPSF-SYMPTRDSTVVELLKQAGAIIIGKTNLDQFATG 134
           L G+   +KDNI  K  PTT        Y    D+TVV+LLKQ G+I++GKTNLD+F  G
Sbjct: 39  LSGLLCGIKDNIVTKDMPTTCGSEILRGYQSPYDATVVKLLKQEGSIVLGKTNLDEFGMG 98

Query: 135 LVGTRSPYGRT-----PCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAAL 189
             G  S +G T     P   +DK                  V  +LGTDT GS R+PA  
Sbjct: 99  SRGIHSCFGPTFNPLYPA--ADKVIMGGSSSGSAAAVVSEAVDFSLGTDTGGSVRLPATY 156

Query: 190 NNIIGLKPTRGIFSCSGVVPACKSLDCVSVFSMNLSDAEKCLKIMTKLD 238
            +I G KP+ G  S  GV+   +SLD V + + N+S   K   ++ K D
Sbjct: 157 GSIYGFKPSYGRISRYGVIAYAQSLDTVGILTKNISTLRKVYHVLDKYD 205

>Kwal_23.4249
          Length = 465

 Score = 99.8 bits (247), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 68/202 (33%), Positives = 101/202 (50%), Gaps = 8/202 (3%)

Query: 75  PLYGVPIAVKDNIDAKGFPTTAACPSFS-YMPTRDSTVVELLKQAGAIIIGKTNLDQFAT 133
           PL  +   +KDNI  K  PT+        +    ++TVV+LL+ AGA+ +GKTN+D+F  
Sbjct: 45  PLKNILCGIKDNIATKELPTSCGSKILKDFQSPFNATVVDLLEGAGAVTVGKTNMDEFGM 104

Query: 134 GLVGTRSPYG--RTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAALNN 191
           G  GT S +G  R P   SD                  +V  A+GTDT GS R+PAA  +
Sbjct: 105 GSGGTHSHFGPTRNPQFPSDNVIAGGSSSGSAAAVAADVVDFAIGTDTGGSVRLPAAYTS 164

Query: 192 IIGLKPTRGIFSCSGVVPACKSLDCVSVFSMNLSDAEKCLKIMTKLDIEN----DEYSRS 247
           ++G KP+ G  S  GVV   +SLD V + + ++   ++  K++ K D ++    DE SR 
Sbjct: 165 VMGFKPSYGRISRHGVVAYAQSLDTVGILAKDIDIVQQVFKVLDKYDWKDPTSLDETSRE 224

Query: 248 FPANPLQSFNKNLTVAIPKNVM 269
             A         L V IP+  +
Sbjct: 225 KLAK-FHCSKTKLKVGIPQEFL 245

>YMR293C (YMR293C) [4247] chr13 complement(855398..856792) Protein
           with similarity to amidases, may be involved in
           mitochondrial function [1395 bp, 464 aa]
          Length = 464

 Score = 99.0 bits (245), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 117/427 (27%), Positives = 174/427 (40%), Gaps = 61/427 (14%)

Query: 76  LYGVPIAVKDNIDAKGFPTTAACPSF-SYMPTRDSTVVELLKQAGAIIIGKTNLDQFATG 134
           L G   ++KDNI  K FPTT A     ++    D+TVV+LLKQAG  I+GKTNLD+F  G
Sbjct: 44  LTGCVASIKDNIVTKDFPTTCASHILENFKSPFDATVVKLLKQAGVHILGKTNLDEFGMG 103

Query: 135 LVGTRSPYGRTPCV-----FSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAAL 189
             G  S   R P +       DK                 +V  ALGTDT GS R+PA  
Sbjct: 104 SGGVHSI--RGPVINPLYPHEDKKIMGGSSSGAAASVACDLVDFALGTDTGGSVRLPACY 161

Query: 190 NNIIGLKPTRGIFSCSGVVPACKSLDCVSVFSMNLSDAEKCLKIMTKLDIENDEYSRSFP 249
            +++G KP+ G  S  GV+   +SLD V + S  ++   K    + K D++ D  S S  
Sbjct: 162 GSVLGFKPSYGRLSRFGVIAYSQSLDTVGILSKKINVLRKVFHTLDKYDMK-DPTSLSVE 220

Query: 250 ANPLQSFNKN----LTVAIPKNVMWYGEKENPL----LYDRAIDNFKQLGAQIKIIDFEP 301
              L   NK     L V I   V  +  +  P+    LY   ++    LG +I  +    
Sbjct: 221 LRELIEGNKKVRRPLKVGI---VKEFSHESMPIGFHRLYLSLLEKLINLGLEIYPVSIPS 277

Query: 302 LLELARCLY-----EGTWVAERYAATRKFLETS-----------PQQSTLDPVVYGIIKS 345
           +       Y     E      RY   R     S           P +S     V   I  
Sbjct: 278 VKNCLPIYYTLSPAEAASNLSRYDGIRYGYRDSELDIKDGILFAPTRSKFGTEVKNRIIL 337

Query: 346 ATKFDAADAFEYEYKR------------QGILRKVEVLLQD------IDVLCVPTCPLNP 387
                 +DAF+  + +             GI R   VL         +D+L VPT    P
Sbjct: 338 GNYNLCSDAFKNNFIKAEKLRVNLIDEFDGIFRFPNVLTNSKGNPDGLDLLIVPTSSKLP 397

Query: 388 S----FEEVDKEPILVNSRQGTWTNFVNLADLSALAIPVGFRSDGLPNGVTLIAKKFEDY 443
                FEE + +    +     +T  ++LA L +L++P+  ++   P G+ ++ +  +D 
Sbjct: 398 GSIRDFEEEEAKSPANSYINDVFTVPMSLAGLPSLSMPLKEKT---PIGLQVVGQYGDDS 454

Query: 444 ALLQLAK 450
            +L   +
Sbjct: 455 TVLDFVE 461

>KLLA0A09845g complement(862467..863876) similar to sp|Q03557
           Saccharomyces cerevisiae YMR293c, start by similarity
          Length = 469

 Score = 98.2 bits (243), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 71/201 (35%), Positives = 100/201 (49%), Gaps = 11/201 (5%)

Query: 75  PLYGVPIAVKDNIDAKGFPTTAACPSFS-YMPTRDSTVVELLKQAGAIIIGKTNLDQFAT 133
           PL     A+KDNI  K  P+T A      YM   D+TVV LL +AG +I GK N+D+F  
Sbjct: 46  PLNYTLAAIKDNIATKNMPSTCASKILDGYMSPFDATVVSLLLEAGTVIAGKANMDEFGM 105

Query: 134 GLVGTRSPYGRT--PCV-FSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAALN 190
           G  G  S +G T  P     D+                G+V  ALGTDT GS R+PA+  
Sbjct: 106 GSAGIHSHFGPTFNPLFDHKDRVIAGGSSSGSAAAVASGVVDFALGTDTGGSVRLPASYT 165

Query: 191 NIIGLKPTRGIFSCSGVVPACKSLDCVSVFSMNLSDAEKCLKIMTKLDIEN-----DEYS 245
           +  G KP+ G  S  GV+   +SLD V VF+ +LS  ++   ++ K D ++     +E  
Sbjct: 166 STFGFKPSYGRLSRHGVISYAQSLDTVGVFANDLSMIDRVFSLLDKHDKKDPTSLSEELR 225

Query: 246 RSFPANPLQSFNKNLTVAIPK 266
             F +  L +  K L + IP+
Sbjct: 226 HKFTS--LTTKRKTLRIGIPE 244

>Scas_684.25
          Length = 482

 Score = 98.2 bits (243), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 83/167 (49%), Gaps = 3/167 (1%)

Query: 75  PLYGVPIAVKDNIDAKGFPTTAACPSFS-YMPTRDSTVVELLKQAGAIIIGKTNLDQFAT 133
           PL     AVKDNI     PTT +    S Y    D+TVV+LL+++G  I+GKTN+D+FA 
Sbjct: 48  PLSNTLCAVKDNIATNDMPTTCSSSMLSNYQSPFDATVVKLLRESGTTIVGKTNMDEFAM 107

Query: 134 GLVGTRSPYG--RTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAALNN 191
           G +G  S YG    P                      G+V  ALGTDT GS R+PA   +
Sbjct: 108 GSLGIHSHYGPALNPLFHDVDTVSGGSSSGSAGSVTSGVVHFALGTDTGGSVRLPACYCS 167

Query: 192 IIGLKPTRGIFSCSGVVPACKSLDCVSVFSMNLSDAEKCLKIMTKLD 238
           ++G K + G  S  GVV   +SLD V + + NL   +     + K D
Sbjct: 168 VLGFKGSYGRISRFGVVSFAQSLDTVGIMADNLQRVKDVFNTLDKFD 214

>ABR140C [732] [Homologous to ScYMR293C - SH] (662185..663576) [1392
           bp, 463 aa]
          Length = 463

 Score = 95.5 bits (236), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 68/203 (33%), Positives = 103/203 (50%), Gaps = 10/203 (4%)

Query: 75  PLYGVPIAVKDNIDAKGFPTTAACPSFS-YMPTRDSTVVELLKQAGAIIIGKTNLDQFAT 133
           PL  + + +KDNI  K  PTT +    + YM   D+TVVELL +AGA+  GKTN+D+F  
Sbjct: 38  PLGNLVVGIKDNIVTKKLPTTCSSGVLAGYMSPYDATVVELLDEAGAVTAGKTNMDEFGM 97

Query: 134 GLVGTRSPYGRT--PCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAALNN 191
           G  G  S +G T  P                      G+V  ALGTDT GS R+PAA  +
Sbjct: 98  GSGGIHSFFGPTLNPAFPERPTVAGGSSSGSAAAVAAGVVDFALGTDTGGSVRMPAAYTS 157

Query: 192 IIGLKPTRGIFSCSGVVPACKSLDCVSVFSMNLSDAEKCLKIMTKLDIEN-----DEYSR 246
            +G KP+ G  S  GV+   +SLD V + + ++    +  +++ + D ++     DE  +
Sbjct: 158 TVGFKPSYGRVSRHGVIAYAQSLDTVGIGARDVGLVRRVFEVLDRHDPKDPTSLPDELRQ 217

Query: 247 SFPANPLQSFNKNLTVAIPKNVM 269
              A  L+   K+L + IP  ++
Sbjct: 218 Q--AAALRREKKHLKIGIPAELL 238

>Kwal_56.22295
          Length = 583

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 86/179 (48%), Gaps = 10/179 (5%)

Query: 75  PLYGVPIAVKDNIDAKGFPTTAACPSFSYMPT---RDSTVVELLKQAGAIIIGKTNLDQF 131
           PL+G+P  VKDN   K    T  C S++ + +   RD+ VV  L+ AGA++ G   L ++
Sbjct: 131 PLHGIPFVVKDNYATKDKMDTT-CGSWALLGSVVPRDAHVVAKLRDAGAVLFGHATLSEW 189

Query: 132 A-----TGLVGTRSPYGRTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVP 186
           A     +   G  +  G+  C F+                   ++P +LGT+T GS   P
Sbjct: 190 ADMRSSSYSEGYSARGGQARCPFNLSVNPGGSSSGSAAAVAANMIPFSLGTETDGSIIDP 249

Query: 187 AALNNIIGLKPTRGIFSCSGVVPACKSLDCVSVFSMNLSDAEKCLKIMTKLDIENDEYS 245
           A  N I+G KPT G+ S +GVVP  +  D     + ++ DA    + M  +D E D Y+
Sbjct: 250 AMRNGIVGFKPTVGLTSRAGVVPESEHQDSTGPMARSVRDAVYAFQYMWGVD-ERDVYT 307

>Sklu_2417.11 , Contig c2417 20071-21846
          Length = 591

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 85/179 (47%), Gaps = 10/179 (5%)

Query: 75  PLYGVPIAVKDNIDAKGFPTTAACPSFSYMPT---RDSTVVELLKQAGAIIIGKTNLDQF 131
           PL+G+P  VKDN   K    T A  S+S M +   RD+ VVE L+ AGA++ G   + ++
Sbjct: 140 PLHGIPFVVKDNYATKDKMDTTAG-SWSLMGSVVPRDAYVVEKLRDAGAVLFGHATMSEW 198

Query: 132 A-----TGLVGTRSPYGRTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVP 186
           A     +   G  +  G+  C F+                   ++  +LGT+T GS   P
Sbjct: 199 ADMRSNSYSEGYSARGGQARCPFNLTVNPGGSSSGSAGSVAANMIMFSLGTETDGSIIDP 258

Query: 187 AALNNIIGLKPTRGIFSCSGVVPACKSLDCVSVFSMNLSDAEKCLKIMTKLDIENDEYS 245
           A  N I+G KPT G+ S +GV+P  +  D     +  + DA    + M  +D E D Y+
Sbjct: 259 AMRNGIVGFKPTVGLTSRAGVIPESEHQDSTGPMARTVKDAVYVFQSMWGVD-ERDAYT 316

>Sklu_2417.10 , Contig c2417 20071-21846
          Length = 591

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 85/179 (47%), Gaps = 10/179 (5%)

Query: 75  PLYGVPIAVKDNIDAKGFPTTAACPSFSYMPT---RDSTVVELLKQAGAIIIGKTNLDQF 131
           PL+G+P  VKDN   K    T A  S+S M +   RD+ VVE L+ AGA++ G   + ++
Sbjct: 140 PLHGIPFVVKDNYATKDKMDTTAG-SWSLMGSVVPRDAYVVEKLRDAGAVLFGHATMSEW 198

Query: 132 A-----TGLVGTRSPYGRTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVP 186
           A     +   G  +  G+  C F+                   ++  +LGT+T GS   P
Sbjct: 199 ADMRSNSYSEGYSARGGQARCPFNLTVNPGGSSSGSAGSVAANMIMFSLGTETDGSIIDP 258

Query: 187 AALNNIIGLKPTRGIFSCSGVVPACKSLDCVSVFSMNLSDAEKCLKIMTKLDIENDEYS 245
           A  N I+G KPT G+ S +GV+P  +  D     +  + DA    + M  +D E D Y+
Sbjct: 259 AMRNGIVGFKPTVGLTSRAGVIPESEHQDSTGPMARTVKDAVYVFQSMWGVD-ERDAYT 316

>Scas_582.4*
          Length = 2193

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 69/309 (22%), Positives = 139/309 (44%), Gaps = 21/309 (6%)

Query: 642  AVRIIKTLKSMQIKSLAIYSATDKYSQHVLDVDMAQALDGHTVEETYLHVEKIISIAKKY 701
            AV  ++TL++ +IK++ I    +  S    D D A  L   T+     ++E+I+ I +  
Sbjct: 977  AVTAVRTLRANKIKTIMINYNPETVST---DYDEADRLYFETI-----NLERILDIYEIE 1028

Query: 702  DVDAIIPGYGFLSENASFADRCEQEGIQFIGPRGETIRKLGLKHSAREVAKSAGVPLVPG 761
            +   ++   G  + N + A    +E ++ +G   E I     ++    +    GV   P 
Sbjct: 1029 NSSGVVVSMGGQTSN-NIAMSLHRENVKILGTSPEMIDSAENRYKFSRMLDQIGVDQ-PA 1086

Query: 762  SPLVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGD 821
               + + DEA + A+ +GYPV+V+ +    G  +  V ++ D+        +Q      D
Sbjct: 1087 WKELTSMDEAESFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLASYL----NQAVEVSRD 1142

Query: 822  SGVFMEKFIDNARHVEVQIMG-DGKGKTLALGER--DCSLQRRNQKVIEETPAPNLPRET 878
              V + K+I+NA+ +E+  +  +G+     + E   +  +   +  +I   P  +L +ET
Sbjct: 1143 YPVVITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLI--VPPQDLAKET 1200

Query: 879  RQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEHPITEMVTGLDLVE 938
              +++ A  ++G  L   G   ++FI  +  ++   +E N R     P    V G++L+E
Sbjct: 1201 VDRIVVATAKIGKALKITGPYNIQFIAKD--NEIKVIECNVRASRSFPFISKVVGVNLIE 1258

Query: 939  WMIKISAGV 947
               K   G+
Sbjct: 1259 LATKAVMGL 1267

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 74/350 (21%), Positives = 140/350 (40%), Gaps = 52/350 (14%)

Query: 704  DAIIPGYG---FLSENASFADRCEQEGIQFIGPRGETIRKLGLKHSAREVAKSAGVPL-- 758
            DAI   +G    LS      D  E  G++ +G + +TI    +    RE+  +A   +  
Sbjct: 510  DAIYVTFGGQTALSVGIEMKDEFESLGVKVLGTQIDTI----ITTEDRELFANAIDEINE 565

Query: 759  -VPGSPLVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSS 817
                S    + +EA T  K+IG+PV+V++    GG+G    +NEQ++      +     +
Sbjct: 566  KCAKSHAANSVEEALTAVKDIGFPVIVRAAYALGGLGSGFANNEQEL------IDLCNVA 619

Query: 818  YFGDSGVFMEKFIDNARHVEVQIMGDGKGKTLALGERDCSLQR------RNQKVIEETPA 871
            +     V +E+ +   + +E +++ D     + +    C+++            I   P+
Sbjct: 620  FASSPQVLVERSMKGWKEIEYEVVRDAFDNCVTV----CNMENFDPLGIHTGDSIVVAPS 675

Query: 872  PNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEHPITEMV 931
              L  E    +   A  +  +L   G   +++  +    ++  +EVN RL     +    
Sbjct: 676  QTLSDEEYNMLRNTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKA 735

Query: 932  TGLDLVEWMIKISAGVMPSLDEFNISQNGASIEVRVYAENPLKDFRPSPGELVDVQFPND 991
            TG  L     K+           NI  N     +    ++    F PS    V V+ P  
Sbjct: 736  TGYPLAYTAAKLG---------LNIPLNEV---INSVTKSTCACFEPSLDYCV-VKMPR- 781

Query: 992  CRVDTW-VKKGTKISPEFDPTL---AKIIVHGKDRNEAILKMKKALNETK 1037
                 W +KK T++S E   ++    +++  G+   EAI   +KA+  T+
Sbjct: 782  -----WDLKKFTRVSTELSSSMKSVGEVMSIGRTFEEAI---QKAIRSTE 823

>CAGL0L05676g 619734..626369 highly similar to sp|P07259 Saccharomyces
            cerevisiae YJL130c URA2, start by similarity
          Length = 2211

 Score = 68.2 bits (165), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 68/309 (22%), Positives = 138/309 (44%), Gaps = 21/309 (6%)

Query: 642  AVRIIKTLKSMQIKSLAIYSATDKYSQHVLDVDMAQALDGHTVEETYLHVEKIISIAKKY 701
            AV  ++TL++  IK++ I    +  S    D D A  L   T+     ++E+++ I +  
Sbjct: 1000 AVTAVRTLRANNIKTIMINYNPETVST---DYDEADRLYFETI-----NLERVLDIYEAE 1051

Query: 702  DVDAIIPGYGFLSENASFADRCEQEGIQFIGPRGETIRKLGLKHSAREVAKSAGVPLVPG 761
              + ++   G  + N + A    +E ++ +G   + I     ++    +    GV   P 
Sbjct: 1052 ASNGVVVSMGGQTSN-NIAMSLHRENVKILGTSPDMIDSAENRYKFSRMLDQIGVDQ-PA 1109

Query: 762  SPLVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGD 821
               + + DEA   A+ +GYPV+V+ +    G  +  V ++ D+    E+  +Q      D
Sbjct: 1110 WKELTSMDEAEDFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDL----ESYLNQAVEVSRD 1165

Query: 822  SGVFMEKFIDNARHVEVQIMG-DGKGKTLALGER--DCSLQRRNQKVIEETPAPNLPRET 878
              V + K+I+NA+ +E+  +  +G+     + E   +  +   +  +I   P  +L  ET
Sbjct: 1166 YPVVITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLI--VPPQDLAPET 1223

Query: 879  RQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEHPITEMVTGLDLVE 938
              +++ A  ++G  L   G   ++FI  +  ++   +E N R     P    V G++L+E
Sbjct: 1224 VDRIVVATAKIGKALKITGPYNIQFIAKD--NEIKVIECNVRASRSFPFISKVVGVNLIE 1281

Query: 939  WMIKISAGV 947
               K   G+
Sbjct: 1282 LATKAIMGL 1290

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 74/341 (21%), Positives = 136/341 (39%), Gaps = 49/341 (14%)

Query: 704  DAIIPGYG---FLSENASFADRCEQEGIQFIGPRGETIRKLGLKHSAREVAKSAGVPL-- 758
            DAI   +G    LS      D  E  G++ +G   +TI    +    RE+  +A   +  
Sbjct: 513  DAIYVTFGGQTALSVGIEMKDEFESLGVKVLGTPIDTI----ITTEDRELFANAIDEIDE 568

Query: 759  -VPGSPLVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSS 817
                S    + +EA    K+IG+PV+V++    GG+G    +NEQ++      +     +
Sbjct: 569  KCAKSQAANSVEEALAAVKDIGFPVIVRAAYALGGLGSGFANNEQEL------IDLCNVA 622

Query: 818  YFGDSGVFMEKFIDNARHVEVQIMGDGKGKTLALGERDCSLQR------RNQKVIEETPA 871
            +     V +E+ +   + VE +++ D     + +    C+++            I   P+
Sbjct: 623  FASSPQVLVERSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPS 678

Query: 872  PNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEHPITEMV 931
              L  E    + T A  +  +L   G   +++  +    ++  +EVN RL     +    
Sbjct: 679  QTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKA 738

Query: 932  TGLDLVEWMIKISAGVMPSLDEFNISQNGASIEVRVYAENPLKDFRPSPGELVDVQFPND 991
            TG  L     K+  G+   L+E   S   ++             F PS    V V+ P  
Sbjct: 739  TGYPLAYTAAKL--GLNIPLNEVKNSVTKSTCAC----------FEPSLDYCV-VKMPR- 784

Query: 992  CRVDTW-VKKGTKISPEFDPTL---AKIIVHGKDRNEAILK 1028
                 W +KK T++S E   ++    +++  G+   EAI K
Sbjct: 785  -----WDLKKFTRVSTELSSSMKSVGEVMSIGRTFEEAIQK 820

>YJL130C (URA2) [2788] chr10 complement(165641..172285)
            Multifunctional protein of pyrimidine biosynthesis
            pathway, contains glutamine amidotransferase,
            glutamine-dependent carbamylphosphate synthetase
            (CPSase), dihydroorotase-like (DHOase) domain, and
            aspartate carbamyltransferase (ATCase) [6645 bp, 2214 aa]
          Length = 2214

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 67/309 (21%), Positives = 139/309 (44%), Gaps = 21/309 (6%)

Query: 642  AVRIIKTLKSMQIKSLAIYSATDKYSQHVLDVDMAQALDGHTVEETYLHVEKIISIAKKY 701
            AV  ++TL++  IK++ +    +  S    D D A  L   T+     ++E+++ I +  
Sbjct: 1002 AVTAVRTLRANNIKTIMVNYNPETVST---DYDEADRLYFETI-----NLERVLDIYEIE 1053

Query: 702  DVDAIIPGYGFLSENASFADRCEQEGIQFIGPRGETIRKLGLKHSAREVAKSAGVPLVPG 761
            +   ++   G  + N + A    +E ++ +G   + I     ++    +    GV   P 
Sbjct: 1054 NSSGVVVSMGGQTSN-NIAMTLHRENVKILGTSPDMIDSAENRYKFSRMLDQIGVDQ-PA 1111

Query: 762  SPLVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGD 821
               + + DEA + A+ +GYPV+V+ +    G  +  V ++ D+    E+  +Q      D
Sbjct: 1112 WKELTSMDEAESFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDL----ESYLNQAVEVSRD 1167

Query: 822  SGVFMEKFIDNARHVEVQIMG-DGKGKTLALGER--DCSLQRRNQKVIEETPAPNLPRET 878
              V + K+I+NA+ +E+  +  +G+     + E   +  +   +  +I   P  +L  ET
Sbjct: 1168 YPVVITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLI--VPPQDLAPET 1225

Query: 879  RQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEHPITEMVTGLDLVE 938
              +++ A  ++G  L   G   ++FI  +  ++   +E N R     P    V G++L+E
Sbjct: 1226 VDRIVVATAKIGKALKITGPYNIQFIAKD--NEIKVIECNVRASRSFPFISKVVGVNLIE 1283

Query: 939  WMIKISAGV 947
               K   G+
Sbjct: 1284 LATKAIMGL 1292

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 78/350 (22%), Positives = 140/350 (40%), Gaps = 52/350 (14%)

Query: 704  DAIIPGYG---FLSENASFADRCEQEGIQFIGPRGETIRKLGLKHSAREVAKSAGVPL-- 758
            DAI   +G    LS   +  D  E  G++ +G   +TI    +    RE+  +A   +  
Sbjct: 515  DAIYVTFGGQTALSVGIAMKDEFEALGVKVLGTPIDTI----ITTEDRELFSNAIDEINE 570

Query: 759  -VPGSPLVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSS 817
                S    + DEA    K IG+PV+V++    GG+G    +NE+++      V     +
Sbjct: 571  KCAKSQAANSVDEALAAVKEIGFPVIVRAAYALGGLGSGFANNEKEL------VDLCNVA 624

Query: 818  YFGDSGVFMEKFIDNARHVEVQIMGDGKGKTLALGERDCSLQR------RNQKVIEETPA 871
            +     V +EK +   + VE +++ D     + +    C+++            I   P+
Sbjct: 625  FSSSPQVLVEKSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPS 680

Query: 872  PNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEHPITEMV 931
              L  E    + T A  +  +L   G   +++  +     +  +EVN RL     +    
Sbjct: 681  QTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPVSKDYCIIEVNARLSRSSALASKA 740

Query: 932  TGLDLVEWMIKISAGVMPSLDEFNISQNGASIEVRVYAENPLKDFRPSPGELVDVQFPND 991
            TG  L     K+  G+   L+E   S   ++             F PS    V V+ P  
Sbjct: 741  TGYPLAYTAAKL--GLNIPLNEVKNSVTKSTCAC----------FEPSLDYCV-VKMPR- 786

Query: 992  CRVDTW-VKKGTKISPEFDPTL---AKIIVHGKDRNEAILKMKKALNETK 1037
                 W +KK T++S E   ++    +++  G+   EAI   +KA+  T+
Sbjct: 787  -----WDLKKFTRVSTELSSSMKSVGEVMSIGRTFEEAI---QKAIRSTE 828

>Sklu_2331.1 YJL130C, Contig c2331 2029-8691
          Length = 2220

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 69/309 (22%), Positives = 135/309 (43%), Gaps = 21/309 (6%)

Query: 642  AVRIIKTLKSMQIKSLAIYSATDKYSQHVLDVDMAQALDGHTVEETYLHVEKIISIAKKY 701
            AV  ++TL++  +K++ +    +  S    D D A  L   T+     ++E+I+ I +  
Sbjct: 1002 AVTAVRTLRANNVKTIMVNYNPETVST---DYDEADRLYFETI-----NLERILDIYEAE 1053

Query: 702  DVDAIIPGYGFLSENASFADRCEQEGIQFIGPRGETIRKLGLKHSAREVAKSAGVPLVPG 761
                ++   G  + N + A    +E ++ +G   E I     ++    +    GV   P 
Sbjct: 1054 ASAGVVISMGGQTSN-NIAMSLHREKVKILGTSPEMIDSAENRYKFSRMLDQIGVDQ-PA 1111

Query: 762  SPLVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGD 821
               + + DEA   A+N+GYPV+V+ +    G  +  V ++ D+        +Q      D
Sbjct: 1112 WKELTSIDEAEGFAENVGYPVLVRPSYVLSGAAMNTVYSKDDLASYL----NQAVEVSRD 1167

Query: 822  SGVFMEKFIDNARHVEVQ-IMGDGKGKTLALGER--DCSLQRRNQKVIEETPAPNLPRET 878
              V + K+I+NA+ +E+  +  DG+     + E   +  +   +  +I   P  +L  ET
Sbjct: 1168 YPVVITKYIENAKEIEMDAVAKDGELVMHVVSEHVENAGVHSGDATLI--VPPQDLDPET 1225

Query: 879  RQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEHPITEMVTGLDLVE 938
              +++ A  ++G  L   G   ++FI   + +    +E N R     P    V G++L+E
Sbjct: 1226 VNRIVVATAKIGKALKITGPYNIQFI--AKNNDIKVIECNVRASRSFPFISKVVGVNLIE 1283

Query: 939  WMIKISAGV 947
               K   G+
Sbjct: 1284 MATKAVMGL 1292

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 74/350 (21%), Positives = 135/350 (38%), Gaps = 52/350 (14%)

Query: 704  DAIIPGYG---FLSENASFADRCEQEGIQFIGPRGETIRKLGLKHSAREVAKSAGVPL-- 758
            DAI   +G    LS      D  E  G++ +G   +T+    +    RE+  +A   +  
Sbjct: 515  DAIYVTFGGQTALSVGIEMKDEFETLGVKVLGTPIDTV----ITTEDRELFSNAMDEINE 570

Query: 759  -VPGSPLVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSS 817
                S       EA    K IG+PV+V++    GG+G     NE ++      V     +
Sbjct: 571  KCAKSKAASTVKEALEAVKEIGFPVIVRAAYALGGLGSGFASNETEL------VDLCNVA 624

Query: 818  YFGDSGVFMEKFIDNARHVEVQIMGDGKGKTLALGERDCSLQR------RNQKVIEETPA 871
            +     V +E+ +   + VE +++ D     + +    C+++            I   P+
Sbjct: 625  FASSPQVLVERSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPS 680

Query: 872  PNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEHPITEMV 931
              L  E    + T A  +  +L   G   +++  +    ++  +EVN RL     +    
Sbjct: 681  QTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKA 740

Query: 932  TGLDLVEWMIKISAGVMPSLDEFNISQNGASIEVRVYAENPLKDFRPSPGELVDVQFPND 991
            TG  L    I    G+   L+E   S   ++             F PS    V V+ P  
Sbjct: 741  TGYPLA--FIAAKLGLNIPLNEVKNSVTKSTCAC----------FEPSLDYCV-VKMPR- 786

Query: 992  CRVDTW-VKKGTKISPEFDPTL---AKIIVHGKDRNEAILKMKKALNETK 1037
                 W +KK T++S +   ++    +++  G+   EAI   +KA+  T+
Sbjct: 787  -----WDLKKFTRVSTQLSSSMKSVGEVMSVGRTFEEAI---QKAIRSTE 828

>Scas_721.66
          Length = 573

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 60/129 (46%), Gaps = 3/129 (2%)

Query: 75  PLYGVPIAVKDNIDAKGFPTTAACPSFSYMPTR---DSTVVELLKQAGAIIIGKTNLDQF 131
           PLYG+PI++KD  + +G  TT    S ++ P +   +S +V  L+  GAII  KT +   
Sbjct: 141 PLYGIPISLKDQCNVEGVDTTLGYLSRAFKPKKKEDESLIVSFLRDLGAIIYVKTTVPPS 200

Query: 132 ATGLVGTRSPYGRTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAALNN 191
                 T + +G T   F+                      + LGTD  GS R+PA+ + 
Sbjct: 201 MMATETTSNTFGYTYNSFNQHFSAGGSSGGEGSLIGCYGSVLGLGTDIGGSIRIPASYHG 260

Query: 192 IIGLKPTRG 200
           I G KP+ G
Sbjct: 261 IFGFKPSTG 269

>Sklu_2413.4 YJR109C, Contig c2413 10886-14254
          Length = 1122

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 56/228 (24%), Positives = 100/228 (43%), Gaps = 14/228 (6%)

Query: 725 QEGIQFIGPRGETIRKLGLKHSAREVAKSAGVPLVPGSPLVKNADEAFTIAKNIGYPVMV 784
            EG + +G   E I K   +H    +  S GV   P    + + +EA   A  +GYPV++
Sbjct: 678 HEGAKILGTSPEDIDKAENRHKFSSILDSIGVDQ-PEWKELTSVNEAKIFASKVGYPVLI 736

Query: 785 KSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQIMG-D 843
           + +    G  +  V++E ++    E      S    D  V + KFI+ A+ ++V  +  D
Sbjct: 737 RPSYVLSGAAMSVVNSEDEL----EVKLTNASDVSPDHPVVISKFIEGAQEIDVDAVAYD 792

Query: 844 GKGKTLALGER--DCSLQRRNQKVIEETPAPNLPRETRQKMLTAAERLGAYLNYRGAGTV 901
           GK    A+ E   +  +   +  +I   P  +L  ET+Q++   A+++    N  G   +
Sbjct: 793 GKVLVHAISEHVENAGVHSGDASLI--LPPQHLSEETKQRLKDIADKVAKAWNICGPFNM 850

Query: 902 EFIYDEQRDQ---FYFLEVNTRLQVEHPITEMVTGLDLVEWMIKISAG 946
           + I D+ RD       +E N R     P    V G++ ++  +K   G
Sbjct: 851 QIIKDD-RDHGTSLKVIECNIRASRSFPFVSKVLGINFIDVAVKAFLG 897

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/235 (21%), Positives = 98/235 (41%), Gaps = 18/235 (7%)

Query: 724 EQEGIQFIGPRGETIRKLGLKHSAREVAKSAGVPLVPGSPLVKNADEAFTIAKNIGYPVM 783
           E+ G++ +G   +T+     +    +  K   +P+   S   +  D+A   A  + YPV+
Sbjct: 133 EKYGVKVLGTPIKTLETSEDRDLFAQALKEINIPIAE-SFACETIDQALEAAAKVKYPVI 191

Query: 784 VKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQIMGD 843
           V+S    GG+G    ++EQ+M++          S      + +EK +   + +E +++ D
Sbjct: 192 VRSAYALGGLGSGFANDEQEMKEL------ASQSLSLAPQILVEKSLKGWKEIEYEVVRD 245

Query: 844 GKGKTLALGERDCSLQRRNQKVIEE------TPAPNLPRETRQKMLTAAERLGAYLNYRG 897
             G  + +    C+++  +   I         P+  L  E    + +AA ++  +L   G
Sbjct: 246 RVGNCITV----CNMENFDPLGIHTGDSIVFAPSQTLSDEEFHMLRSAAIKIIRHLGVVG 301

Query: 898 AGTVEFIYDEQRDQFYFLEVNTRLQVEHPITEMVTGLDLVEWMIKISAG-VMPSL 951
              V++        +  +EVN RL     +    TG  L     KI+ G  +P L
Sbjct: 302 ECNVQYALQPDGLDYRVIEVNARLSRSSALASKATGYPLAYTAAKIALGYTLPEL 356

>KLLA0E15444g 1370741..1377427 highly similar to sp|P07259
            Saccharomyces cerevisiae YJL130c URA2 multifunctional
            pyrimidine biosynthesis protein, start by similarity
          Length = 2228

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 66/309 (21%), Positives = 134/309 (43%), Gaps = 21/309 (6%)

Query: 642  AVRIIKTLKSMQIKSLAIYSATDKYSQHVLDVDMAQALDGHTVEETYLHVEKIISIAKKY 701
            AV  ++TL+    K++ +    +  S    D D A  L   T+     ++E+I+ I +  
Sbjct: 1000 AVTAVRTLRKNNFKTIMVNYNPETVST---DYDEADRLYFETI-----NLERIMDIYELE 1051

Query: 702  DVDAIIPGYGFLSENASFADRCEQEGIQFIGPRGETIRKLGLKHSAREVAKSAGVPLVPG 761
                ++   G  + N + A    +E ++ +G   E I     ++    +     V   P 
Sbjct: 1052 SSAGVVVSMGGQTSN-NIAMSLHRENVKILGTSPEMIDSAENRYKFSRMLDQIDVDQ-PA 1109

Query: 762  SPLVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGD 821
               + + DEA   A+ + YPV+V+ +    G  +  V ++ D+    E+  +Q      +
Sbjct: 1110 WKELTSMDEAEDFAEKVSYPVLVRPSYVLSGAAMNTVYSKDDL----ESYLNQAVEVSRE 1165

Query: 822  SGVFMEKFIDNARHVEVQIMG-DGKGKTLALGER--DCSLQRRNQKVIEETPAPNLPRET 878
              V + K+I+NA+ +E+  +  DG+     + E   +  +   +  +I   P  +L  ET
Sbjct: 1166 YPVVITKYIENAKEIEMDAVALDGELIMHVVSEHVENAGVHSGDATLI--VPPQDLDPET 1223

Query: 879  RQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEHPITEMVTGLDLVE 938
             ++++ A  ++G  L   G   ++FI   + ++   +E N R     P    V G++L+E
Sbjct: 1224 VRRIVEATAKIGRALQITGPYNIQFI--AKNNEIKVIECNVRASRSFPFISKVVGVNLIE 1281

Query: 939  WMIKISAGV 947
               K   G+
Sbjct: 1282 MATKAIMGI 1290

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 34/178 (19%), Positives = 73/178 (41%), Gaps = 16/178 (8%)

Query: 776 KNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGDSGVFMEKFIDNARH 835
           K+IG+PV+V++    GG+G     NE+++      V     ++     V +E+ +   + 
Sbjct: 587 KDIGFPVIVRAAYALGGLGSGFASNEKEL------VDLCNVAFASSPQVLVERSMKGWKE 640

Query: 836 VEVQIMGDGKGKTLALGERDCSLQRRNQKVIEE------TPAPNLPRETRQKMLTAAERL 889
           +E +++ D     + +    C+++  +   I         P+  L  E    + T A  +
Sbjct: 641 IEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVIAPSQTLSDEDYNMLRTTAVNV 696

Query: 890 GAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEHPITEMVTGLDLVEWMIKISAGV 947
             +L   G   +++  +    ++  +EVN RL     +    TG  L     K+   +
Sbjct: 697 IRHLGVVGECNIQYALNPTSKEYCIIEVNARLSRSSALASKATGYPLAYTAAKLGLNI 754

>ACR263C [1310] [Homologous to ScYJL130C (URA2) - SH] (827830..834552)
            [6723 bp, 2240 aa]
          Length = 2240

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 65/309 (21%), Positives = 134/309 (43%), Gaps = 21/309 (6%)

Query: 642  AVRIIKTLKSMQIKSLAIYSATDKYSQHVLDVDMAQALDGHTVEETYLHVEKIISIAKKY 701
            AV  ++TL+   +K++ +    +  S    D D    L   T+     ++E+I+ I +  
Sbjct: 1018 AVTAVRTLRQNNVKTIMVNYNPETVST---DYDEVDRLYFETI-----NMERILDIYEVE 1069

Query: 702  DVDAIIPGYGFLSENASFADRCEQEGIQFIGPRGETIRKLGLKHSAREVAKSAGVPLVPG 761
                ++   G  + N + A    +E ++ +G   E I     ++    +     V   P 
Sbjct: 1070 SSAGVVVSMGGQTSN-NIAMSLHRENVKILGTSPEMIDSAENRYKFSRMLDQIEVDQ-PA 1127

Query: 762  SPLVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGD 821
               + + +EA   A  +GYPV+V+ +    G  +  V ++ D+    E+  +Q      +
Sbjct: 1128 WKELTSMEEAEDFANKVGYPVLVRPSYVLSGAAMNTVYSKDDL----ESYLNQAVEVSRE 1183

Query: 822  SGVFMEKFIDNARHVEVQ-IMGDGKGKTLALGER--DCSLQRRNQKVIEETPAPNLPRET 878
              V + K+I+NA+ +E+  +  DG+     + E   +  +   +  +I   P  +L  ET
Sbjct: 1184 YPVVITKYIENAKEIEMDAVAKDGEMIMHVVSEHVENAGVHSGDATLI--VPPQDLDPET 1241

Query: 879  RQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEHPITEMVTGLDLVE 938
             ++++ A  ++G  L   G   ++FI   + ++   +E N R     P    V G++L+E
Sbjct: 1242 VRRIVDATAKIGRALKITGPYNIQFI--AKNNEIKVIECNVRASRSFPFISKVIGVNLIE 1299

Query: 939  WMIKISAGV 947
               K   G+
Sbjct: 1300 MATKAIMGI 1308

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 55/256 (21%), Positives = 100/256 (39%), Gaps = 26/256 (10%)

Query: 704 DAIIPGYG---FLSENASFADRCEQEGIQFIGPRGETIRKLGLKHSAREVAKSAGVPL-- 758
           DAI   +G    LS      D  E  G++ +G   +TI    +    RE+  +A   +  
Sbjct: 531 DAIYVTFGGQTALSVGIEMKDEFEALGVKVLGTSIDTI----ITTEDRELFANAMDEINE 586

Query: 759 -VPGSPLVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSS 817
               S      DEA    K+IG+PV+V++    GG+G     NEQ++      V     +
Sbjct: 587 KCAKSKAASTVDEALEAVKDIGFPVIVRAAYALGGLGSGFASNEQEL------VDLCNVA 640

Query: 818 YFGDSGVFMEKFIDNARHVEVQIMGDGKGKTLALGERDCSLQR------RNQKVIEETPA 871
           +     V +E+ +   + VE +++ D     + +    C+++            I   P+
Sbjct: 641 FASSPQVLVERSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPS 696

Query: 872 PNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEHPITEMV 931
             L  E    + T A  +  +L   G   +++  +    ++  +EVN RL     +    
Sbjct: 697 QTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKA 756

Query: 932 TGLDLVEWMIKISAGV 947
           TG  L     K+   +
Sbjct: 757 TGYPLAYTAAKLGLNI 772

>Sklu_2136.3 , Contig c2136 3336-5189 reverse complement
          Length = 617

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 71/137 (51%), Gaps = 6/137 (4%)

Query: 75  PLYGVPIAVKDNIDAKGFPTTAACPSF-SYMPTRDSTVVELLKQAGAIIIGKTNLDQFAT 133
           PL+GVP+++K+ ++ KG PT A+  S+ + +P   +  +++L + GAI   +T+  Q   
Sbjct: 188 PLHGVPVSLKEQMNFKGKPTHASYVSYITNIPKNSAVSIDILDKLGAIFHTRTSQPQAIM 247

Query: 134 GLVGTRSPYGRT--PCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAALNN 191
            L    +  GRT  PC  +                  G V I  G+D  GS RVPAA  +
Sbjct: 248 HLDTWNNITGRTRNPCS-TRLSPGGSSGGESAMVGMHGSV-IGHGSDIGGSIRVPAAFVD 305

Query: 192 IIGLKP-TRGIFSCSGV 207
           + G++P TR I S +G+
Sbjct: 306 LFGIRPTTRRISSLNGL 322

>Sklu_1884.2 YDR242W, Contig c1884 1484-3124 reverse complement
          Length = 546

 Score = 57.4 bits (137), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 64/137 (46%), Gaps = 5/137 (3%)

Query: 68  RHEKEKLPLYGVPIAVKDNIDAKGFPTTAACPSFSYMP---TRDSTVVELLKQAGAIIIG 124
           R   + LPLYG+PI++KD  +  G+ TT      ++ P     +S +V+ LK  GA++  
Sbjct: 112 RKPDKLLPLYGIPISLKDQCNVAGYDTTLGYLGRAFKPKTAAEESLLVKFLKDLGAVLYV 171

Query: 125 KTNLDQFATGLVGTRSPYGRT-PCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSG 183
           KT +           + +G T   V ++                 G + + +GTD  GS 
Sbjct: 172 KTTVPSSMMASETVSNTFGYTLNSVNTNFSSGGSSGGEGSLIGCYGSI-LGIGTDIGGSI 230

Query: 184 RVPAALNNIIGLKPTRG 200
           R+P++   + GL+PT G
Sbjct: 231 RIPSSFQGLFGLRPTHG 247

>Kwal_33.14061
          Length = 2221

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 66/309 (21%), Positives = 131/309 (42%), Gaps = 21/309 (6%)

Query: 642  AVRIIKTLKSMQIKSLAIYSATDKYSQHVLDVDMAQALDGHTVEETYLHVEKIISIAKKY 701
            AV  ++TL+  +IKS+ +    +  S    D D A  L   T+      +E+I+ I +  
Sbjct: 1002 AVTAVRTLRKEKIKSIMVNYNPETVST---DYDEADRLYFETI-----CLERILDIYEIE 1053

Query: 702  DVDAIIPGYGFLSENASFADRCEQEGIQFIGPRGETIRKLGLKHSAREVAKSAGVPLVPG 761
                ++   G  + N + A    +E ++ +G   E I     ++    +    GV   P 
Sbjct: 1054 SSAGVVVSMGGQTSN-NIAMSLHRENVKILGTTPEMIDSAENRYKFSRMLDQIGVDQ-PA 1111

Query: 762  SPLVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGD 821
               + + +EA   A  + +PV+V+ +    G  +  V ++ D+        +Q      D
Sbjct: 1112 WKELTSIEEAEQFADAVSFPVLVRPSYVLSGAAMNTVYSKDDLASYL----NQAVEVSRD 1167

Query: 822  SGVFMEKFIDNARHVEVQ-IMGDGKGKTLALGER--DCSLQRRNQKVIEETPAPNLPRET 878
              V + K+I+NA+ +E+  +  DG+     + E   +  +   +  +I   P  +L  ET
Sbjct: 1168 YPVVITKYIENAKEIEMDAVAKDGELVMHVVSEHVENAGVHSGDATLI--VPPQDLDPET 1225

Query: 879  RQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEHPITEMVTGLDLVE 938
             ++++ A  ++G  L   G   ++FI   + +    +E N R     P    V  ++L+E
Sbjct: 1226 VERIVVATAKIGKALKITGPFNIQFI--AKNNDIKVIECNVRASRSFPFISKVVNVNLIE 1283

Query: 939  WMIKISAGV 947
               K   G+
Sbjct: 1284 MATKAIMGL 1292

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/256 (19%), Positives = 99/256 (38%), Gaps = 26/256 (10%)

Query: 704 DAIIPGYG---FLSENASFADRCEQEGIQFIGPRGETIRKLGLKHSAREVAKSAGVPL-- 758
           DAI   +G    LS      D  E  G++ +G   +T+    +    RE+  +A   +  
Sbjct: 515 DAIYVTFGGQTALSVGIEMKDEFEALGVKVLGTPIDTV----ITTEDRELFSNAMDEINE 570

Query: 759 -VPGSPLVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSS 817
               S      +EA    K IG+PV+ ++    GG+G    +NE+++      V     +
Sbjct: 571 KCAKSKAAATVEEALEAVKEIGFPVICRAAYALGGLGSGFANNEKEL------VDLCNIA 624

Query: 818 YFGDSGVFMEKFIDNARHVEVQIMGDGKGKTLALGERDCSLQR------RNQKVIEETPA 871
           +     V +E+ +   + VE +++ D     + +    C+++            I   P+
Sbjct: 625 FASSPQVLVERSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPS 680

Query: 872 PNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEHPITEMV 931
             L  E    + T A  +  +L   G   +++  +    ++  +EVN RL     +    
Sbjct: 681 QTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKA 740

Query: 932 TGLDLVEWMIKISAGV 947
           TG  L     K+   +
Sbjct: 741 TGYPLAYTAAKLGLNI 756

>KLLA0F03190g complement(296883..300236) highly similar to sp|P03965
           Saccharomyces cerevisiae YJR109c CPA2 arginine-specific
           carbamoylphosphate synthase, large chain, start by
           similarity
          Length = 1117

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 70/306 (22%), Positives = 125/306 (40%), Gaps = 21/306 (6%)

Query: 642 AVRIIKTLKSMQIKSLAIYSATDKYSQHVLDVDMAQALDGHTVEETYLHVEKIISIAKKY 701
           AV   K L+    K++ I      Y+   +  D  + +D    EE  L  E+++ I +  
Sbjct: 601 AVNTTKALRKEGKKTIMI-----NYNPETVSTDFDE-VDRLYFEE--LSFERVMDIYELE 652

Query: 702 DVDA-IIPGYGFLSENASFADRCEQEGIQFIGPRGETIRKLGLKHSAREVAKSAGVPLVP 760
           + +  +I   G L +N   A +    G   +G   E I K   +H    +  S GV    
Sbjct: 653 NSEGCVISVGGQLPQN--IALKLLHNGAHILGTSPEDIDKAENRHKFSTILDSIGVNQPE 710

Query: 761 GSPLVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSSYFG 820
            S L  + +EA   A  +GYPV+++ +    G  +  V  E ++     T     S    
Sbjct: 711 WSEL-SSVEEAKVFANQVGYPVLIRPSYVLSGAAMSVVTGEHELEVKLTT----ASDVSP 765

Query: 821 DSGVFMEKFIDNARHVEVQ-IMGDGKGKTLALGERDCSLQRRNQKVIEETPAPNLPRETR 879
           D  V M KFI+ A+ ++V  +  +G     A+ E   +    +       P  NL +  +
Sbjct: 766 DHPVVMSKFIEGAQEIDVDAVAHNGMVLVHAISEHVENAGIHSGDATLVLPPQNLSQNIK 825

Query: 880 QKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQ---FYFLEVNTRLQVEHPITEMVTGLDL 936
            ++   A+++    N  G   ++ I D+ RD+      +E N R     P    V G++ 
Sbjct: 826 DRLKEIADKVAKAWNITGPFNMQIIKDD-RDEGVSLKVIECNIRASRSFPFVSKVLGVNF 884

Query: 937 VEWMIK 942
           +E  ++
Sbjct: 885 IEAAVQ 890

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 82/193 (42%), Gaps = 17/193 (8%)

Query: 766 KNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGDSGVF 825
           +  D A   A  +G+PV+V+S    GG+G    +N Q+M++    +  Q  S      + 
Sbjct: 172 ETVDAALEAADIVGFPVIVRSAYALGGLGSGFANNAQEMKQ----LASQSLSL--APQIL 225

Query: 826 MEKFIDNARHVEVQIMGDGKGKTLALGERDCSLQRRNQKVIEE------TPAPNLPRETR 879
           +EK +   + VE +++ D  G  + +    C+++  +   I         P+  L  E  
Sbjct: 226 VEKSLKGWKEVEYEVVRDRVGNCITV----CNMENFDPLGIHTGDSIVFAPSQTLSDEEF 281

Query: 880 QKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEHPITEMVTGLDLVEW 939
             + +AA ++  +L   G   V++        +  +EVN RL     +    TG  L   
Sbjct: 282 HMLRSAAIKIIRHLGVIGECNVQYALSPDSLDYRVIEVNARLSRSSALASKATGYPLAYT 341

Query: 940 MIKISAG-VMPSL 951
             KI+ G  +P L
Sbjct: 342 AAKIALGYTLPEL 354

>YDR242W (AMD2) [1076] chr4 (946799..948448) Protein with similarity
           to amidases [1650 bp, 549 aa]
          Length = 549

 Score = 54.3 bits (129), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 56/129 (43%), Gaps = 3/129 (2%)

Query: 75  PLYGVPIAVKDNIDAKGFPTTAACPSFSYMP---TRDSTVVELLKQAGAIIIGKTNLDQF 131
           PLYG+PI++KD  + +G  T+      ++ P     +S +V  L+  GAII  KT +   
Sbjct: 123 PLYGIPISLKDQCNVEGVDTSLGYLCRTFKPKTKNEESLIVSFLRDLGAIIFVKTTVPSS 182

Query: 132 ATGLVGTRSPYGRTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAALNN 191
                   + +G T    +                      + LGTD  GS R+P++   
Sbjct: 183 MMATDTQSNTFGYTYNSINLSFSSGGSSGGEGSLIGAHGSLLGLGTDIGGSIRIPSSYQG 242

Query: 192 IIGLKPTRG 200
           + GLKPT G
Sbjct: 243 LFGLKPTFG 251

>Kwal_55.19783
          Length = 1121

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 77/322 (23%), Positives = 134/322 (41%), Gaps = 39/322 (12%)

Query: 646 IKTLKSMQIKSLAIYS--ATDKYSQHVLDVDMAQALDGHTVEETYLHV--EKIISIAKKY 701
           IK LK  + +++ I    AT++ S  + D            E  YL V  E I  I ++ 
Sbjct: 58  IKALKEAKKRTILINPNIATNQTSHSLAD------------EIYYLPVTPEYITYIIERE 105

Query: 702 DVDAIIPGYGFLSE-NASFA-DR---CEQEGIQFIGPRGETIRKLGLKHSAREVAKSAGV 756
             DAI+  +G  +  N   A DR    ++ G++ +G   +T+     +    +  K   +
Sbjct: 106 RPDAILLTFGGQTGLNCGVALDRMGVLQKYGVKVLGTPIKTLETSEDRDLFAQALKEINI 165

Query: 757 PLVPGSPLVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGS 816
           P    S   +  DEA + A  +GYPV+V+S    GG+G    +NE +M++    +  Q  
Sbjct: 166 PTAE-SFACETVDEALSAASRVGYPVIVRSAYALGGLGSGFAENEAEMKE----LAAQAL 220

Query: 817 SYFGDSGVFMEKFIDNARHVEVQIMGDGKGKTLALGERDCSLQR------RNQKVIEETP 870
           S      + +EK +   + VE +++ D     + +    C+++            I   P
Sbjct: 221 SL--SPQILVEKSLKGWKEVEYEVVRDRVDNCITV----CNMENFDPLGVHTGDSIVFAP 274

Query: 871 APNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEHPITEM 930
           +  L  E    + TAA ++  +L   G   V++        +  +EVN RL     +   
Sbjct: 275 SQTLSDEEFHMLRTAAIKIIRHLGVVGECNVQYALQPDGLDYRVIEVNARLSRSSALASK 334

Query: 931 VTGLDLVEWMIKISAG-VMPSL 951
            TG  L     KI+ G  +P L
Sbjct: 335 ATGYPLAYTAAKIALGYTLPEL 356

 Score = 52.0 bits (123), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 56/264 (21%), Positives = 115/264 (43%), Gaps = 15/264 (5%)

Query: 689 LHVEKIISIAK-KYDVDAIIPGYGFLSENASFADRCEQEGIQFIGPRGETIRKLGLKHSA 747
           L  E+++ I + ++   A+I   G L +N   A +  + G   +G   E I +   +H  
Sbjct: 643 LSFERVMDIYELEHSEGAVISVGGQLPQN--IALKMLENGANILGTSPEDIDRAENRHKF 700

Query: 748 REVAKSAGVPLVPGSPLVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKA 807
             +  + GV     S L  +  EA   +K++GYPV+++ +    G  +  V++E ++   
Sbjct: 701 SSILDTIGVDQPEWSEL-SSVSEAKDFSKSVGYPVLIRPSYVLSGAAMSVVNSEDEL--- 756

Query: 808 FETVKHQGSSYFGDSGVFMEKFIDNARHVEVQIMG-DGKGKTLALGER--DCSLQRRNQK 864
            ET     S    D  V + KFI+ A+ ++V  +  +G+    A+ E   +  +   +  
Sbjct: 757 -ETKLTNASDVSPDHPVVISKFIEGAQEIDVDAVAYNGEVLVHAISEHVENAGVHSGDAT 815

Query: 865 VIEETPAPNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQRD--QFYFLEVNTRLQ 922
           +I   P  +L    ++++   A+++       G   ++ I D++ +      +E N R  
Sbjct: 816 LI--LPPQSLSESIKERLYDIAKKVAHAWKITGPFNMQIIKDDRHEGTSLKVIECNIRAS 873

Query: 923 VEHPITEMVTGLDLVEWMIKISAG 946
              P    V G + ++  +K   G
Sbjct: 874 RSFPFVSKVLGCNFIDVAVKAFIG 897

>KLLA0B08800g complement(772732..774444) similar to
           ca|CA4426|CaAMD21 Candida albicans amidase (by
           homology), start by similarity
          Length = 570

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 60/125 (48%), Gaps = 1/125 (0%)

Query: 75  PLYGVPIAVKDNIDAKGFPTTAACPSF-SYMPTRDSTVVELLKQAGAIIIGKTNLDQFAT 133
           PL+GVP+++K+ +  KG  T A+  S+  ++P + +  V++L + GA+   +T+  Q   
Sbjct: 141 PLHGVPVSIKEQMCYKGKVTNASYVSYVDFVPEQSAVSVDILIKLGAVCHVRTSQPQTIM 200

Query: 134 GLVGTRSPYGRTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAALNNII 193
            L    +  GRT    S K                    I  G+D  GS R PAA  N+ 
Sbjct: 201 HLDTWNNYIGRTRNPRSTKLSPGGSSGGESACVGMHGSVIGHGSDIGGSIRAPAAFANLF 260

Query: 194 GLKPT 198
           GL+PT
Sbjct: 261 GLRPT 265

>CAGL0C04917g 457506..460847 highly similar to sp|P03965
           Saccharomyces cerevisiae YJR109c CPA2, hypothetical
           start
          Length = 1113

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 69/311 (22%), Positives = 128/311 (41%), Gaps = 34/311 (10%)

Query: 642 AVRIIKTLKSMQIKSLAIYSATDKYSQHVLDVDMAQALDGHTVEETYLHVEKIISIAKKY 701
           AV   K L+    K++ I      Y+   +  D  + +D    EE  L  E+++ I   Y
Sbjct: 601 AVNTAKALREQNYKTIMI-----NYNPETVSTDFDE-VDRLYFEE--LSYERVLDI---Y 649

Query: 702 DVD----AIIPGYGFLSENASFADRCEQEGIQFIGPRGETIRKLGLKHSAREVAKSAGVP 757
           +++     I+   G L +N + +    + G + +G   + I     +H    +  S  V 
Sbjct: 650 ELEQSEGCIVSMGGQLPQNIALS--LYEYGCKILGTSPKDIDNAENRHKFSSILDSINV- 706

Query: 758 LVPGSPLVK---NADEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQ 814
              G P  K   + +EA T A  + YPV+++ +    G  +  V+NE ++          
Sbjct: 707 ---GQPEWKELTSVEEAKTFANKVSYPVLIRPSYVLSGAAMSVVNNEHELEDKLTL---- 759

Query: 815 GSSYFGDSGVFMEKFIDNARHVEVQIMG-DGKGKTLALGER--DCSLQRRNQKVIEETPA 871
            S    D  V M KFI  A+ ++V  +  +G+    A+ E   D  +   +  +I   P 
Sbjct: 760 ASDVSPDHPVVMSKFIQGAQEIDVDAVACNGELLVHAISEHVEDAGVHSGDATLI--LPP 817

Query: 872 PNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEHPITEMV 931
            +L    + ++ T A+++    N  G   ++ I   + D    +E N R     P    V
Sbjct: 818 QHLSENVKSQLKTIAKKVAKAWNITGPFNMQVIKAGEND-LKVIECNIRASRSFPFVSKV 876

Query: 932 TGLDLVEWMIK 942
            G++ +E  +K
Sbjct: 877 LGVNFIEVAVK 887

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 81/193 (41%), Gaps = 17/193 (8%)

Query: 766 KNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGDSGVF 825
           +N D+  + A  IGYPV+++S    GG+G    +N +++++          S      V 
Sbjct: 170 ENIDDVLSAASTIGYPVIIRSAYALGGLGSGFANNPEELKEL------ASQSLSLAPQVL 223

Query: 826 MEKFIDNARHVEVQIMGDGKGKTLALGERDCSLQR------RNQKVIEETPAPNLPRETR 879
           +EK +   + VE +++ D +   + +    C+++            I   P+  L  E  
Sbjct: 224 VEKSLRGWKEVEYEVVRDRENNCITV----CNMENFDPLGVHTGDSIVFAPSQTLSDEEF 279

Query: 880 QKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEHPITEMVTGLDLVEW 939
             + +AA ++  +L   G   V++        +  +EVN RL     +    TG  L   
Sbjct: 280 HMLRSAAIKIIRHLGVVGECNVQYALSPNSLDYRVIEVNARLSRSSALASKATGYPLAYT 339

Query: 940 MIKISAG-VMPSL 951
             KI+ G  +P L
Sbjct: 340 AAKIALGYTLPEL 352

>Sklu_2072.3 , Contig c2072 3010-4362 reverse complement
          Length = 450

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 83/372 (22%), Positives = 141/372 (37%), Gaps = 32/372 (8%)

Query: 75  PLYGVPIAVKDNIDAKGFPTTAACPSF-SYMPTRDSTVVELLKQAGAIIIGKTNLDQFAT 133
           P++G+P+++K++   KG  T A   S    +   D+   E+ ++AGA+   +T   Q   
Sbjct: 28  PMHGLPLSLKEHYAYKGKTTNAGFSSMIDNLTEEDALTTEIFRKAGAVFYIRTTQPQSLM 87

Query: 134 GLVGTRSPYGRTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAALNNII 193
            L    +  GR     +                     P+  G+D  GS R PAA  NI 
Sbjct: 88  HLDSFNNITGRCRNPLNTLLSPGGSTSGEGALISLRGSPLGTGSDIGGSIRAPAAFCNIW 147

Query: 194 GLKPTRGIFSCSGVVPACKSLD----CVSVFSMNLSDAEKCLKIMTKLDIE---NDEYSR 246
           G KPT    S  G   + + +       SV  M  +  +  L + T LD E    D Y  
Sbjct: 148 GFKPTNKRVSLQGAWASYRDMSNDMVLCSVGPMANTPEDLELYMKTFLDSEPWLRDNYVI 207

Query: 247 SFPANPLQSFNKNLTVAIPKNVMWYG--EKENPLLYDRAIDNFKQ------LGAQIKIID 298
             P   +      L +AI   VM  G  +   P+L  RA++  K+      +   ++ + 
Sbjct: 208 RLPWREVDLSLDKLKIAI---VMDDGIVKPSPPVL--RALELAKKSLEKAGVAKCVEWVP 262

Query: 299 FEPLLELARCLYEGTWVAERYAATRKFLETSPQQSTLDPVVYGIIKSATKFDAADAFEYE 358
           F     L  C Y        +    ++ E+    + L              D+ +  +Y 
Sbjct: 263 FNTSEGLDIC-YTAYNCDGNFNHRSRYEESGEPLAPLSEHHMRFGCGDRGLDSLEMLQYL 321

Query: 359 YKRQGILRKVEVLLQDIDVLCVPTCPLNPSFEEVDKEPILVNSRQGTW--TNFVNLADLS 416
           +KR    ++   ++ +IDV  V    L P++      P  +  +   W  T   N+ DL 
Sbjct: 322 HKRDSYRQRFADMMNEIDVDYV----LTPAY----FAPAAIPDKIKYWGYTALYNILDLP 373

Query: 417 ALAIPVGFRSDG 428
            ++ P G  +D 
Sbjct: 374 GVSFPTGVVTDA 385

>ABR157W [750] [Homologous to ScYJR109C (CPA2) - SH]
           complement(695747..699088) [3342 bp, 1113 aa]
          Length = 1113

 Score = 51.2 bits (121), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 78/190 (41%), Gaps = 17/190 (8%)

Query: 769 DEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGDSGVFMEK 828
           ++A   A +IGYPV+V+S    GG+G    D++  +R+          S      V +EK
Sbjct: 174 EDAVAAANDIGYPVIVRSAYALGGLGSGFADDDLQLRQLC------AQSLALSPQVLVEK 227

Query: 829 FIDNARHVEVQIMGDGKGKTLALGERDCSLQR------RNQKVIEETPAPNLPRETRQKM 882
            +   + +E +++ D  G  + +    C+++            I   P+  L  E    +
Sbjct: 228 SLKGWKEIEYEVVRDRVGNCITV----CNMENFDPLGIHTGDSIVLAPSQTLSDEEFHML 283

Query: 883 LTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEHPITEMVTGLDLVEWMIK 942
            TAA  +  +L   G   V++        F  +EVN RL     +    TG  L     K
Sbjct: 284 RTAAIEIIRHLGVVGECNVQYALQPDGLAFKVIEVNARLSRSSALASKATGYPLAYTAAK 343

Query: 943 ISAG-VMPSL 951
           I+ G  +P L
Sbjct: 344 IALGYTLPEL 353

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 57/249 (22%), Positives = 101/249 (40%), Gaps = 13/249 (5%)

Query: 718 SFADRCEQEGIQFIGPRGETIRKLGLKHSAREVAKSAGVPLVPGSPLVKNADEAFTIAKN 777
           + A +  ++G   +G   E I K   +H    +  + G+     S L K+  E      +
Sbjct: 663 NIASQLYEQGANILGTSPEDIDKAEDRHKFSTILDTLGLDQPRWSEL-KSLSEVKHFLDD 721

Query: 778 IGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVE 837
           +GYPV+V+ +    G  +  V N +D+   FE+      +   +  V + KFI+ A+ ++
Sbjct: 722 VGYPVLVRPSYVLSGAAMSTVYNSEDLEGVFES----AVAVSPEHPVVISKFIEGAQELD 777

Query: 838 VQIMGDGKGKTL--ALGERDCSLQRRNQKVIEETPAPNLPRETRQKMLTAAERLGAYLNY 895
           +  +   KG  L  A+ E   +    +       P  +L  E + ++   A ++ A  N 
Sbjct: 778 IDAVAY-KGSLLVHAISEHVENAGVHSGDATLVLPPQSLKEEEKTRLKQLAAQVAAAWNI 836

Query: 896 RGAGTVEFIYDEQRDQ--FYFLEVNTRLQVEHPITEMVTGLDLVEWMIKISAG---VMPS 950
            G   ++ I   +        +E N R     P    V G++ VE  +K   G   V PS
Sbjct: 837 TGPFNMQIIKTAEGGHTCLKIIECNIRASRSFPFVSKVLGVNFVEIAVKAFLGGDLVPPS 896

Query: 951 LDEFNISQN 959
            D    S N
Sbjct: 897 CDLMARSYN 905

>Kwal_34.15724
          Length = 556

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 54/126 (42%), Gaps = 1/126 (0%)

Query: 76  LYGVPIAVKDNIDAKGFPTTAACPS-FSYMPTRDSTVVELLKQAGAIIIGKTNLDQFATG 134
           L+GVPI++KD ++  G  TT    S       + S +  +L+  GAI   KT +      
Sbjct: 124 LHGVPISLKDQVNLPGIETTIGYISKVGSKSEKVSLLARVLQDQGAIFYVKTAVPTAMLA 183

Query: 135 LVGTRSPYGRTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAALNNIIG 194
                S +GRT    +                     P+ +GTD  GS R+PAA   + G
Sbjct: 184 SETVSSLHGRTLNAVNIAFSSGGSSGGEGSLIGARGSPLGVGTDIGGSIRIPAAFQGLYG 243

Query: 195 LKPTRG 200
           L+P+ G
Sbjct: 244 LRPSHG 249

>Scas_691.19
          Length = 1117

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/207 (21%), Positives = 84/207 (40%), Gaps = 18/207 (8%)

Query: 752 KSAGVPLVPGSPLVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETV 811
           K   +P +  S      DEA   A +I YPV+++S    GG+G    +N+Q++++     
Sbjct: 158 KEINIP-IANSIACATVDEALAAANSIKYPVIIRSAYALGGLGSGFANNDQELKQLSSQS 216

Query: 812 KHQGSSYFGDSGVFMEKFIDNARHVEVQIMGDGKGKTLALGERDCSLQR------RNQKV 865
                       + +E+ +   + VE +++ D  G  + +    C+++            
Sbjct: 217 LSLSPQ------ILVERSMKGWKEVEYEVVRDRVGNCITV----CNMENFDPLGVHTGDS 266

Query: 866 IEETPAPNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEH 925
           I   P+  L  E    + +AA ++  +L   G   V++        +  +EVN RL    
Sbjct: 267 IVFAPSQTLSDEEYHMLRSAAIKIIRHLGVIGECNVQYALQPDGLDYCVIEVNARLSRSS 326

Query: 926 PITEMVTGLDLVEWMIKISAG-VMPSL 951
            +    TG  L     KI+ G  +P L
Sbjct: 327 ALASKATGYPLAYTAAKIALGYTLPEL 353

 Score = 48.5 bits (114), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 69/312 (22%), Positives = 127/312 (40%), Gaps = 28/312 (8%)

Query: 642 AVRIIKTLKSMQIKSLAIYSATDKYSQHVLDVDMAQALDGHTVEETYLHVEKIISIAKKY 701
           AV   KTL+    K++ I      Y+   +  D  + +D    EE  L  E+++ I   Y
Sbjct: 601 AVNTAKTLRDEGKKTIMI-----NYNPETVSTDFDE-VDRLYFEE--LSYERVMDI---Y 649

Query: 702 DVD----AIIPGYGFLSENASFADRCEQEGIQFIGPRGETIRKLGLKHSAREVAKSAGVP 757
           +++     II   G L +N +      + G + +G     I +   +H    +  S  V 
Sbjct: 650 ELEQSEGCIISVGGQLPQNIALP--LYENGCKILGTSPVDIDRAEDRHKFSSILDSINVG 707

Query: 758 LVPGSPLVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSS 817
             P    + + DEA   A  +GYPV+++ +    G  +  V+NE +++          S 
Sbjct: 708 Q-PAWSELTSVDEAKVFADKVGYPVLIRPSYVLSGAAMSVVNNEDELKLKLTL----ASD 762

Query: 818 YFGDSGVFMEKFIDNARHVEVQIMG-DGKGKTLALGER--DCSLQRRNQKVIEETPAPNL 874
              D  V M KFI+ A+ ++V  +  +GK    A+ E   +  +   +  +I   P  NL
Sbjct: 763 VSPDHPVVMSKFIEGAQEIDVDAVAYNGKVLIHAISEHVENAGVHSGDASLI--LPPQNL 820

Query: 875 PRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEHPITEMVTGL 934
             + +  +   A+++    +  G   ++ I  E       +E N R     P    V G 
Sbjct: 821 SDKVKANLKEIADKVADAWHITGPFNMQII-KEGDKPLKVIECNIRASRSFPFVSKVLGK 879

Query: 935 DLVEWMIKISAG 946
           + +E  ++   G
Sbjct: 880 NFIEVAVRAFLG 891

>KLLA0D12628g 1071637..1073373 weakly similar to sp|P22580
           Saccharomyces cerevisiae YDR242w AMD2 amidase singleton,
           hypothetical start
          Length = 578

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 1/138 (0%)

Query: 75  PLYGVPIAVKDNIDAKGFPTTAACPSF-SYMPTRDSTVVELLKQAGAIIIGKTNLDQFAT 133
           P++G+PI++K+++  KG  T A+  S  S +  + +  V++  + GA+   +T   Q   
Sbjct: 143 PMHGIPISLKEHLSFKGEITHASYVSLLSSVTPKHALTVDIFDKQGALYHVRTAQPQTIM 202

Query: 134 GLVGTRSPYGRTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAALNNII 193
            L       GRT    S K                    I +GTD  GS R PAA   I 
Sbjct: 203 HLDTWNIITGRTRNPRSTKLSPGGSSGGESAAIGMHGSVIGIGTDIGGSIRCPAAFAGIC 262

Query: 194 GLKPTRGIFSCSGVVPAC 211
           G++PT    S   V P+ 
Sbjct: 263 GMRPTVKRVSLLDVTPSS 280

>YJR109C (CPA2) [3001] chr10 complement(629500..632856)
           Carbamoylphosphate synthetase of arginine biosynthetic
           pathway, synthetase (large) subunit [3357 bp, 1118 aa]
          Length = 1118

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 79/193 (40%), Gaps = 17/193 (8%)

Query: 766 KNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGDSGVF 825
           +  DEA   A+ + YPV+V+S    GG+G    +N  +M++          S      + 
Sbjct: 171 ETVDEALEAAERVKYPVIVRSAYALGGLGSGFANNASEMKEL------AAQSLSLAPQIL 224

Query: 826 MEKFIDNARHVEVQIMGDGKGKTLALGERDCSLQRRNQKVIEE------TPAPNLPRETR 879
           +EK +   + VE +++ D  G  + +    C+++  +   +         P+  L  E  
Sbjct: 225 VEKSLKGWKEVEYEVVRDRVGNCITV----CNMENFDPLGVHTGDSMVFAPSQTLSDEEF 280

Query: 880 QKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEHPITEMVTGLDLVEW 939
             + +AA ++  +L   G   V++        +  +EVN RL     +    TG  L   
Sbjct: 281 HMLRSAAIKIIRHLGVIGECNVQYALQPDGLDYRVIEVNARLSRSSALASKATGYPLAYT 340

Query: 940 MIKISAG-VMPSL 951
             KI  G  +P L
Sbjct: 341 AAKIGLGYTLPEL 353

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 67/312 (21%), Positives = 126/312 (40%), Gaps = 28/312 (8%)

Query: 642 AVRIIKTLKSMQIKSLAIYSATDKYSQHVLDVDMAQALDGHTVEETYLHVEKIISIAKKY 701
           AV   KTL+    K++ I      Y+   +  D  + +D    EE  L  E+++ I   Y
Sbjct: 601 AVNTAKTLRDQGKKTIMI-----NYNPETVSTDFDE-VDRLYFEE--LSYERVMDI---Y 649

Query: 702 DVD----AIIPGYGFLSENASFADRCEQEGIQFIGPRGETIRKLGLKHSAREVAKSAGVP 757
           +++     II   G L +N   A +    G   +G     I +   +H    +  S  V 
Sbjct: 650 ELEQSEGCIISVGGQLPQN--IALKLYDNGCNIMGTNPNDIDRAENRHKFSSILDSIDVD 707

Query: 758 LVPGSPLVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSS 817
               S L  + +EA   A  + YPV+++ +    G  +  V+NE++++          S 
Sbjct: 708 QPEWSELT-SVEEAKLFASKVNYPVLIRPSYVLSGAAMSVVNNEEELKAKLTL----ASD 762

Query: 818 YFGDSGVFMEKFIDNARHVEVQIMG-DGKGKTLALGER--DCSLQRRNQKVIEETPAPNL 874
              D  V M KFI+ A+ ++V  +  +G     A+ E   +  +   +  ++   P  +L
Sbjct: 763 VSPDHPVVMSKFIEGAQEIDVDAVAYNGNVLVHAISEHVENAGVHSGDASLV--LPPQHL 820

Query: 875 PRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEHPITEMVTGL 934
             + +  +   A+++       G   ++ I D +      +E N R     P    V G+
Sbjct: 821 SDDVKIALKDIADKVAKAWKITGPFNMQIIKDGEH-TLKVIECNIRASRSFPFVSKVLGV 879

Query: 935 DLVEWMIKISAG 946
           + +E  +K   G
Sbjct: 880 NFIEIAVKAFLG 891

>Kwal_27.10438
          Length = 569

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 58/125 (46%), Gaps = 1/125 (0%)

Query: 75  PLYGVPIAVKDNIDAKGFPTTAACPSFSYMPT-RDSTVVELLKQAGAIIIGKTNLDQFAT 133
           PL+GV +++K+ ++ KG  TTA+  ++    T ++   + +L++ GA+   +T   Q   
Sbjct: 143 PLHGVVVSLKEQMNYKGKVTTASYVAYLRNVTEKEGLSISILRKLGAVFHVRTAQPQGIM 202

Query: 134 GLVGTRSPYGRTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAALNNII 193
            L    +  GRT    S +                    I  G+D  GS R PAA  ++ 
Sbjct: 203 HLDTWNNITGRTRNPLSTRLSPGGSSGGESAIVAMHGSVIGHGSDIGGSIRAPAAFADLF 262

Query: 194 GLKPT 198
           G++PT
Sbjct: 263 GIRPT 267

>Sklu_777.1 YJL126W, Contig c777 867-1775
          Length = 302

 Score = 37.7 bits (86), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 45/99 (45%), Gaps = 3/99 (3%)

Query: 673 VDMAQALDGHTVEETYLHVEKIISIAKKYDVDAII--PGYGFLSENASFADRCEQEGIQF 730
           V +AQ      +++    V  +IS A + DV  +       FLS NA+ ++R  QE   F
Sbjct: 4   VAIAQLCSSSNLQQNLRTVTGLISRALEQDVAVLFFPEATDFLSANAAHSNRLAQESPLF 63

Query: 731 IGPRGETIRKLGLKHSAREVAKSAGVPLVPGSPLVKNAD 769
           I      +R+L ++H  R +  S GV L P    V   D
Sbjct: 64  ISSLQSRLRELTVEHGKR-IDVSIGVHLPPTEGDVSRGD 101

>CAGL0K11792g complement(1134215..1136869) similar to tr|Q12071
            Saccharomyces cerevisiae YDR027c LUV1 interacts with the
            beta-tubulin binding protein RBL2P, hypothetical start
          Length = 884

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 72/168 (42%), Gaps = 23/168 (13%)

Query: 1420 EDPILFQK--DGQELQSPKVVYRQAGDRYILIEYGDDIFELNLCYRIKSLIDIISQRNTK 1477
            ++P +F K  +G ELQ        A DR  +I YG      NL   +   +D++     K
Sbjct: 223  DNPRVFHKVLEGVELQLENFSVSGAEDR--VIGYG------NLRRNLNDYLDVVENLLIK 274

Query: 1478 GIKEMSQGVRSVLVEYDGYEISQK-------ELLKTLIAYEEQLPQEKNWSVKSRIFRLP 1530
             I + S      L E D  E+S K       EL K+L+  E    + +   +K +IFR  
Sbjct: 275  EISKSSHKFYRTLSEVDDLEVSIKKGLGLLDELSKSLVNVERNEIEVRLAKLK-KIFRRR 333

Query: 1531 MAFEDKETLACVKRYQETIRS-----KAPWLPNNVDFVAEVNNLTHDD 1573
               + ++ L  V+  +E IR      +   L   +D  + +NNL H D
Sbjct: 334  NVEKLEQGLLQVRLIKEKIRECQEIYEKEELQKCLDLTSSINNLIHGD 381

>Kwal_27.11485
          Length = 471

 Score = 34.3 bits (77), Expect = 0.91,   Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 31/61 (50%), Gaps = 9/61 (14%)

Query: 399 VNSRQGTWTNFVNLADL-------SALAIPVGFRSDGLPNGV--TLIAKKFEDYALLQLA 449
           +N+  GT T F +  +L         LAIP  FRSDG+  G+  TLIA     + L  LA
Sbjct: 1   MNTNTGTATAFFSTINLVKTIVGAGMLAIPYAFRSDGVLVGIVLTLIAALTSGFGLFVLA 60

Query: 450 K 450
           K
Sbjct: 61  K 61

>CAGL0K10340g complement(1006791..1008503) sp|O74197 Candida
           glabrata Phosphoribosylaminoimidazole carboxylase,
           identified start
          Length = 570

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 49/226 (21%), Positives = 96/226 (42%), Gaps = 34/226 (15%)

Query: 631 KTVLVANRGEIAVRIIKTLKSMQIKSLAIYSATDKYSQHVLDVDMAQALDGHTVEETYLH 690
           +TV +   G++   I++    + IK+L I  A +  ++ +   + +  +DG         
Sbjct: 4   RTVGILGGGQLGRMIVEAANRLNIKTL-ILDAPNSPAKQI--TNASDHVDG--------- 51

Query: 691 VEKIISIAKKYDVDAIIPGYGFLSENASFADRCEQEGIQF------IGPRGETIRKLGLK 744
                S A K D++A+      ++      D    + +Q       I P  ETI  +  K
Sbjct: 52  -----SFANKEDIEALAAKCDVMTVEIEHVDVNALKEVQKQFPKLEIYPTPETIGLIQDK 106

Query: 745 HSAREVAKSAGVPLVPGSPLVKNADEAFT-IAKNIGYPVMVKS-TAGGGGIGLQKVDNEQ 802
           +  ++      +P+VP S  V+N+ E+      ++GYP ++KS T    G G   V +E+
Sbjct: 107 YVQKQHLVKNRIPVVP-SITVENSKESLIKTGSSLGYPFVLKSRTLAYDGRGNFVVKSEE 165

Query: 803 DMRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQIMGDGKGKT 848
           D+ K  E        +  +  ++ EK+    + + V I+    G+ 
Sbjct: 166 DIEKGLE--------FLANRPLYAEKWASFKKELSVMIIRSLDGRV 203

>CAGL0M03245g complement(372122..373810) similar to sp|P39994
           Saccharomyces cerevisiae YEL020c, hypothetical start
          Length = 562

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 41/97 (42%), Gaps = 4/97 (4%)

Query: 689 LHVEKIISIAK-KYDVDAIIPGYGFLSENASFADRCEQEGIQFIGPRGETIRKLGLKHSA 747
           +H   I S+ K +YDVD +    G       FA   +  GI+FIG R E           
Sbjct: 6   IHSRNIASLLKYQYDVDVVFGIVGI--PVVEFAQELQSVGIRFIGFRNEQAASYAASAYG 63

Query: 748 REVAKSAGVPLVPGSPLVKNADEAFTIAKNIGYPVMV 784
               K  GV LV G P V +A      + N  +P+++
Sbjct: 64  YLTGK-PGVLLVVGGPGVIHALAGVYNSMNNRWPLLI 99

>ADL345C [1395] [Homologous to ScYBR114W (RAD16) - SH]
           (100332..102572) [2241 bp, 746 aa]
          Length = 746

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 35/73 (47%), Gaps = 5/73 (6%)

Query: 870 PAPNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEHPITE 929
           PA  +  E  +K  +   RLG   N+R +  +E + +E     Y L  +TR       ++
Sbjct: 547 PALEIDEEMFKKQ-SIVNRLGLQGNWRSSTKIEALLEE----LYNLRSSTRTIKSIVFSQ 601

Query: 930 MVTGLDLVEWMIK 942
             + LDLVEW +K
Sbjct: 602 FTSMLDLVEWRLK 614

>Kwal_47.16696
          Length = 1430

 Score = 31.6 bits (70), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 12/78 (15%)

Query: 1512 EQLPQE---------KNWSVKSRIFRLPMAFEDKETLACVKRYQETIRSKAPWLPNNVDF 1562
            E+LPQ          + WS    +  LP + ++   +A V+R  +   S A + P  +DF
Sbjct: 208  EELPQNVALVDIQVYRPWSFNELLQELPSSIKN---IAIVQRTNDQSLSTAGFQPVLLDF 264

Query: 1563 VAEVNNLTHDDIRQLIYT 1580
             ++ N+L    I+QL+ T
Sbjct: 265  FSDFNSLIERGIQQLLVT 282

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.137    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 60,534,516
Number of extensions: 2797900
Number of successful extensions: 6779
Number of sequences better than 10.0: 73
Number of HSP's gapped: 6820
Number of HSP's successfully gapped: 98
Length of query: 1806
Length of database: 16,596,109
Length adjustment: 116
Effective length of query: 1690
Effective length of database: 12,580,421
Effective search space: 21260911490
Effective search space used: 21260911490
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)