Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M04917g58657730520.0
ABL013C6985303041e-28
Kwal_55.203146576102711e-24
KLLA0B13068g6716392362e-20
YMR232W (FUS2)6771702061e-16
Scas_594.16513711755e-13
Sklu_2189.41526141760.49
Kwal_56.2374754168730.82
AEL209W470161701.7
CAGL0F07975g77077683.3
Sklu_2133.328030673.4
KLLA0F13178g662167674.8
Kwal_47.18192130751666.3
ADR012C131960667.6
KLLA0E22660g80660649.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M04917g
         (577 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M04917g 537760..539520 weakly similar to sp|Q05670 Saccharo...  1180   0.0  
ABL013C [579] [Homologous to ScYMR232W (FUS2) - SH] (372925..375...   121   1e-28
Kwal_55.20314                                                         108   1e-24
KLLA0B13068g complement(1140423..1142438) weakly similar to sp|Q...    96   2e-20
YMR232W (FUS2) [4188] chr13 (736925..738958) Protein required fo...    84   1e-16
Scas_594.1                                                             72   5e-13
Sklu_2189.4 YLR310C, Contig c2189 8340-12920                           34   0.49 
Kwal_56.23747                                                          33   0.82 
AEL209W [2297] [Homologous to ScYHR161C (YAP1801) - SH; ScYGR241...    32   1.7  
CAGL0F07975g complement(782229..784541) similar to sp|P50089 Sac...    31   3.3  
Sklu_2133.3 YGL111W, Contig c2133 5312-6149 reverse complement         30   3.4  
KLLA0F13178g 1215760..1217748 weakly similar to sgd|S0002629 Sac...    30   4.8  
Kwal_47.18192                                                          30   6.3  
ADR012C [1753] [Homologous to ScYER008C (SEC3) - SH] (725113..72...    30   7.6  
KLLA0E22660g 2011000..2013420 similar to sp|P40985 Saccharomyces...    29   9.8  

>CAGL0M04917g 537760..539520 weakly similar to sp|Q05670
           Saccharomyces cerevisiae YMR232w FUS2 required for cell
           fusion during mating, hypothetical start
          Length = 586

 Score = 1180 bits (3052), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 577/577 (100%), Positives = 577/577 (100%)

Query: 1   MYEQFQMISKNSLTPIRDYNNDFFHANDSKLPNLTRVKDGYGGARASYSDSIGGDLDTMD 60
           MYEQFQMISKNSLTPIRDYNNDFFHANDSKLPNLTRVKDGYGGARASYSDSIGGDLDTMD
Sbjct: 1   MYEQFQMISKNSLTPIRDYNNDFFHANDSKLPNLTRVKDGYGGARASYSDSIGGDLDTMD 60

Query: 61  NKIDDRVKKSSNSSVLTDMKNINLREMLKKFIFSEEKYIEMTEKALTSYRFNMQNKKMRS 120
           NKIDDRVKKSSNSSVLTDMKNINLREMLKKFIFSEEKYIEMTEKALTSYRFNMQNKKMRS
Sbjct: 61  NKIDDRVKKSSNSSVLTDMKNINLREMLKKFIFSEEKYIEMTEKALTSYRFNMQNKKMRS 120

Query: 121 KKIFDPNSKEDVILFGNLETICAVSYLYLNSLSKIVTKLELNPSSIDVIYDELVELHVTL 180
           KKIFDPNSKEDVILFGNLETICAVSYLYLNSLSKIVTKLELNPSSIDVIYDELVELHVTL
Sbjct: 121 KKIFDPNSKEDVILFGNLETICAVSYLYLNSLSKIVTKLELNPSSIDVIYDELVELHVTL 180

Query: 181 FNRMKQPYTSYIIAYQNQTHLVKILENSTSKIVASWYHRSYDDARQIKLSEILQCPYKHV 240
           FNRMKQPYTSYIIAYQNQTHLVKILENSTSKIVASWYHRSYDDARQIKLSEILQCPYKHV
Sbjct: 181 FNRMKQPYTSYIIAYQNQTHLVKILENSTSKIVASWYHRSYDDARQIKLSEILQCPYKHV 240

Query: 241 HDWLENIKILKEWLVVGTSVEEFQKLIETFTDYISHLNIDNEDNVRSSQHRHPISSIQIS 300
           HDWLENIKILKEWLVVGTSVEEFQKLIETFTDYISHLNIDNEDNVRSSQHRHPISSIQIS
Sbjct: 241 HDWLENIKILKEWLVVGTSVEEFQKLIETFTDYISHLNIDNEDNVRSSQHRHPISSIQIS 300

Query: 301 KSSDLNPESSGPSDDGNFVAYIPSVASSVYTEVIKPRMSPKISLDEKPCNADSNHALMLL 360
           KSSDLNPESSGPSDDGNFVAYIPSVASSVYTEVIKPRMSPKISLDEKPCNADSNHALMLL
Sbjct: 301 KSSDLNPESSGPSDDGNFVAYIPSVASSVYTEVIKPRMSPKISLDEKPCNADSNHALMLL 360

Query: 361 VRLFKEKLYHLTQLRKLLVKHDITNLADNFIMQIHSWTSLLSIEKDSVFQNIHEQLNNKI 420
           VRLFKEKLYHLTQLRKLLVKHDITNLADNFIMQIHSWTSLLSIEKDSVFQNIHEQLNNKI
Sbjct: 361 VRLFKEKLYHLTQLRKLLVKHDITNLADNFIMQIHSWTSLLSIEKDSVFQNIHEQLNNKI 420

Query: 421 NLCVKLYKEKKEELGAFKFLKLESFIIKKLETVLALMKTVKGYINDLKVLHKDYLIFKKE 480
           NLCVKLYKEKKEELGAFKFLKLESFIIKKLETVLALMKTVKGYINDLKVLHKDYLIFKKE
Sbjct: 421 NLCVKLYKEKKEELGAFKFLKLESFIIKKLETVLALMKTVKGYINDLKVLHKDYLIFKKE 480

Query: 481 KQMKLQDIKRTLLGTHYEQIQNKLVEQLPRFLTYINQFMVLFLLSFNAYLRDALDILISV 540
           KQMKLQDIKRTLLGTHYEQIQNKLVEQLPRFLTYINQFMVLFLLSFNAYLRDALDILISV
Sbjct: 481 KQMKLQDIKRTLLGTHYEQIQNKLVEQLPRFLTYINQFMVLFLLSFNAYLRDALDILISV 540

Query: 541 QADLLHTEEGVNEIEKDYDKRRNVMKKTVNSHYEKSN 577
           QADLLHTEEGVNEIEKDYDKRRNVMKKTVNSHYEKSN
Sbjct: 541 QADLLHTEEGVNEIEKDYDKRRNVMKKTVNSHYEKSN 577

>ABL013C [579] [Homologous to ScYMR232W (FUS2) - SH]
           (372925..375021) [2097 bp, 698 aa]
          Length = 698

 Score =  121 bits (304), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 126/530 (23%), Positives = 246/530 (46%), Gaps = 70/530 (13%)

Query: 77  TDMKNINLREMLKKFIFSEEKYIEMTEKALTSYRFNMQNKKMRSKKIFDPNSKEDVILFG 136
            D K +N  +++K+ + +E +YI+  E   + YRF +Q KK+ S  + D    ++++LFG
Sbjct: 154 VDPKLLNTLDVVKRLVQTEREYIKKLELGNSVYRFELQAKKVGSM-LLDKERNDELLLFG 212

Query: 137 NLETICAVSYLYLNSLS---------------KIVTKLELNPSSIDVIYDEL-----VEL 176
           +LET+ +VS + +  L                +I+ +L ++P  +    + L     +E 
Sbjct: 213 DLETLASVSKILVKQLEEKIAEAYGGDKGDSDQILKELRVHPDKLRAFIERLDIGTVLEH 272

Query: 177 HVTLFNRMKQPYTSYIIAYQNQTHLVKILENSTSKIVASWYHRSYDDARQIKLSEILQCP 236
           H   F R+K  Y +Y + +Q Q  L++ +    S I   WY R    A  IKL +IL+ P
Sbjct: 273 H---FERIKYLYLTYSVNHQKQLELLQQIRRKHSTIYFKWYDRCLQKADLIKLEDILKLP 329

Query: 237 YKHVHDW---LENIKILKEWLVVGTSVEEFQKLIETFTDYISHLNIDNED---NVRSSQH 290
            + +  W    E + +  E +    +  +     + +  Y+  ++    +     +++  
Sbjct: 330 VERLRTWGAITEQVLLYTEGISSDLATAQLSDFYDQYCVYLRGVSTSERECNCEAKANLE 389

Query: 291 RHPISSIQISKSSDLNPESSG----PSDDGNFVAYIPSVASSVYTEVIKPRMSP--KISL 344
             P   I   + S ++PE S          +    + +  SS Y+E   P + P  KIS 
Sbjct: 390 LTPTQIIHFYECS-VDPEVSAIDIKRKKSQSTALSVNTGTSSAYSE---PNVLPSNKISD 445

Query: 345 DEKPCNADSNHALM--LLVRLFKEKLYHLTQLRKLLVKHDITNLADNFIMQI---HSWTS 399
            + P   DS++A +   + + F  +      L+ LLV+ +  +LA+    Q+    +W  
Sbjct: 446 CKSP---DSDYADLDRSICQFFSVR----KGLQDLLVELEQLDLAEIICQQLANAKTWHR 498

Query: 400 LLSIEKDSVFQNIHEQLNNKINLC------VKLYKEKKEELGAFKFLKLESFIIKKLETV 453
           L+       F+  +E  NN I +       +     ++EE+   +   L+  +I  L  +
Sbjct: 499 LMD------FEPHNENCNNSIYISSIYTAFIDKLNHQREEISVLRVKHLKKGVIDPLLVL 552

Query: 454 LALMKTVKGYINDLKVLHKDYLIFKKEKQMKLQDIKRTLLGTHYEQIQNKLVEQLPRFLT 513
           LA   +V+G I+DLKVL K+Y  + K++     DIK+ ++   +E  Q  L ++LP+F+ 
Sbjct: 553 LARTDSVRGKIDDLKVLSKEYKAYMKQRDY--HDIKKKVMAQSFEDAQALLAKELPQFMA 610

Query: 514 YINQFMVLFLLSFNAYLRDALDILIS----VQADLLHTEEGVNEIEKDYD 559
           ++++ +   LL +++ + + L IL      ++ +L   EE   E+  ++D
Sbjct: 611 FMHKSISYLLLRYHSLVLEYLKILCGGEKLLKKELTFFEESERELGDNFD 660

>Kwal_55.20314
          Length = 657

 Score =  108 bits (271), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 142/610 (23%), Positives = 253/610 (41%), Gaps = 112/610 (18%)

Query: 9   SKNSLTPIRDYNNDFFHAND---------SKLP--------NLTRVKDGYGG-------- 43
           +K+ LTPIRD   DFF             S++P        ++   +DGY          
Sbjct: 15  AKSVLTPIRDSGQDFFVTKGNAGKFGQFGSRIPEDFNPYAKSMWTTEDGYKNNAQKLKKI 74

Query: 44  -----ARASYSDSIGGDL--------DTMDNKIDDRVKKSSNSSVLTDMKNINLREMLKK 90
                 + S+ ++   +L        + +D K+    K S  SS  TD     L      
Sbjct: 75  TSMRRDKVSFQEADSKELIASNLSPTEPLDLKLQKETK-SQLSSEFTDKGKAFLTSFYS- 132

Query: 91  FIFSEEKYIEMTEKALTSYRFNMQNKKMRSKKIFDPNSKEDVILFGNLETICAVSYLYLN 150
           F+  EE Y   T+     YR  + + K +  ++ D NS ++++LFGN++TI  +S + + 
Sbjct: 133 FLKREEDYAYFTDSLNMVYRKELHDHKSK-HRLIDRNSNDEILLFGNMDTISQLSRILVK 191

Query: 151 SL----------SKIVTKLELNPSSIDVI--YDELVE---LHVTLFNRMKQPYTSYIIAY 195
           SL            I+ + +   S ++V   +++L +     ++  N+++  Y++YI++ 
Sbjct: 192 SLKNYMKACCDTGNILFQWDGYDSHMNVTDKFEDLFDPSDFLISHLNKIRSTYSTYILSR 251

Query: 196 QNQTHLVKILENSTSKIVASWYHRSYDDARQIKLSEILQCPYKHVHDWLENIKILKEWLV 255
           Q Q  L+  L    S     WY      A   +L +IL+ P K +HD+ +++      L 
Sbjct: 252 QKQLQLICELRKLKSAAYYKWYETCLKKADFNRLEDILEAPMKRIHDFYDDL------LD 305

Query: 256 VGTSVEEF-------------QKLIETFTDYISHLNIDNEDNVRSSQHRHPISSIQISKS 302
           V T  E F              + +E F+D   HL   N           P S  ++SK 
Sbjct: 306 VSTHAEGFISPEACGKIKSFLNRYLE-FSDECQHLLGSN----------IPKSEGKLSKP 354

Query: 303 SDLNPESSG----PSDDGNFVAYIPSVASSVYT-------EVIKPRMSPKIS----LDEK 347
             L+P S      P+ D +  +     + S          E+ + + +P  S      E 
Sbjct: 355 --LSPHSDAHLTVPASDTSCRSSDSRYSLSSSRYSDHSSFELSRKQSAPSSSSTDIQKEN 412

Query: 348 PCNADSNHALMLLVRLFKEKLYHLTQLRKLLVKHDITNLADNFIMQIHSWTSLLSIEKDS 407
           P  AD        +R FK    H  +L K L K D+  + D  + Q   W ++   E  S
Sbjct: 413 PTLADC-------IRRFKLVESHAIKLEKELTKLDLAAILDENLRQAEEWRNIFEFEPLS 465

Query: 408 VFQNIHEQLNNKINLCVKLYKEKKEELGAFKFLKLESFIIKKLETVLALMKTVKGYINDL 467
                H  + +   + +    ++++E+   K   L+  ++  L  ++   K V   I DL
Sbjct: 466 DLLTEHTNVESIYTIYIDKIHQQRQEVMLIKLGDLQEKVLSPLRHIIQCCKAVHVKIQDL 525

Query: 468 KVLHKDYLIFKKEKQMKLQDIKRTLLGTHYEQIQNKLVEQLPRFLTYINQFMVLFLLSFN 527
           K L KDY+ F + K  +  ++K  ++  H+  +Q +L+ +LP FL   +QF +  +  +N
Sbjct: 526 KYLKKDYMAFLQAKDTR--NVKMEIVVKHFLSLQGELLSELPTFLHLTSQFTIYLISFYN 583

Query: 528 AYLRDALDIL 537
             + D L +L
Sbjct: 584 RIMLDYLRVL 593

>KLLA0B13068g complement(1140423..1142438) weakly similar to
           sp|Q05670 Saccharomyces cerevisiae YMR232w FUS2 required
           for cell fusion during mating singleton, start by
           similarity
          Length = 671

 Score = 95.5 bits (236), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 136/639 (21%), Positives = 284/639 (44%), Gaps = 84/639 (13%)

Query: 9   SKNSLTPIRD------------------YNNDFFHANDSKLPNLTRVKDGYGGARASYSD 50
           S NS+TPIR                   Y+N  ++ ++     L R+K+     R +  D
Sbjct: 15  SNNSVTPIRTCREDKYVLPNFYQTNHNPYSNSLWNTSEENREALKRIKESAASKR-TRED 73

Query: 51  SIGGDLDTM----DNKIDDRVKKSSNS-------------SVLTDMKNINLREMLKKFIF 93
               DL+      +++ + + KK+ +              S   D K ++  + L+K + 
Sbjct: 74  DCSDDLEKQSIIWESEQEPQSKKTYSPLDVETFSQKMNLDSARPDSKTLSFIQTLQKLLE 133

Query: 94  SEEKYIEMTEKALTSYRFN-MQNKKMRSKKIFDPNSKEDVILFGNLETICAVSYLYLNSL 152
           SE++Y EM    L++Y+     NKK R+K + +  S ++++LFGNL+T+  +S L+  +L
Sbjct: 134 SEQQYFEMLSLCLSTYKEEACHNKKFRNK-LLNRASNDELLLFGNLDTMAELSKLFCKNL 192

Query: 153 SKIVTKLELNPSS----------------IDVIYDELVELHVTLFNRMKQPYTSYIIAYQ 196
           S+ +   +    S                +D  +  L++ H+   +R+K PY SY I ++
Sbjct: 193 SECLKVTDAGTQSRIWKEIKGSDKLCQIILDTDFSTLIKSHL---HRIKSPYHSYCICHE 249

Query: 197 NQTHLVKILENSTSKIVASWYHRSYDDARQIKLSEILQCPYKHVHDW---LENIKILKEW 253
            +   +  ++   ++    WY      ++  KL ++L+ P + +  W    EN+ +  + 
Sbjct: 250 ERKRFLDSIKLQNTETFYKWYELCLKKSQFEKLEDLLELPLERLGQWGSLFENLCLFGDN 309

Query: 254 LVVGTSVEEFQKLIETFTDYISHLNIDNEDNVRSSQHRHPI----SSIQISKSSD----- 304
           L+   S E   ++     +YIS+L   N++   S + +  I    +++   K +D     
Sbjct: 310 LL---SPERSVQMNAISKEYISYLRDLNDELNNSGRAKESILGEENAVTQEKENDNISSK 366

Query: 305 -LNPESSGPSDDGNFVAYIPSVASSVYTEVIKPRMSPKI-------SLDEKP-CNADSNH 355
             +   S  S   +F + IPS  + V  EV +   +  +       S++EK     +S++
Sbjct: 367 SGSRGGSQISKSSSFYSDIPSF-TRVEEEVPQGEPTGAVLHNSHLNSIEEKEESKFNSSN 425

Query: 356 ALMLLVRLFKEKLYHLTQLRKLLVKHDITNLADNFIMQIHSWTSLLSIEKDSVFQNIHEQ 415
           +L   ++ F     +L +  K L K ++  + D  +    +W +L+  E  +   +  + 
Sbjct: 426 SLKDCIKEFNNIYANLQKWDKALCKLELAKVLDRTLTIAITWKNLIEFEPPNEMFHSGDN 485

Query: 416 LNNKINLCVKLYKEKKEELGAFKFLKLESFIIKKLETVLALMKTVKGYINDLKVLHKDYL 475
                   V+   ++++++   +   L   +IK L+ +L    TVK  + D   L K+Y+
Sbjct: 486 ERTIYGTYVEKIDKQRQQVMILQLQDLRRKVIKPLQHLLQRFATVKQKLADRNSLKKEYM 545

Query: 476 IFKKEKQMKLQDIKRTLLGTHYEQIQNKLVEQLPRFLTYINQFMVLFLLSFNAYLRDALD 535
            + +++  +  D K+ +L   ++ +Q++L E LP F  Y  + + L +  +   + + + 
Sbjct: 546 AYLRQRDTETHDAKKQILANSFQDLQHQLAESLPIFNEYAREAITLLVSQYTLLMMEYMQ 605

Query: 536 ILISVQADLLHTE-EGVNEIEKDYDKRRNVMKKTVNSHY 573
           I IS     L+ E E VN  ++D     ++++   +S Y
Sbjct: 606 I-ISGGDQFLNKELELVNSGQRDLGDNFDILQLFCSSRY 643

>YMR232W (FUS2) [4188] chr13 (736925..738958) Protein required for
           cell fusion during mating, localizes to dots beneath the
           tip of mating projection (shmoo) [2034 bp, 677 aa]
          Length = 677

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 96/170 (56%), Gaps = 9/170 (5%)

Query: 382 DITNLADNFIMQIHSWTSLLSIEKDSVFQNIHEQLNNKINLC---VKLYKEKKEELGAFK 438
           D++ + D  + +I++W  ++  E+ S     H+ L +   +C   +    E+K ++   K
Sbjct: 454 DLSGIIDISLRRINAWKKVIECERPSGAFFAHDNLIS--TMCSSYIDKLHEQKNQVTILK 511

Query: 439 FLKLESFIIKKLETVLALMKTVKGYINDLKVLHKDYLIFKKEKQMKLQDIKRTLLGTHYE 498
             +LE+ ++  LE ++A   TVK  + DL+ L KDY++F +EK+  ++DIKR LLG H++
Sbjct: 512 LTELETDVMNPLERIIAHCTTVKSKLKDLQALKKDYMLFLQEKKANVRDIKRDLLGMHFQ 571

Query: 499 QIQNKLVEQLPRFLTYINQFMVLFLLSFNAYLRDALDILIS----VQADL 544
            +QN++  +LP F+T I+  +   LL++       L+I+      +Q DL
Sbjct: 572 NLQNQMKRELPVFITLIHDTIECILLNYIKVFLKYLEIIAGGKKYLQKDL 621

>Scas_594.1
          Length = 651

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 80/371 (21%), Positives = 156/371 (42%), Gaps = 44/371 (11%)

Query: 210 SKIVASWYHRSYDDARQIKLSEILQCPYKHVHDWLENIKILKEWLVVGTSVEEFQKLIET 269
           S +  +WY          KL +I + P   V++W+  +  L       T    +++LIET
Sbjct: 2   SDLFNAWYESXLKIGNLQKLEDIFKRPINRVNEWILILNDLISASKEATHTSNYERLIET 61

Query: 270 ---FTDYISHLNIDNEDNVRSSQHRHPISSIQISKSSDLNPESSGPSDDGNFVAYIP--- 323
              + D+  H+    ++   ++ +   ++  +I +S D N   S   D    V Y P   
Sbjct: 62  RNRYKDFQKHIREQADEYNGNTMYNFSLTPNEIIQSYD-NAICSPKHDQPQVVVYPPLND 120

Query: 324 ------SVASSVYTEVIKPRMSPKI-------------------SLDEKPCNADSNHALM 358
                 S A++ Y  +   R                        S  E  C         
Sbjct: 121 AIPYTDSFAANTYGSLQSRRSLSVASTSSSHYSSNNGSVDLKDHSNKENICKDSVFQPPQ 180

Query: 359 LLVRLFKEKLYHLTQLRKLLVKHDITNLADNFIMQIH-----SWTSLLSIEKDSVFQNIH 413
           L +     K  H+ +  K+LV   I NL  + ++  +     +W  +L       F + H
Sbjct: 181 LTLNDHIHKFKHIHKKLKILVGL-IGNLDFHAVLDFNLRLGKTWKKMLD------FDHPH 233

Query: 414 EQLNNKINLCVKLYKEKKEELGAFKFLKLESFIIKKLETVLALMKTVKGYINDLKVLHKD 473
           +  + K +  +    + KE+    K   LE+ ++  L  +    + VK  + DLK L KD
Sbjct: 234 DSHDTKYSRYMDTILKLKEQETILKLTDLETTVLLPLARMGKYCEVVKLRLKDLKSLKKD 293

Query: 474 YLIFKKEKQMKLQDIKRTLLGTHYEQIQNKLVEQLPRFLTYINQFMVLFLLSFNAYLRDA 533
           Y+I+ +E++ K+ D+KR ++G H+E +Q +L ++LP F+   ++   + +++++  +   
Sbjct: 294 YMIYLQERKTKIHDVKRDVIGKHFENMQRQLTDELPIFIDLFHRIFEVVVINYSQVMLKY 353

Query: 534 LDILISVQADL 544
           L+ +   +ADL
Sbjct: 354 LETMSGGEADL 364

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 78/161 (48%), Gaps = 22/161 (13%)

Query: 1   MYEQFQMISKNSLTPIRDYNNDFFHANDSKLPNLTR-------------VKDG---YGGA 44
           +++     + +SLTPIRDY ND+FH +D+KLPN+TR             +KD    Y   
Sbjct: 429 LFDDLHYPATDSLTPIRDYKNDYFHRDDNKLPNVTRFPVLNNSTKISSHLKDTTNFYENI 488

Query: 45  RASYSDSIGGDLDTMDNKID-----DRVKKSSNSSVLT-DMKNINLREMLKKFIFSEEKY 98
           +   S  +    + ++ K+      DR +K       T +   + L +++++   SE +Y
Sbjct: 489 KRPASLDLSEIGEPLNKKLYSPLNLDRFQKVVQLETPTNEGTTVPLLDIIRRLYESELEY 548

Query: 99  IEMTEKALTSYRFNMQNKKMRSKKIFDPNSKEDVILFGNLE 139
            E    A ++YR  +        K+   +S E+++LFGNL+
Sbjct: 549 AEFLTIADSAYRKTLHEITTFRDKLLRKDSNEELLLFGNLD 589

>Sklu_2189.4 YLR310C, Contig c2189 8340-12920
          Length = 1526

 Score = 33.9 bits (76), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 65/141 (46%), Gaps = 23/141 (16%)

Query: 379 VKHDITNLADNFIMQIHSWTSLLSIEKDSVFQNIHEQLNNKINLCVKLYKEKKEELGAFK 438
           +K  + ++A   IM +      L+++   VF  I ++     ++C   Y ++++EL  ++
Sbjct: 876 IKQALHDIAIRQIMDVQG----LTLDDPFVFCAIRDE-----SVC---YFDREDELSKYQ 923

Query: 439 FLKLESFIIKKLETVLALMKTVKGYINDLKVLHKDYLIFKKEKQMKLQDIKRTLLGTHYE 498
           FLK E F     E +  L+ +     NDL  L  D L+  +E   K  DI  T+L     
Sbjct: 924 FLKQEKFA----EELRNLLISQDVEYNDLAFLDADQLV--REAFAKFSDIGNTML----- 972

Query: 499 QIQNKLVEQLPRFLTYINQFM 519
           Q   +L+E+    L Y  + M
Sbjct: 973 QNVEQLIEERENILNYAARMM 993

>Kwal_56.23747
          Length = 541

 Score = 32.7 bits (73), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 5/68 (7%)

Query: 371 LTQLRKLLVKHDITNLADNFIMQIHSWTSLLSIEKDSVFQNIHEQLNNKINL-CVK---- 425
           LT++R   +K  I   AD F +       +L  EK++VF N  +Q N  +++ C+K    
Sbjct: 6   LTKVRNRFLKPVIKPDADKFTIVTEGKAHILFPEKETVFYNPIQQFNRDLSVSCIKAWDN 65

Query: 426 LYKEKKEE 433
           LY + K+E
Sbjct: 66  LYGQPKQE 73

>AEL209W [2297] [Homologous to ScYHR161C (YAP1801) - SH; ScYGR241C
           (YAP1802) - SH] complement(239062..240474) [1413 bp, 470
           aa]
          Length = 470

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 63/161 (39%), Gaps = 14/161 (8%)

Query: 111 FNMQNKKMRSKKIFDPNSKEDVILFGNLETICAVSYLYLNSLSKIVTKLEL--NPSSIDV 168
           F    KK    K+  P  K    +   +ET           L +I+  L++    S+  V
Sbjct: 4   FQAVVKKATKIKMAAPKQKYLKTILAGMETPAV--------LEEIMRALQVRVGDSAFTV 55

Query: 169 IYDELVELHVTLFNRMKQPYTSYIIAYQNQTHLVKILENSTSKIVASWYHRSYDDARQIK 228
           +Y  LV +HV +    K    +Y+ A ++   L  +L+   +        R Y D  + +
Sbjct: 56  VYKALVVVHVMMREGAKHVTLAYLAARRDFFELRGLLQGGAAAHSGVHLVRRYVDYLRTR 115

Query: 229 LSEI--LQCPYKHVHDWLENIKILKEWLVVGTSVEEFQKLI 267
            +E   L+C Y  V D    +K L    VV   VE  +  I
Sbjct: 116 AAEYGRLECDY--VRDGAARLKELGRSTVVLQHVESLETQI 154

>CAGL0F07975g complement(782229..784541) similar to sp|P50089
           Saccharomyces cerevisiae YGR237c, start by similarity
          Length = 770

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 34/77 (44%), Gaps = 7/77 (9%)

Query: 242 DW-LENIKILKEWLVVGTSVEEFQKLIETFTDY------ISHLNIDNEDNVRSSQHRHPI 294
           DW +EN+    + LV+ + V EF+K +ET  +       +   N D  D +      H +
Sbjct: 333 DWYIENVAADGDHLVIVSRVPEFEKELETLCNQEKRKSKLQQRNSDRSDRISVYSESHTL 392

Query: 295 SSIQISKSSDLNPESSG 311
           SS   S    + P + G
Sbjct: 393 SSTPSSDPDAVTPSTIG 409

>Sklu_2133.3 YGL111W, Contig c2133 5312-6149 reverse complement
          Length = 280

 Score = 30.4 bits (67), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 20/30 (66%)

Query: 180 LFNRMKQPYTSYIIAYQNQTHLVKILENST 209
           L++  K PY  Y+ AY  + +LVK++E ST
Sbjct: 183 LYDLSKGPYQKYLFAYGGEENLVKLVELST 212

>KLLA0F13178g 1215760..1217748 weakly similar to sgd|S0002629
           Saccharomyces cerevisiae YDR221w, start by similarity
          Length = 662

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 73/167 (43%), Gaps = 29/167 (17%)

Query: 371 LTQLRKLLVKH----DITNLADNFIMQIHSWTSLLSIEKDSVFQNIHEQLNN-KINLCVK 425
           +T L+KL  K     D  N A+N   QI   T+  S++  +   N+ E L + + +   K
Sbjct: 143 VTALKKLKSKTKDNTDDPNSAENVHFQIDGLTTY-SVDLKTALNNVEENLQSLEESYRCK 201

Query: 426 LYKEKKEELGAFKFLKLE-SFIIKKLETVLALMKTVKGYINDLKVLHK-----------D 473
           L++E  +    F++  L  +FI   + +V +  + +    N+LK +             D
Sbjct: 202 LFEESPQ---LFEYENLNVTFITDSVVSVFSHAQMLSNAFNELKFILNNLYETYNRKLND 258

Query: 474 YLIFKKEKQMKLQDIK--------RTLLGTHYEQIQNKLVEQLPRFL 512
            ++ K  KQ    ++K          L GT  +QI   L E+LP FL
Sbjct: 259 KVVIKNMKQFAELEMKFKKSFQPDGRLDGTQRDQINEYLNEELPTFL 305

>Kwal_47.18192
          Length = 1307

 Score = 30.0 bits (66), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 3/51 (5%)

Query: 293 PISSIQISKSSDLNPESSG-PSDDGNFVAYIPSVASSV--YTEVIKPRMSP 340
           PI+S+ + K S  NP   G P+ + N +A + S    +  Y  V++P + P
Sbjct: 466 PITSLAVGKVSSANPNIEGLPNPNRNEIALVSSSGHGIGAYINVMEPSVPP 516

>ADR012C [1753] [Homologous to ScYER008C (SEC3) - SH]
           (725113..729072) [3960 bp, 1319 aa]
          Length = 1319

 Score = 30.0 bits (66), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 27/60 (45%), Gaps = 10/60 (16%)

Query: 289 QHRHPISSIQISKSSDLNPESSGPSDDGNFVAYIPSVASSVYTEVIKPRMSPKISLDEKP 348
           Q  HP SS            + G SD GN    IP   SSV ++V K  +SP + L+  P
Sbjct: 401 QGSHPYSSFY----------ARGRSDSGNKTLRIPHSPSSVRSDVSKTGISPVMPLNVSP 450

>KLLA0E22660g 2011000..2013420 similar to sp|P40985 Saccharomyces
           cerevisiae YJR036c HUL4 hect domain E3 ubiquitin-protein
           ligase, hypothetical start
          Length = 806

 Score = 29.3 bits (64), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 34/60 (56%), Gaps = 8/60 (13%)

Query: 414 EQLNNKINLCVKLYKEKK-------EELGAFKFLKLESFIIKKLETVLALMKTVKGYIND 466
           EQL+N +  C++ YK+ +       +EL ++ F+ +E +I++K  T  AL +  K  + D
Sbjct: 83  EQLSNIVGQCLESYKKDQTGDETPAKELNSY-FIPVEKYIVQKFGTAEALNQLFKPTVKD 141

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.133    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,841,269
Number of extensions: 928623
Number of successful extensions: 3984
Number of sequences better than 10.0: 74
Number of HSP's gapped: 4094
Number of HSP's successfully gapped: 75
Length of query: 577
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 470
Effective length of database: 12,891,983
Effective search space: 6059232010
Effective search space used: 6059232010
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)