Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M04939g23323010551e-147
YMR233W2262034446e-55
ABL015C2201943853e-46
KLLA0B13024g124833228e-38
Sklu_1837.2161793222e-37
YOR295W (UAF30)2282122714e-29
Kwal_55.2030878572161e-22
Scas_324.1103611892e-18
Scas_665.262492281932e-17
CAGL0G07557g2412201685e-14
CAGL0G08646g52544616.5
KLLA0F00770g62884617.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M04939g
         (230 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M04939g 539988..540689 similar to sp|Q05024 Saccharomyces c...   410   e-147
YMR233W (YMR233W) [4189] chr13 (739184..739864) Protein containi...   175   6e-55
ABL015C [577] [Homologous to ScYMR233W (TRI1) - SH; ScYOR295W (U...   152   3e-46
KLLA0B13024g complement(1138572..1138946) some similarities with...   128   8e-38
Sklu_1837.2 YMR233W, Contig c1837 1803-2288 reverse complement        128   2e-37
YOR295W (UAF30) [5079] chr15 (869205..869891) Component of the U...   108   4e-29
Kwal_55.20308                                                          88   1e-22
Scas_324.1                                                             77   2e-18
Scas_665.26                                                            79   2e-17
CAGL0G07557g 715354..716079 similar to tr|Q08747 Saccharomyces c...    69   5e-14
CAGL0G08646g complement(814956..816533) some similarities with s...    28   6.5  
KLLA0F00770g 65967..67853 weakly similar to sgd|S0005721 Sacchar...    28   7.3  

>CAGL0M04939g 539988..540689 similar to sp|Q05024 Saccharomyces
           cerevisiae YMR233w or tr|Q08747 Saccharomyces cerevisiae
           YOR295w, hypothetical start
          Length = 233

 Score =  410 bits (1055), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 206/230 (89%), Positives = 206/230 (89%)

Query: 1   MDQNIDLNNYVSMLDAIISVSDPDKVSPKKIRKALEQLFSVSLENKKKEVNELIVARFQI 60
           MDQNIDLNNYVSMLDAIISVSDPDKVSPKKIRKALEQLFSVSLENKKKEVNELIVARFQI
Sbjct: 1   MDQNIDLNNYVSMLDAIISVSDPDKVSPKKIRKALEQLFSVSLENKKKEVNELIVARFQI 60

Query: 61  LQADPHILVSNEEFQNLKMIRGNYDALLSSKSMEKKHKLTEXXXXXXXXXXXXXXXXXXX 120
           LQADPHILVSNEEFQNLKMIRGNYDALLSSKSMEKKHKLTE                   
Sbjct: 61  LQADPHILVSNEEFQNLKMIRGNYDALLSSKSMEKKHKLTESSKKTRIQVKKKKSKKSSK 120

Query: 121 XXXXXVANPNSNAINSMKLRLSDDLYKFLGERELPRTQVVKQVWDYIKEHNLQSPEDRRE 180
                VANPNSNAINSMKLRLSDDLYKFLGERELPRTQVVKQVWDYIKEHNLQSPEDRRE
Sbjct: 121 DGEKKVANPNSNAINSMKLRLSDDLYKFLGERELPRTQVVKQVWDYIKEHNLQSPEDRRE 180

Query: 181 IICDDRMRPIFGDKMTMFALNKILSKHLTKIEPKSEEADNSRLSVKLEDG 230
           IICDDRMRPIFGDKMTMFALNKILSKHLTKIEPKSEEADNSRLSVKLEDG
Sbjct: 181 IICDDRMRPIFGDKMTMFALNKILSKHLTKIEPKSEEADNSRLSVKLEDG 230

>YMR233W (YMR233W) [4189] chr13 (739184..739864) Protein containing
           a BAF60b domain of the SWIB complex, has moderate
           similarity to S. cerevisiae Uaf30p, which is a component
           of the Upstream Activation Factor (UAF) complex and is
           involved in activation of RNA polymerase I [681 bp, 226
           aa]
          Length = 226

 Score =  175 bits (444), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 91/203 (44%), Positives = 134/203 (66%), Gaps = 12/203 (5%)

Query: 6   DLNNYVSMLDAIISVSDPDKVSPKKIRKALEQLFSVSLENKKKEVNELIVARFQILQADP 65
           D+N Y+ M+DAI+SVS+PD++SPK++RKAL+ L+SV+L++++K +NELI+ RF  +Q +P
Sbjct: 3   DINKYIPMVDAILSVSNPDEISPKRVRKALQILYSVNLDSQRKLINELILERFGDIQENP 62

Query: 66  HILVSNEEFQNLKMIRGNYDALLSSKSMEKKHKLTEXXXXXXXXXXXXXXXXXXXXXXXX 125
            +L+   +     + R    +L   K  E+  + T                         
Sbjct: 63  RVLIPKNDL----ISRDQELSLRLQKEEERPLRSTRKRKGKSESKSKRKKKKND------ 112

Query: 126 VANPNSNAINSMKLRLSDDLYKFLGERELPRTQVVKQVWDYIKEHNLQSPEDRREIICDD 185
             +P+SN+I+  K+ LS  L KFLG  ELPRTQVVK +W YIKEH+LQ+P+DRREI+CD+
Sbjct: 113 --SPDSNSISVRKVLLSAPLQKFLGSEELPRTQVVKMIWQYIKEHDLQNPKDRREILCDE 170

Query: 186 RMRPIFGDKMTMFALNKILSKHL 208
           +M PIFG KMTMF++NK+L+KHL
Sbjct: 171 KMEPIFGKKMTMFSMNKLLTKHL 193

>ABL015C [577] [Homologous to ScYMR233W (TRI1) - SH; ScYOR295W
           (UAF30) - SH] (371210..371872) [663 bp, 220 aa]
          Length = 220

 Score =  152 bits (385), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 114/194 (58%), Gaps = 16/194 (8%)

Query: 16  AIISVSDPDKVSPKKIRKALEQLFSVSLENKKKEVNELIVARFQILQADPHILVSNEEFQ 75
           AI+SVSDPD++S K+IRKAL++LF+V L+  KK++  LI+ RF +L+     ++S EE  
Sbjct: 20  AILSVSDPDEISAKRIRKALQELFAVDLDGDKKDIKALILERFDLLRDRQSKVLSQEE-- 77

Query: 76  NLKMIRGNYDALLSSKSMEKKHKLTEXXXXXXXXXXXXXXXXXXXXXXXXVANPNSNAIN 135
                       L  +  E    L                            NPNS   +
Sbjct: 78  ------------LVQRDSEMAAALVRGDAGRAKRPRKRDADKPRKKRANQSDNPNS--FH 123

Query: 136 SMKLRLSDDLYKFLGERELPRTQVVKQVWDYIKEHNLQSPEDRREIICDDRMRPIFGDKM 195
              ++LS+ L + LGE +LPRTQVVK VWDYIK+H LQ+P+DRREI+CD  M P+FG KM
Sbjct: 124 MRPVQLSEPLQRLLGEEQLPRTQVVKAVWDYIKQHQLQNPDDRREILCDAAMEPVFGKKM 183

Query: 196 TMFALNKILSKHLT 209
           TMF++NKILS+HLT
Sbjct: 184 TMFSMNKILSQHLT 197

>KLLA0B13024g complement(1138572..1138946) some similarities with
           sp|Q05024 Saccharomyces cerevisiae YMR233w, hypothetical
           start
          Length = 124

 Score =  128 bits (322), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 70/83 (84%)

Query: 126 VANPNSNAINSMKLRLSDDLYKFLGERELPRTQVVKQVWDYIKEHNLQSPEDRREIICDD 185
           VAN N N+I+  K+ LS +L +FL   E+PRTQVVK VWDYIKEH+LQ+PEDRREIICDD
Sbjct: 22  VANDNPNSIHLKKVGLSPELQEFLKVEEMPRTQVVKSVWDYIKEHDLQNPEDRREIICDD 81

Query: 186 RMRPIFGDKMTMFALNKILSKHL 208
            M+PIFG+KMTMF LNKILSKHL
Sbjct: 82  AMKPIFGEKMTMFTLNKILSKHL 104

>Sklu_1837.2 YMR233W, Contig c1837 1803-2288 reverse complement
          Length = 161

 Score =  128 bits (322), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 68/79 (86%)

Query: 130 NSNAINSMKLRLSDDLYKFLGERELPRTQVVKQVWDYIKEHNLQSPEDRREIICDDRMRP 189
           N+N+I + K+ LS  L +FLGE ELPRTQVVK+VWDYIKEH+LQ+P DRREI+CDD M P
Sbjct: 44  NANSIQARKVLLSKKLEQFLGETELPRTQVVKKVWDYIKEHDLQNPNDRREILCDDAMEP 103

Query: 190 IFGDKMTMFALNKILSKHL 208
           IFG KMTMF++NKILSKHL
Sbjct: 104 IFGKKMTMFSMNKILSKHL 122

>YOR295W (UAF30) [5079] chr15 (869205..869891) Component of the
           Upstream Activation Factor (UAF) complex, involved in
           activation of RNA polymerase I [687 bp, 228 aa]
          Length = 228

 Score =  108 bits (271), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 65/212 (30%), Positives = 118/212 (55%), Gaps = 20/212 (9%)

Query: 6   DLNNYVSMLDAIISVSDPDKVSPKKIRKALEQLFSVSLENKKKEVNELIVARFQILQADP 65
           +LN+Y +M+D ++S  D + V+ KK+R AL++++++ +E++ K +N+LI     +++  P
Sbjct: 3   ELNDYSTMIDILLSDMDLETVTTKKVRMALKEVYAIDVESQGKAINKLIRKHLDLVKERP 62

Query: 66  HILVSNEEF--QNLKM-IRGNYDALLSSKSMEKKHKLTEXXXXXXXXXXXXXXXXXXXXX 122
               S E+   +N  + I    +  +S +S  ++   +E                     
Sbjct: 63  RFERSLEDLLKENATLAIELTKEITVSKRSSGEEKNDSETKGTHVEKKK----------- 111

Query: 123 XXXVANPNSNAINSMKLRLSDDLYKFLGERELPRTQVVKQVWDYIKEHNLQSPEDRREII 182
                  + + I++ K+ LS  L   LGE EL RT+VV+++W YIK HNLQ+P +++EI+
Sbjct: 112 ----GTVSKSPISTRKVTLSKSLASLLGEHELTRTEVVRRLWAYIKAHNLQNPNNKKEIL 167

Query: 183 CDDRMRPIFGDKMTMFALNKILSKHLTKIEPK 214
           CD+++  I G    MF ++KIL+ H+T  EPK
Sbjct: 168 CDEKLELILGKSTNMFEMHKILASHMT--EPK 197

>Kwal_55.20308
          Length = 78

 Score = 87.8 bits (216), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 49/57 (85%)

Query: 154 LPRTQVVKQVWDYIKEHNLQSPEDRREIICDDRMRPIFGDKMTMFALNKILSKHLTK 210
           + RTQ+VK+VW++IK++ LQ+P+DRREI CDD M+P+FG+K TMFALNK LS H+ K
Sbjct: 1   MARTQIVKKVWEHIKDNQLQNPDDRREIFCDDLMKPVFGEKTTMFALNKSLSNHILK 57

>Scas_324.1
          Length = 103

 Score = 77.4 bits (189), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 50/61 (81%)

Query: 7  LNNYVSMLDAIISVSDPDKVSPKKIRKALEQLFSVSLENKKKEVNELIVARFQILQADPH 66
          L+ YVSM+DAI+S S+PD+VSPKKIR+AL++LF+V L+ ++K VN+LI+ RF  LQ  P 
Sbjct: 6  LDRYVSMIDAILSASNPDEVSPKKIRRALQELFNVDLDAQRKAVNDLIIERFNALQDRPK 65

Query: 67 I 67
          +
Sbjct: 66 V 66

>Scas_665.26
          Length = 249

 Score = 79.0 bits (193), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 117/228 (51%), Gaps = 51/228 (22%)

Query: 9   NYVSMLDAIISVSDPDKVSPKKIRKALEQLFSVSLENKKKEVNELIVARFQILQADPHIL 68
           +Y+SM+DA+++ S  D  + K++R  L+++F++++E  + + N++I +R ++ Q    I+
Sbjct: 17  SYISMIDALLNSSFTDNPTVKELRMDLQEVFALNIEPLRGDFNDIIQSRIEMWQQRSKII 76

Query: 69  VSNE---EFQNLKMIR----------GNYDALLSSKSMEKKHKLTEXXXXXXXXXXXXXX 115
           + NE   E +N+ ++R           N D ++S +  +K+ K+                
Sbjct: 77  I-NEIDLEKENISLLRKFNEKLDRHSNNKDDIISPR--DKRQKVD--------------- 118

Query: 116 XXXXXXXXXXVANPNSNAINSMKLRLSDDLYKFLGERELPRTQVVKQVWDYIKEHNLQSP 175
                        P          ++S+ L  F GE EL +++++ ++WDYI+ H L+  
Sbjct: 119 -----------VEPT--------YKISEPLRGFFGETELTKSEIMNRIWDYIELHKLKRS 159

Query: 176 EDRREIICDDRMRPIFGDKMTMFALNKILSKHLTKIEPKSEEADNSRL 223
            +  EI+CDD++  +FG+ +    +  + SK+L +IE +  EAD S L
Sbjct: 160 NNSEEILCDDKLGLVFGEVVLAHKIPTMTSKYLERIESEL-EADASSL 206

>CAGL0G07557g 715354..716079 similar to tr|Q08747 Saccharomyces
           cerevisiae YOR295w, hypothetical start
          Length = 241

 Score = 69.3 bits (168), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 53/220 (24%), Positives = 102/220 (46%), Gaps = 43/220 (19%)

Query: 10  YVSMLDAIISVSDPDKVSPKKIRKALEQLFSVSLENKKKEVNELI---VARFQILQADPH 66
           Y SM+DA+++  D ++VS   +R  L ++FS+++++    +  L+   +  F+ +   P 
Sbjct: 10  YESMIDAVLTYCD-EEVSLNSLRAQLNEVFSLNIKSFDLNLRTLVDKKLEAFKNVTEKPK 68

Query: 67  I--------LVSNEEF-----QNLKMIRGNYDALLSSKSMEKKHKLTEXXXXXXXXXXXX 113
           +        +  N  +     Q LK      + +  +K  + K KL              
Sbjct: 69  VKDISTDKVMTENRRYINVIKQTLKEAELKKEGITVTKVQKPKLKL-------------- 114

Query: 114 XXXXXXXXXXXXVANPNSNAINSMKLRLSDDLYKFLGERELPRTQVVKQVWDYIKEHNLQ 173
                       V N   + I+ +K+ ++ +L   +G     RT++V+ +W YIKEHNLQ
Sbjct: 115 -----------KVTNSKKSMIH-IKMTVTPELQAVIGTHYQSRTEIVRNLWKYIKEHNLQ 162

Query: 174 SPEDRREIICDDRMRPIFGDKMTMFALNKILSKHLTKIEP 213
           +P+D+R+II D  + P+ G    +F +++ L  H+    P
Sbjct: 163 NPDDKRQIISDAMLEPVLGKTSDIFMMHRALKHHILGPAP 202

>CAGL0G08646g complement(814956..816533) some similarities with
           sp|P40473 Saccharomyces cerevisiae YIL122w, hypothetical
           start
          Length = 525

 Score = 28.1 bits (61), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 26/44 (59%)

Query: 33  KALEQLFSVSLENKKKEVNELIVARFQILQADPHILVSNEEFQN 76
           K LE+ FS+ +E ++KE+ +L     + L+      VSNE+F N
Sbjct: 140 KLLERFFSLHIEREQKEIEKLKTKNLEKLELIVDKFVSNEKFTN 183

>KLLA0F00770g 65967..67853 weakly similar to sgd|S0005721
           Saccharomyces cerevisiae YOR195w SLK19 involved in
           control of spindle dynamics together with KAR3P,
           hypothetical start
          Length = 628

 Score = 28.1 bits (61), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 48/84 (57%), Gaps = 10/84 (11%)

Query: 3   QNIDLNNYVSMLDAIISVSDPDKVSPKKIRKALEQLFSVSLENKKKEVNELIVARFQILQ 62
           +NIDL   ++  +  ++ S+ D++  K I+K LE++ + S    + E N+    + Q+L 
Sbjct: 512 ENIDLKARLTQTETNVNKSETDELRAK-IQK-LEKMVADS----EAETNK----KLQLLA 561

Query: 63  ADPHILVSNEEFQNLKMIRGNYDA 86
            D +I  S++  Q +KM++  Y+A
Sbjct: 562 EDLYIQYSSKHEQKVKMLKKGYEA 585

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.132    0.358 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,705,114
Number of extensions: 251936
Number of successful extensions: 768
Number of sequences better than 10.0: 30
Number of HSP's gapped: 767
Number of HSP's successfully gapped: 34
Length of query: 230
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 132
Effective length of database: 13,203,545
Effective search space: 1742867940
Effective search space used: 1742867940
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 60 (27.7 bits)