Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M04895g1036102050960.0
Scas_594.21029102721990.0
YMR231W (PEP5)1029102821840.0
KLLA0B13090g1021102719480.0
ABL012C1020102518480.0
Kwal_55.2031889990216040.0
CAGL0A03432g115151910.016
YAL002W (VPS8)127444830.14
Sklu_2412.7112776820.17
AFR220W108560800.26
YLR032W (RAD5)116978790.43
Scas_700.4787397760.86
Sklu_2433.1791454751.2
CAGL0A00781g120648741.6
CAGL0M04653g95974731.7
CAGL0B02695g42949731.8
YDR255C (RMD5)42149703.3
Scas_670.26130534703.9
Kwal_26.803066055704.1
KLLA0D17182g92424695.2
Scas_721.100113749687.2
Scas_600.10968105688.2
Scas_654.1*1668101688.7
AEL207W62686679.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M04895g
         (1020 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M04895g 534252..537362 similar to sp|P12868 Saccharomyces c...  1967   0.0  
Scas_594.2                                                            851   0.0  
YMR231W (PEP5) [4187] chr13 (733544..736633) Vacuolar peripheral...   845   0.0  
KLLA0B13090g complement(1142698..1145763) similar to sp|P12868 S...   754   0.0  
ABL012C [580] [Homologous to ScYMR231W (PEP5) - SH] (375053..378...   716   0.0  
Kwal_55.20318                                                         622   0.0  
CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces c...    40   0.016
YAL002W (VPS8) [64] chr1 (143711..147535) Protein involved in va...    37   0.14 
Sklu_2412.7 YLR032W, Contig c2412 15481-18864                          36   0.17 
AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH] complement(...    35   0.26 
YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded DNA...    35   0.43 
Scas_700.47                                                            34   0.86 
Sklu_2433.17 YFR040W, Contig c2433 26349-29093 reverse complement      33   1.2  
CAGL0A00781g 77746..81366 similar to sp|P39702 Saccharomyces cer...    33   1.6  
CAGL0M04653g 505982..508861 similar to sp|P27801 Saccharomyces c...    33   1.7  
CAGL0B02695g complement(256863..258152) similar to tr|Q12508 Sac...    33   1.8  
YDR255C (RMD5) [1088] chr4 complement(966549..967814) Protein po...    32   3.3  
Scas_670.26                                                            32   3.9  
Kwal_26.8030                                                           32   4.1  
KLLA0D17182g 1456620..1459394 similar to sp|P27801 Saccharomyces...    31   5.2  
Scas_721.100                                                           31   7.2  
Scas_600.10                                                            31   8.2  
Scas_654.1*                                                            31   8.7  
AEL207W [2299] [Homologous to ScYNL299W (TRF5) - SH; ScYOL115W (...    30   9.2  

>CAGL0M04895g 534252..537362 similar to sp|P12868 Saccharomyces
            cerevisiae YMR231w PEP5, start by similarity
          Length = 1036

 Score = 1967 bits (5096), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 981/1020 (96%), Positives = 981/1020 (96%)

Query: 1    MSLESWRHFQFYDNLPIPDPLLGNDIRLYSDPTLSAAATVNEDLFFIAVRSNYIRHFSLK 60
            MSLESWRHFQFYDNLPIPDPLLGNDIRLYSDPTLSAAATVNEDLFFIAVRSNYIRHFSLK
Sbjct: 1    MSLESWRHFQFYDNLPIPDPLLGNDIRLYSDPTLSAAATVNEDLFFIAVRSNYIRHFSLK 60

Query: 61   KAEIIKEFKAFADGFQISYLMVVGQSFLLAVGEKVNYPSQLKLFKINDLPTNEFHYHSLV 120
            KAEIIKEFKAFADGFQISYLMVVGQSFLLAVGEKVNYPSQLKLFKINDLPTNEFHYHSLV
Sbjct: 61   KAEIIKEFKAFADGFQISYLMVVGQSFLLAVGEKVNYPSQLKLFKINDLPTNEFHYHSLV 120

Query: 121  EIKNSDNAFPISSVSVSNELNCIVVGFVNGKILLIKGDLSRDRGSQQRILYEDSTGDPIT 180
            EIKNSDNAFPISSVSVSNELNCIVVGFVNGKILLIKGDLSRDRGSQQRILYEDSTGDPIT
Sbjct: 121  EIKNSDNAFPISSVSVSNELNCIVVGFVNGKILLIKGDLSRDRGSQQRILYEDSTGDPIT 180

Query: 181  SLFLNSDASSCFATTTSRIMMFNLMRKSKSIPEQVLSSKEGVALNCASFSKFTNENICCM 240
            SLFLNSDASSCFATTTSRIMMFNLMRKSKSIPEQVLSSKEGVALNCASFSKFTNENICCM
Sbjct: 181  SLFLNSDASSCFATTTSRIMMFNLMRKSKSIPEQVLSSKEGVALNCASFSKFTNENICCM 240

Query: 241  NDCIQFYHGNGERHDIPIKISNPKKLMPINKTELLIIFEEERQKTTSIEYESGASNNICK 300
            NDCIQFYHGNGERHDIPIKISNPKKLMPINKTELLIIFEEERQKTTSIEYESGASNNICK
Sbjct: 241  NDCIQFYHGNGERHDIPIKISNPKKLMPINKTELLIIFEEERQKTTSIEYESGASNNICK 300

Query: 301  AIVIDLENSILSFSFYTTSNIVDVLPVRSKDDSILYLVTAEGLMYKVSKKSLDERLSIVM 360
            AIVIDLENSILSFSFYTTSNIVDVLPVRSKDDSILYLVTAEGLMYKVSKKSLDERLSIVM
Sbjct: 301  AIVIDLENSILSFSFYTTSNIVDVLPVRSKDDSILYLVTAEGLMYKVSKKSLDERLSIVM 360

Query: 361  NKEMFPFALQLASDCNLPDNKIQKINKLYGDYLYSKGLHTEAAQQYMKCIDILDISDIIT 420
            NKEMFPFALQLASDCNLPDNKIQKINKLYGDYLYSKGLHTEAAQQYMKCIDILDISDIIT
Sbjct: 361  NKEMFPFALQLASDCNLPDNKIQKINKLYGDYLYSKGLHTEAAQQYMKCIDILDISDIIT 420

Query: 421  KLGANDVFDVKAMRNLADFVWELIRKGRADHDTVTLLLSVLIKLKDEDGLKRFVSYFRRS 480
            KLGANDVFDVKAMRNLADFVWELIRKGRADHDTVTLLLSVLIKLKDEDGLKRFVSYFRRS
Sbjct: 421  KLGANDVFDVKAMRNLADFVWELIRKGRADHDTVTLLLSVLIKLKDEDGLKRFVSYFRRS 480

Query: 481  GKYIETENYKDLDDESYFFSDLRLFDLELIRSLLIDSKLNQLCYQFVFKFSKDPIMITDV 540
            GKYIETENYKDLDDESYFFSDLRLFDLELIRSLLIDSKLNQLCYQFVFKFSKDPIMITDV
Sbjct: 481  GKYIETENYKDLDDESYFFSDLRLFDLELIRSLLIDSKLNQLCYQFVFKFSKDPIMITDV 540

Query: 541  LLNVLKETEATLKYVKSLSVDDILRVLVRFSKQLLYLSPNETNLLLIEVFTGKYRPSSYV 600
            LLNVLKETEATLKYVKSLSVDDILRVLVRFSKQLLYLSPNETNLLLIEVFTGKYRPSSYV
Sbjct: 541  LLNVLKETEATLKYVKSLSVDDILRVLVRFSKQLLYLSPNETNLLLIEVFTGKYRPSSYV 600

Query: 601  SDINNVVNTKTGTKSEKNPVFYSYTAFLKYMNPLADASVLDASENGDRLDVDRPTYHPPK 660
            SDINNVVNTKTGTKSEKNPVFYSYTAFLKYMNPLADASVLDASENGDRLDVDRPTYHPPK
Sbjct: 601  SDINNVVNTKTGTKSEKNPVFYSYTAFLKYMNPLADASVLDASENGDRLDVDRPTYHPPK 660

Query: 661  PSLVFNAFLSRPFEFVVFLEACLESYKQFDGFKNDRQEIXXXXXXXXXXXSKQDVGERKS 720
            PSLVFNAFLSRPFEFVVFLEACLESYKQFDGFKNDRQEI           SKQDVGERKS
Sbjct: 661  PSLVFNAFLSRPFEFVVFLEACLESYKQFDGFKNDRQEILTTLYDLYLTLSKQDVGERKS 720

Query: 721  EWTEKANLVLNESNEXXXXXXXXXXXXXXXXXXXXMKLIAHMNGLNVADISSPINENKEF 780
            EWTEKANLVLNESNE                    MKLIAHMNGLNVADISSPINENKEF
Sbjct: 721  EWTEKANLVLNESNELANELDQNSNNNLNKVDNSLMKLIAHMNGLNVADISSPINENKEF 780

Query: 781  SNDVTDNARIINGFRNLTYMGEVSECMKFFEEHSKNNIDLFPMALSYFISKKEILEFIGG 840
            SNDVTDNARIINGFRNLTYMGEVSECMKFFEEHSKNNIDLFPMALSYFISKKEILEFIGG
Sbjct: 781  SNDVTDNARIINGFRNLTYMGEVSECMKFFEEHSKNNIDLFPMALSYFISKKEILEFIGG 840

Query: 841  EDQLVXXXXXXXXENNIMSILDLLQILSSRDFITYGCVKDILLDRMKEEDAVAKRTKKLI 900
            EDQLV        ENNIMSILDLLQILSSRDFITYGCVKDILLDRMKEEDAVAKRTKKLI
Sbjct: 841  EDQLVKKIIKPIIENNIMSILDLLQILSSRDFITYGCVKDILLDRMKEEDAVAKRTKKLI 900

Query: 901  ASYSEELQDKKTQLRTYLSPDHEQHIAIKDKKCDLCHITLELPVIYFKCEHIYHQKCLNE 960
            ASYSEELQDKKTQLRTYLSPDHEQHIAIKDKKCDLCHITLELPVIYFKCEHIYHQKCLNE
Sbjct: 901  ASYSEELQDKKTQLRTYLSPDHEQHIAIKDKKCDLCHITLELPVIYFKCEHIYHQKCLNE 960

Query: 961  EADLKNEGDLLYKCPKCVIDIETSSKRISKERELASRKELLDLAFKEEGNNSDRFRIVSD 1020
            EADLKNEGDLLYKCPKCVIDIETSSKRISKERELASRKELLDLAFKEEGNNSDRFRIVSD
Sbjct: 961  EADLKNEGDLLYKCPKCVIDIETSSKRISKERELASRKELLDLAFKEEGNNSDRFRIVSD 1020

>Scas_594.2
          Length = 1029

 Score =  851 bits (2199), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/1027 (42%), Positives = 670/1027 (65%), Gaps = 19/1027 (1%)

Query: 1    MSLESWRHFQFYDNLPIPDPLLGNDIRLYSDPTLSAAATVNEDLFFIAVRSNYIRHFSLK 60
            MSL +WR FQFY+++PI DP LG+D  LYSDPTL A+A V+    FIAV+S YI+  +L 
Sbjct: 1    MSLSNWRQFQFYESVPIKDPELGSDEPLYSDPTLCASAPVDATELFIAVKSTYIKLINLA 60

Query: 61   KAEIIKEFKAFADGFQISYLMVVGQSFLLAVGEKVNYPSQLKLFKINDLPTNEFHYHSLV 120
            ++++   F AF + +QI+ L V+ + FL+A+GE +  PS +K++K++ LP+N   YHSLV
Sbjct: 61   ESKVTYHFNAFEEDYQITCLKVIDKIFLVAIGECIGKPSLIKVYKLDKLPSNPTSYHSLV 120

Query: 121  EIKNSDNAFPISSVSVSNELNCIVVGFVNGKILLIKGDLSRDRGSQQRILYEDSTGDPIT 180
            E+KN  N +PIS +S+SN+L+CI VG+VNGKI+LI+GD+SRDRGS+QR++YEDS  +PIT
Sbjct: 121  ELKNGSNTYPISVISISNDLSCIAVGYVNGKIILIRGDISRDRGSRQRMIYEDSGKEPIT 180

Query: 181  SLFLNSDASSCFATTTSRIMMFNLMRKSKSIPEQVLSSKEGVALNCASFSKFTNENICCM 240
            SL LN DAS CFA+TTSR ++FN   ++K  P+ +L++++GV LNC+  + FT+E IC  
Sbjct: 181  SLNLNRDASICFASTTSRTLLFNTTGRNKGSPDLILNAQKGVDLNCSCLNPFTDEYICFT 240

Query: 241  NDCIQFYHGNGERHDIPIKISNPKKLMPINKTELLIIFEEERQKTTSIEYESGASNNICK 300
            +D I+FY   GE+H I   ++ PK++ P++K +++ + EE  ++T +I    G+ + + +
Sbjct: 241  DDSIEFYKETGEKHKILSDLAVPKRIFPVSKDDIVFVIEE--KQTQNISVNGGSFSTLNR 298

Query: 301  AIVIDLENSILSFSFYTTSNIVDVLPVRSKDDSILYLVTAEGLMYKVSKKSLDERLSIVM 360
             IVID  N ++S S Y +  I+D+  V    + IL+++T+EG++Y+++KKS+ E+L+I+M
Sbjct: 299  VIVIDTLNQVISMSIYISHAIIDIFLVNDGKNDILFMLTSEGVLYRITKKSIHEQLNILM 358

Query: 361  NKEMFPFALQLASDCNLPDNKIQKINKLYGDYLYSKGLHTEAAQQYMKCIDILDISDIIT 420
             KE F FAL L+   NL   +I+KI+K +GD+LY KG   +A ++Y++C+D+++ S++I+
Sbjct: 359  QKEAFQFALTLSKQHNLNALEIEKIHKSFGDFLYKKGKKNDATKEYIQCLDVIETSEVIS 418

Query: 421  KLGANDVFDVKAMRNLADFVWELIRKGRADHDTVTLLLSVLIKLKDEDGLKRFVSYFRRS 480
            K G +   D     NLADF+W LI+K  A+ D VTLLL VLIKLKDE G+  F+ +F R+
Sbjct: 419  KFGIDGNPDTNNTENLADFIWSLIKKNIANSDHVTLLLVVLIKLKDEKGMDYFLQHFTRA 478

Query: 481  GKYIETENYKDLDDESYFFSDLRLFDLELIRSLLIDSKLNQLCYQFVFKFSKDPIMITDV 540
            G +  T N +DL+DE YF+SD+ +FDL LI +LL +S  N+  Y F  KF+KDP+ I  +
Sbjct: 479  GTFDATGNAEDLNDEEYFYSDVPVFDLYLIVTLLKNSAFNKKAYFFAKKFAKDPLTIVSI 538

Query: 541  LLNVLKETEATLKYVKSLSVDDILRVLVRFSKQLLYLSPNETNLLLIEVFTGKYRPSSYV 600
            LL+ L +    L+YV+SL +DD LR LV +SK LL   PNETN +LI+VFTGKY+P  Y 
Sbjct: 539  LLSTLNDPSGALEYVRSLPIDDTLRALVSYSKTLLQELPNETNAILIDVFTGKYKPKEYR 598

Query: 601  SDINNVVNTKTGTKSEKNPVFYSYTAFLKYMNP-----LADASVLDASENGDRLDVDRPT 655
             D    V     T S+   VFYSYT F  YMN      L++   LDA        ++ PT
Sbjct: 599  DDNIEPVTPDETTTSDLKKVFYSYTTFFNYMNKTVNPLLSEEHTLDA--------INTPT 650

Query: 656  YHPPKPSLVFNAFLSRPFEFVVFLEACLESYKQFDGFKNDRQEIXXXXXXXXXXXSKQDV 715
            YHPPKPS+VF++FLS+PFEFVVFLEACL+SY++++GF ND+Q+I           S  D+
Sbjct: 651  YHPPKPSIVFSSFLSKPFEFVVFLEACLDSYQRYEGFNNDKQDILTTLYDLYLNLSNTDI 710

Query: 716  GERKSEWTEKANLVLNESNEXXXXXXXXXXXXXXXXX--XXXMKLIAHMNGLNVADISSP 773
             ER+ +W  +A  +L +SNE                      M LI+HMN ++   +   
Sbjct: 711  EERRHDWKSRARKILKQSNELVALQEAATQASTTNKQFDNSLMMLISHMNKIDPYSMLEE 770

Query: 774  INENKEFSNDVTDNARIINGFRNLTYMGEVSECMKFFEEHSKNNIDLFPMALSYFISKKE 833
             +       +  +    I+ F+ +T       C KFF+++S     L  +AL +F+S K 
Sbjct: 771  EDGEPMIVGNNPNELDYISLFKFMTLTDSAVNCFKFFQKYSSREPGLNRIALIFFVSSKH 830

Query: 834  ILEFIGGEDQLVXXXXXXXXENNIMSILDLLQILSSRDFITYGCVKDILLDRMKEEDAVA 893
            IL+ IGGE  L         E+ +MS+L+++Q+LS+ +  T+G V+D+L++ + +E+   
Sbjct: 831  ILKEIGGELVLKEEVLNKIIEDELMSVLEIIQVLSTTNVATFGLVQDLLINYVNKEEIEI 890

Query: 894  KRTKKLIASYSEELQDKKTQLRTYLSPDHEQHIAIKDKKCDLCHITLELPVIYFKCEHIY 953
             + +KLI SY +EL +K  +L+  L      HI IK++KC +C+  L+LP+++FKC HIY
Sbjct: 891  NKNRKLIESYQQELTEKNNKLKELLQTTEPIHIGIKNQKCFMCNGVLDLPIVFFKCGHIY 950

Query: 954  HQKCLNEEADLKNEGDLLYKCPKCVIDIETSSKRISKERELASRKELLDLAFKEEGNNSD 1013
            HQ+CLNEE   + +G+ L+KCPKC++++ET++     +  +A +K  L++  + +G N D
Sbjct: 951  HQRCLNEENSAR-DGEKLFKCPKCMVELETANNLYLAQTAIARKKGQLEILLENDGKN-D 1008

Query: 1014 RFRIVSD 1020
            RF+ ++D
Sbjct: 1009 RFKGITD 1015

>YMR231W (PEP5) [4187] chr13 (733544..736633) Vacuolar peripheral
            membrane protein required for vacuole biogenesis [3090
            bp, 1029 aa]
          Length = 1029

 Score =  845 bits (2184), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/1028 (42%), Positives = 659/1028 (64%), Gaps = 21/1028 (2%)

Query: 1    MSLESWRHFQFYDNLPIPDPLLGNDIRLYSDPTLSAAATVNEDLFFIAVRSNYIRHFSLK 60
            MSL SWR FQ ++N+PI DP  G D  LYSDPTL AA  V+     IAV SN I+   L 
Sbjct: 1    MSLSSWRQFQLFENIPIRDPNFGGDSLLYSDPTLCAATIVDPQTLIIAVNSNIIKVVKLN 60

Query: 61   KAEIIKEFKAFADGFQISYLMVVGQSFLLAVGEKVNYPSQLKLFKINDLPTNEFHYHSLV 120
            ++++I EF++F   FQI++L V+   FL+A+ E +  PS ++++K+  LP  E  YHS V
Sbjct: 61   QSQVIHEFQSFPHDFQITFLKVINGEFLVALAESIGKPSLIRVYKLEKLPNREQLYHSQV 120

Query: 121  EIKNSDNAFPISSVSVSNELNCIVVGFVNGKILLIKGDLSRDRGSQQRILYEDSTGDPIT 180
            E+KN +N +PIS VS+SN+L+CIVVGF+NGKI+LI+GD+SRDRGSQQRI+YED + +PIT
Sbjct: 121  ELKNGNNTYPISVVSISNDLSCIVVGFINGKIILIRGDISRDRGSQQRIIYEDPSKEPIT 180

Query: 181  SLFLNSDASSCFATTTSRIMMFNLMRKSKSIPEQVLSSKEGVALNCASFSKFTNENICCM 240
            +LFLN+DA++CFA TTSRI++FN   +++  P  VL+SK G+ LNC SF+  TNE ICC+
Sbjct: 181  ALFLNNDATACFAATTSRILLFNTTGRNRGRPSLVLNSKNGLDLNCGSFNPATNEFICCL 240

Query: 241  NDCIQFYHGNGERHDIPIKISNPKKLMPINKTELLIIFEEERQKTTSIEYESGASNNICK 300
            ++ I+F+  +G++H     +S  K++  ++K  +LI+ EE    TTSI     +   I +
Sbjct: 241  SNFIEFFSSSGKKHQFAFDLSLRKRIFCVDKDHILIVTEETGVPTTSISVNELSPTIINR 300

Query: 301  AIVIDLENSILSFSFYTTSNIVDVLPVRSKDDSILYLVTAEGLMYKVSKKSLDERLSIVM 360
              +ID +N I+S +F  +S I+D+        +I YL+T+EG+M++++ KSL+ +++I++
Sbjct: 301  IFIIDAKNKIISLNFVVSSAIIDIFSTSQSGKNITYLLTSEGVMHRITPKSLENQINIII 360

Query: 361  NKEMFPFALQLASDCNLPDNKIQKINKLYGDYLYSKGLHTEAAQQYMKCIDILDISDIIT 420
             KE++PFALQLA   +L    +Q+I+K YGDYL+ KGL  EA  QY++C+D+++ S+II+
Sbjct: 361  QKELYPFALQLAKQHSLSPLDVQEIHKKYGDYLFKKGLRKEATDQYIQCLDVVETSEIIS 420

Query: 421  KLGANDVFDVKAMRNLADFVWELIRKGRADHDTVTLLLSVLIKLKDEDGLKRFVSYFRRS 480
            K G  +V D ++MRNLAD++W LI+   +  D VTLLL VLIKLKD +G+  F+ +F R 
Sbjct: 421  KFGVKEVPDPESMRNLADYLWSLIKNSISQRDHVTLLLIVLIKLKDVEGIDTFIQHFDRK 480

Query: 481  GKYIETENYKDLDDESYFFSDLRLFDLELIRSLLIDSKLNQLCYQFVFKFSKDPIMITDV 540
            G + E     D+DD ++F+SD   FDL+LI  L+ +S   +L Y+   K+SKD ++I D+
Sbjct: 481  GIWNEGVVMDDMDDVTFFYSDNDFFDLDLILELMKESDFKRLSYRLAKKYSKDSLIIVDI 540

Query: 541  LLNVLKETEATLKYVKSLSVDDILRVLVRFSKQLLYLSPNETNLLLIEVFTGKYRPSSYV 600
            LLN+L      +KY+KSL +D+ LR LV +SK+LL  SPNETN LLIEVFTGK++PS++ 
Sbjct: 541  LLNLLHNPVKAIKYIKSLPIDETLRCLVTYSKKLLEESPNETNALLIEVFTGKFKPSTFE 600

Query: 601  SDINNVVNTKTGTKSEK-NPVFYSYTAFLKYMNPLADASVLDASENGDRLDVDRPTYHPP 659
             D++      TG  SE    VFYSY  F  YMN    +  +  S      + + PTYHPP
Sbjct: 601  VDLDR--RDTTGDFSENIRTVFYSYKTFFNYMNSNGTSDAMSESSEASH-EHEEPTYHPP 657

Query: 660  KPSLVFNAFLSRPFEFVVFLEACLESYKQFDGFKNDRQEIXXXXXXXXXXXSKQDVGERK 719
            KPS+VF++F+++PFEFVVFLEACL  Y+Q++GF  DRQ I           ++ DV ER 
Sbjct: 658  KPSIVFSSFVTKPFEFVVFLEACLACYQQYEGFDEDRQVILTTLYDLYLNLAQNDVPERI 717

Query: 720  SEWTEKANLVLNESNEXXXXXXXXXXXXXXXXXXXXMKLIAHMNGLNVA-------DISS 772
             +W  +A  VL ESN+                    M LI+HM+  + +       DI+S
Sbjct: 718  DDWRSRATGVLRESNK--LVYSAASNNTSKRVDNSIMLLISHMDQSSASAKDKTKIDIAS 775

Query: 773  PINENKEFSNDVTDNARIINGFRNLTYMGEVSECMKFFEEHSKNNIDLFPMALSYFISKK 832
              N+N E          +++ FR +T   E S C+KF E++      L  +ALSYF+S K
Sbjct: 776  FANDNPEMD--------LLSTFRAMTLNEEPSTCLKFLEKYGTEEPKLLQVALSYFVSNK 827

Query: 833  EILEFIGGEDQLVXXXXXXXXENNIMSILDLLQILSSRDFITYGCVKDILLDRMKEEDAV 892
             I + +GG + L         E   M +LD+++ LS  +   +G ++DI++D +K ED  
Sbjct: 828  LIFKEMGGNEVLKEKVLRPIIEGERMPLLDIIKALSRTNVAHFGLIQDIIIDHVKTEDTE 887

Query: 893  AKRTKKLIASYSEELQDKKTQLRTYLSPDHEQHIAIKDKKCDLCHITLELPVIYFKCEHI 952
             KR +KLI SY +EL++K  +L+  ++ D   H+ +K++ C +C +TL++PV++FKC HI
Sbjct: 888  IKRNEKLIESYDKELKEKNKKLKNTINSDQPLHVPLKNQTCFMCRLTLDIPVVFFKCGHI 947

Query: 953  YHQKCLNEEADLKNEGDLLYKCPKCVIDIETSSKRISKERELASRKELLDLAFKEEGNNS 1012
            YHQ CLNEE D       L+KCPKC++D+ETS+K    + E+  + +LL+ A   E  + 
Sbjct: 948  YHQHCLNEEEDTLESERKLFKCPKCLVDLETSNKLFEAQHEVVEKNDLLNFALNSEEGSR 1007

Query: 1013 DRFRIVSD 1020
            DRF+++++
Sbjct: 1008 DRFKVITE 1015

>KLLA0B13090g complement(1142698..1145763) similar to sp|P12868
            Saccharomyces cerevisiae YMR231w PEP5 vacuolar biogenesis
            protein singleton, start by similarity
          Length = 1021

 Score =  754 bits (1948), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/1027 (38%), Positives = 648/1027 (63%), Gaps = 30/1027 (2%)

Query: 1    MSLESWRHFQFYDNLPIPDPLLGNDIRLYSDPTLSAAATVNEDLFFIAVRSNYIRHFSLK 60
            MSL +WR FQ Y+N+PI DP   +D  LYSDPTL+A A++NE    IAV+++ ++   L 
Sbjct: 1    MSLNTWRQFQLYENIPIRDPFTESDQPLYSDPTLTAVASLNETYLAIAVQASVVKVVDLH 60

Query: 61   KAEIIKEFKAFADGFQISYLMVVGQSFLLAVGEKVNYPSQLKLFKINDLPTNEFHYHSLV 120
               +  EF+A+   +Q++YL  V  + +++VGE +  P  +KL+ +  +P +E  YH+L 
Sbjct: 61   DMTLQFEFEAYTSEYQLTYLERVSDTLIVSVGECLGKPVLIKLWDLEKMPKDESKYHALA 120

Query: 121  EIKNSDNAFPISSVSVSNELNCIVVGFVNGKILLIKGDLSRDRGSQQRILYEDSTGDPIT 180
            E++N  NA+P+S+VS + + +CI VGF +G+++L++GDL RDRGS+ RI+YEDS  +PIT
Sbjct: 121  EVRNGSNAYPVSTVSCNLDASCIAVGFTDGRVILVRGDLLRDRGSKYRIIYEDSNKEPIT 180

Query: 181  SLFLNSDASSCFATTTSRIMMFNLMRKSKSIPEQVLSSKEGVALNCASFSKFTNENICCM 240
            +L L++D S  F TTT++IM+FN   ++   P+ +L+  EGV LNC   ++ T+E IC +
Sbjct: 181  ALSLSNDGSRLFVTTTNKIMLFNTSGRNNGKPDMILNDSEGVDLNCGVLNRSTDEFICAL 240

Query: 241  NDCIQFYHGNGERHDIPIKISNPKKLMPINKTELLIIFEEERQKTTSIEYESGASNNICK 300
             D +  Y G+G +  + + I   K++ PI+   +L++       TTS  +     N   +
Sbjct: 241  KDKLDIYMGSGSKRSLIVDIPTAKRIFPISADHILVLVS---NITTSSLHLGKTPNETIR 297

Query: 301  AIVIDLENSILSFSFYTTSNIVDVLPVRSKDDSILYLVTAEGLMYKVSKKSLDERLSIVM 360
            A+++D++  I+S+S   TS+++D+      D + + L+T+ G+++K+ +K LD++L+ + 
Sbjct: 298  AVILDIKTKIISYSLLITSSVIDIF----SDGASVNLLTSNGVIHKLRQKKLDDQLNTIC 353

Query: 361  NKEMFPFALQLASDCNLPDNKIQKINKLYGDYLYSKGLHTEAAQQYMKCIDILDISDIIT 420
             K+M+  AL+LA   +LPD K+Q+I K YGDYL+ KG   EA +QYM CI++ D ++II+
Sbjct: 354  QKDMYSVALELAKQHSLPDVKVQEIKKSYGDYLFKKGSKREAIEQYMGCIEVCDPTEIIS 413

Query: 421  KLGANDVFDVKAMRNLADFVWELIRKGRADHDTVTLLLSVLIKLKDEDGLKRFVSYFRRS 480
            K G     + +   NL DF+W+L++ G+A  D +TLLL++LIKL D +GL  F+S+F+R 
Sbjct: 414  KFGVEHKTNSEDSINLKDFLWKLVKDGKAKVDHITLLLTLLIKLHDIEGLGSFLSHFKRD 473

Query: 481  GKYIET-ENYKD--LDDESYFFSDLRLFDLELIRSLLIDSKLNQLCYQFVFKFSKDPIMI 537
            G + E  E + +  ++D+S+F+SD  LFDL++   LL++  + +L  ++V K+SKDP  +
Sbjct: 474  GVFNENPEEFGNWSMNDDSFFYSDSSLFDLDIALRLLLECNMLELAQKYVLKYSKDPSQV 533

Query: 538  TDVLLNVLKETEATLKYVKSLSVDDILRVLVRFSKQLLYLSPNETNLLLIEVFTGKYRPS 597
              ++L   K++   L Y+KSL VDD LRVL++FS++LL L PNETNLLLI++F G+Y+PS
Sbjct: 534  VSIVLLHKKDSFGALNYIKSLPVDDALRVLIKFSRKLLDLIPNETNLLLIDLFIGQYKPS 593

Query: 598  SYVSDINNVVNTKTGTK-SEKNP-VFYSYTAFLKYMNPLADASVLDASENGDRLDVD--R 653
            +Y +   NVVN K  ++ ++K P +FY+Y +F +YM P +      AS +   L V+  +
Sbjct: 594  NYDAVKENVVNQKKQSEPADKEPIIFYNYRSFFEYMLPSS------ASSDDKPLTVESAQ 647

Query: 654  PTYHPPKPSLVFNAFLSRPFEFVVFLEACLESYKQFDGFKNDRQEIXXXXXXXXXXXSKQ 713
            PTYHPPKPSL+F +F+ +PF+FVVFLEACLESYK+F G+  DRQ+I            + 
Sbjct: 648  PTYHPPKPSLIFPSFVQKPFQFVVFLEACLESYKRFQGYDQDRQDILTTLYDIYLSLYED 707

Query: 714  DVGERKSEWTEKANLVLNESNEXXXXXXXXXXXXXXXXXXXXMKLIAHMNGLNVADISSP 773
            D+ ERK+EW  KA  VL E+ +                    M LI+HM+ +N   +SS 
Sbjct: 708  DIEERKAEWKGKAEAVLEETEK-----YKIRQASERAPDSSLMLLISHMHDMNPFTLSS- 761

Query: 774  INENKEFSNDVTDNARIINGFRNLTYMGEVSECMKFFEEHSKNNIDLFPMALSYFISKKE 833
            + E+++ SN +  +  + + FR++    +   C+ F E++ ++  DL+ +A+ +F+S K+
Sbjct: 762  MQEDEQESNSIISHVSLSDVFRSMCLTNDPHVCLSFLEKYGESEHDLYKIAMPFFVSSKQ 821

Query: 834  ILEFIGGEDQLVXXXXXXXXENNIMSILDLLQILSSRDFITYGCVKDILLDRMKEEDAVA 893
            I E IGGE            + ++MS L+++Q LS  + + YG +KD L+D +K E+A  
Sbjct: 822  IYEDIGGESVFREKILNKVLKFDLMSPLEIIQTLSGTNVVKYGAIKDFLVDYLKGENAEI 881

Query: 894  KRTKKLIASYSEELQDKKTQLRTYLSPDHEQHIAIKDKKCDLCHITLELPVIYFKCEHIY 953
            ++ + L+ SY +EL  K ++L+  L+ +    + +K + CD C+I LE P+++FKC H+Y
Sbjct: 882  QKNELLVKSYEKELDLKVSKLKEALAIESPLQVQVKKRLCDACNILLEFPMVFFKCGHLY 941

Query: 954  HQKCLNEEADLKNEGDLLYKCPKCVIDIETSSKRISKERELASRKELLDLAFKEEGNNSD 1013
            HQ+CLNEE D     DLLY CP+CV++ E++ K ++  +  +    LL  A  +     D
Sbjct: 942  HQRCLNEETD----SDLLYSCPQCVVETESAKKTMATYKNSSQNANLLRAALSDLDAKED 997

Query: 1014 RFRIVSD 1020
            RF I+S+
Sbjct: 998  RFAIISE 1004

>ABL012C [580] [Homologous to ScYMR231W (PEP5) - SH] (375053..378115)
            [3063 bp, 1020 aa]
          Length = 1020

 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/1025 (38%), Positives = 608/1025 (59%), Gaps = 21/1025 (2%)

Query: 1    MSLESWRHFQFYDNLPIPDPLLGNDIRLYSDPTLSAAATVNEDLFFIAVRSNYIRHFSLK 60
            MS  S R FQ ++  PI DP  G D  LYSDPTLSA   +      IAVRS YI+   LK
Sbjct: 1    MSFNSQRQFQLFEITPIRDPNFGTDTPLYSDPTLSAVTPLGNGTIAIAVRSVYIQTIDLK 60

Query: 61   KAEIIKEFKAFADGFQISYLMVVGQSFLLAVGEKVNYPSQLKLFKINDLPTNEFHYHSLV 120
                + EFKA+ D +QI+YL  V    L++VGE V  P+ +K++ +   P + F +HS  
Sbjct: 61   TPASLAEFKAYGDDYQITYLEYVKDGMLVSVGECVGKPTSIKIWNLGKTPKDAFDFHSTC 120

Query: 121  EIKNSDNAFPISSVSVSNELNCIVVGFVNGKILLIKGDLSRDRGSQQRILYEDSTGDPIT 180
            E++N +N FP+S++S+S +L+CIV+GFVNG+I+L++GDL RDRGS+QRI+YED   +PIT
Sbjct: 121  EVRNGNNTFPVSAISLSQDLSCIVLGFVNGRIILVRGDLYRDRGSRQRIIYEDLNNEPIT 180

Query: 181  SLFLNSDASSCFATTTSRIMMFNLMRKSKSIPEQVLSSKEGVALNCASFSKFTNENICCM 240
            +LFLN+D S  FA+TTSRIM+F    ++   PE+VL++  G+ LNC+ F+   +E +CC+
Sbjct: 181  ALFLNNDYSVTFASTTSRIMLFRTTGRNNGEPERVLNANTGIDLNCSCFNPERDELLCCL 240

Query: 241  NDCIQFYHGNGERHDIPIKISNPKKLMPINKTELLIIFEEERQKTTSIEYESGASNNICK 300
            +  ++FY   GE+H + +++   K++  I+   +L++       +T+++  S  +    K
Sbjct: 241  DKSVEFYKATGEKHSLLVEVPMKKRIFLIDNDHILLLSSVSTPNSTALQLSSTGTIT-KK 299

Query: 301  AIVIDLENSILSFSFYTTSNIVDVLPVRSKDDSILYLVTAEGLMYKVSKKSLDERLSIVM 360
             +++DL+N +++ +    SNIV +          +YLVT +G++ ++++K +D+++ ++ 
Sbjct: 300  VLILDLKNQLIAMNHLLASNIVHIYSDTVDGVYSVYLVTTDGVINRITEKPVDKQIKLIT 359

Query: 361  NKEMFPFALQLASDCNLPDNKIQKINKLYGDYLYSKGLHTEAAQQYMKCIDILDISDIIT 420
             +E++P ALQLA   ++   +IQ+I + YGD LY K +  EA +QY++C+DI + S+II+
Sbjct: 360  QRELYPIALQLAEQRSVSPLRIQEIRRQYGDALYKKNMKEEAVEQYIQCLDITETSEIIS 419

Query: 421  KLGANDVFDVKAMRNLADFVWELIRKGRADHDTVTLLLSVLIKLKDEDGLKRFVSYFRRS 480
            + G          RNLA ++W +I++  +  D VTLLL++LIKLKD DG+  F+S+F R+
Sbjct: 420  RFGIQKTSRPDDSRNLATYLWSMIKQKLSHSDHVTLLLAILIKLKDVDGIDYFISHFSRN 479

Query: 481  GKYIET---ENYKDLDDESYFFSDLRLFDLELIRSLLIDSKLNQLCYQFVFKFSKDPIMI 537
            G+++E    E+   +DDE++F+SD+ L DL+ I  LL DS+L+   +  V KFSKDPI +
Sbjct: 480  GEFVEEGEDESSWSVDDETFFYSDIVLMDLDTILQLLKDSELDAQAFSLVHKFSKDPIQV 539

Query: 538  TDVLLNVLKETEATLKYVKSLSVDDILRVLVRFSKQLLYLSPNETNLLLIEVFTGKYRPS 597
             DV+LN L +  + LKY+KSL VDD LRVL+ FSK LL   PN+TN LLI+VFTG+Y+ S
Sbjct: 540  VDVILNTLDDPHSALKYIKSLHVDDTLRVLIEFSKVLLEKLPNDTNALLIDVFTGRYQRS 599

Query: 598  SYVSDINNVVNTKTGTKSEKNPVFYSYTAFLKYMNPLADASVLDASENGDRLDVDRPTYH 657
            +   ++N  +  K  T S  NPVF+SY AF+ YM   + A  +  SE     D+  PTYH
Sbjct: 600  TKC-EVN--IREKKQTISRNNPVFHSYKAFVTYM--YSTAGGVPNSE-----DIQEPTYH 649

Query: 658  PPKPSLVFNAFLSRPFEFVVFLEACLESYKQFDGFKNDRQEIXXXXXXXXXXXSKQDVGE 717
            PPKPSLVF +F+ RPF+FVVFLEACLESY +F GF  D+QEI           +  D   
Sbjct: 650  PPKPSLVFTSFIDRPFQFVVFLEACLESYNKFQGFLRDKQEILTTLYDIYLSLAATDEAH 709

Query: 718  RKSEWTEKANLVLNESNEXXXXXXXXXXXXXXXXX--XXXMKLIAHMNGLNVADISSPIN 775
             + +W  KA  V  ES +                      M LI+H+N +++  +    +
Sbjct: 710  NE-DWRTKATAVYKESEKLAGTCRSPQAPKASNTQFDNSLMMLISHINNVDLYSVEGDAS 768

Query: 776  ENKEFSNDVTDNARIINGFRNLTYMGEVSECMKFFEEHSKNNIDLFPMALSYFISKKEIL 835
              ++ S    + A + N FR++    E  +CM F E++     +L+ MAL +F+S K++ 
Sbjct: 769  GTEDLS---VNKANLTNTFRSMCLTKEAKKCMNFLEKYGSVEPELYRMALGFFLSSKQVY 825

Query: 836  EFIGGEDQLVXXXXXXXXENNIMSILDLLQILSSRDFITYGCVKDILLDRMKEEDAVAKR 895
            + IGG             E +++  LD+L +LSS    T+G V+D L++ +K +      
Sbjct: 826  DSIGGAPVFKARVLDKVIEMDLLQPLDILFVLSSTSVATFGLVRDFLINHIKAQQRETHN 885

Query: 896  TKKLIASYSEELQDKKTQLRTYLSPDHEQHIAIKDKKCDLCHITLELPVIYFKCEHIYHQ 955
             +KLI SY  ELQ+K+ QL+T LS      + +K+  C +CH  L+LP    +    Y  
Sbjct: 886  NEKLIQSYQGELQEKEMQLKTLLSESEPLQVKVKNNFCKMCHTLLDLPGDILQM-WPYLP 944

Query: 956  KCLNEEADLKNEGDLLYKCPKCVIDIETSSKRISKERELASRKELLDLAFKEEGNNSDRF 1015
              L  E  +  E   L   PKC +D   S   I  +++  ++  LL  A   E ++ DRF
Sbjct: 945  PALPPEDSISAEMVRLILMPKCAVDNGASETWIKPKKDNDTKASLLQAALSNEDSSGDRF 1004

Query: 1016 RIVSD 1020
            ++VS+
Sbjct: 1005 KVVSE 1009

>Kwal_55.20318
          Length = 899

 Score =  622 bits (1604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/902 (36%), Positives = 551/902 (61%), Gaps = 28/902 (3%)

Query: 129  FPISSVSVSNELNCIVVGFVNGKILLIKGDLSRDRGSQQRILYEDSTGDPITSLFLNSDA 188
            +P+S+VS+ ++L CI +GFVNG+++LI+GD+  DRGS+QR++Y+D   +PIT+L L+ D 
Sbjct: 2    YPMSAVSIWHDLTCIAIGFVNGRVILIRGDILHDRGSRQRVIYDDHNKEPITALMLDRDC 61

Query: 189  SSCFATTTSRIMMFNLMRKSKSIPEQVLSSKEGVALNCASFSKFTNENICCMNDCIQFYH 248
              CFA+TTS + +FN   ++   P+ VL+S+ G+ LNC+  S    E ICC +  I+FY 
Sbjct: 62   RMCFASTTSAMFLFNTAGRNSGKPDVVLNSETGIDLNCSCLSYDETEFICCSSSSIEFYK 121

Query: 249  GNGERHDIPIKISNPKKLMPINKTELLIIFEEERQKTTSIEYESGASNNICKAIVIDLEN 308
              GE+  + I I+  K++  I++  +LI+   +   +T++   + ++ N  + +++D++N
Sbjct: 122  STGEKRSLVIDIAMIKRVYAIDQNHILILSGVQTSNSTALSVTNVSTPN-NRVVILDIQN 180

Query: 309  SILSFSFYTTSNIVDVLPVRSKDDSILYLVTAEGLMYKVSKKSLDERLSIVMNKEMFPFA 368
             +++ +   T +I+D+ P     +  + L+T +G ++K+++KS++++L I   KE+FP A
Sbjct: 181  KLIAMNSLITGSILDIFPSIFAGEPSVVLLTNDGTLHKLTEKSIEQKLDITEQKELFPIA 240

Query: 369  LQLASDCNLPDNKIQKINKLYGDYLYSKGLHTEAAQQYMKCIDILDISDIITKLGANDVF 428
            L LA    L   +I+ I K Y +YLY KG   EA +QY++C+ + + S++I K G     
Sbjct: 241  LDLAKQNKLKPLQIENIRKKYAEYLYRKGAKAEAIEQYLQCLSVTETSEVIEKFGIGSTS 300

Query: 429  DVKAMRNLADFVWELIRKGRADHDTVTLLLSVLIKLKDEDGLKRFVSYFRRSGKYI---- 484
            D+  + +L+ ++  +I+K  ++ + VTL +  LIKL+DE+G+ RF+ +F RSG Y+    
Sbjct: 301  DISDVSHLSYYLLAMIKKRLSNANHVTLYMITLIKLRDEEGIDRFIKHFSRSGYYLEEEE 360

Query: 485  ETENYKDLDDESYFFSDLRLFDLELIRSLLIDSKLNQLCYQFVFKFSKDPIMITDVLLNV 544
              E+++  +DE+YF+SD  LFDL+L   LL ++      YQ   KF+KDP ++ ++ +  
Sbjct: 361  SEEDWRK-EDEAYFYSDSDLFDLDLSLRLLQEAGFFSQSYQLSRKFAKDPAIVVEMSIEG 419

Query: 545  LKETEATLKYVKSLSVDDILRVLVRFSKQLLYLSPNETNLLLIEVFTGKYRPSSYVSDIN 604
            L +  + L+Y+KSL VDD LRVL+ FSK+LL L PN+TN LLIE+FTGKY+P +Y  +  
Sbjct: 420  LNDPHSALRYIKSLPVDDTLRVLITFSKKLLELLPNDTNALLIELFTGKYQPLTY--EEA 477

Query: 605  NVVNTKTGTKSEKNPVFYSYTAFLKYMNPLADASVLDASENGDRLDVDR-PTYHPPKPSL 663
            +  N+ +  K EKN VFYSY++F+++M   A +         D+  V+  PTY PPKP+L
Sbjct: 478  SRCNSLSEKKPEKN-VFYSYSSFIEHMKTSATSK--------DQPHVNNIPTYQPPKPAL 528

Query: 664  VFNAFLSRPFEFVVFLEACLESYKQFDGFKNDRQEIXXXXXXXXXXXSKQDVGERKSEWT 723
            +F +F+++PFEFVVFLEACL SY +F GF +D+Q I           ++ D  +R+ EW 
Sbjct: 529  IFTSFINQPFEFVVFLEACLGSYSEFHGFDHDKQLILTTLYDIYLSLAEADEEDRQQEWR 588

Query: 724  EKANLVLNESNEXXXXXXXXXXXXXXXXXX-----XXMKLIAHMNGLNVADISSPINENK 778
             KA+ V  ES +                         M LI+ +NG+++A +   +++ +
Sbjct: 589  AKASRVYKESTKLLAATAASNKSSSSEKPAKPIDNSLMMLISQVNGIDLA-LEECMSKEE 647

Query: 779  EFSNDVTDNARIINGFRNLTYMGEVSECMKFFEEHSKNNIDLFPMALSYFISKKEILEFI 838
            E S+   +   +   F++L+        ++F E+  +    L+ MALS+FI+ K  ++ I
Sbjct: 648  EVSS--FEKLDLTYRFQSLSLTSSPQNALEFVEKFGEREPALYTMALSHFITSKSAMKAI 705

Query: 839  GGEDQLVXXXXXXXXENNIMSILDLLQILSSRDFITYGCVKDILLDRMKEEDAVAKRTKK 898
            GGE            E ++M +LD+LQ+L S +  ++G V++IL+D ++ +    K+ KK
Sbjct: 706  GGEAVFRSKVLQKVLEKDLMPLLDVLQVLGSTNVASFGLVQEILIDHLRSDSQEIKKNKK 765

Query: 899  LIASYSEELQDKKTQLRTYLSPDHEQHIAIKDKKCDLCHITLELPVIYFKCEHIYHQKCL 958
            LI SY  ELQ+K+++L + L   +   I +K++ C+ CH TL  P++YFKC HIYHQ+CL
Sbjct: 766  LIDSYEAELQEKESRLLSLLDDTNPSQIRLKNQNCNTCHTTLNAPIVYFKCGHIYHQRCL 825

Query: 959  NEEADLKNEGDLLYKCPKCVIDIETSSKRISKERELASRKELLDLAFKEEGNNSDRFRIV 1018
            NEE  L+  G   +KCP+CVID ETS    + + +     +LL LA K++ NN DRFR+V
Sbjct: 826  NEEESLE-RGSRFFKCPQCVIDFETSEGMKNAQIKAQMDADLLKLALKDQ-NNKDRFRVV 883

Query: 1019 SD 1020
            ++
Sbjct: 884  TE 885

>CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces
           cerevisiae YLR032w RAD5, hypothetical start
          Length = 1151

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 5/51 (9%)

Query: 936 CHITLELPV-----IYFKCEHIYHQKCLNEEADLKNEGDLLYKCPKCVIDI 981
           C I    P+     +  +CEH++ ++CL E  + + E  L  KCP C  DI
Sbjct: 897 CSICTAEPIESSSAVVTECEHVFCKECLEEYGNFQKEKSLQQKCPNCRRDI 947

>YAL002W (VPS8) [64] chr1 (143711..147535) Protein involved in
            vacuolar sorting [3825 bp, 1274 aa]
          Length = 1274

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 4/44 (9%)

Query: 934  DLCHITLELPVIYFKCEHIYHQKCLNEEADLKNEGDLLYKCPKC 977
            D+  + L+ P++ FKC H +HQ CL   A   +E    Y C  C
Sbjct: 1226 DMISVDLKTPLVIFKCHHGFHQTCLENLAQKPDE----YSCLIC 1265

>Sklu_2412.7 YLR032W, Contig c2412 15481-18864
          Length = 1127

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 34/76 (44%), Gaps = 6/76 (7%)

Query: 920 PDHEQHIAIKDKKCDLCHITLELP---VIYFKCEHIYHQKCLNEEADLKNEGDLLYKCPK 976
           PD +   + K  +C +C      P   VI+ +C H + + CL E  D + +  L  KCP 
Sbjct: 864 PDRD---SFKGLECSICTSEPIEPITQVIFTECAHAFCEHCLLEYIDFQTQKKLELKCPN 920

Query: 977 CVIDIETSSKRISKER 992
           C   I+       KER
Sbjct: 921 CRESIDPKRLLTLKER 936

>AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH]
           complement(830240..833497) [3258 bp, 1085 aa]
          Length = 1085

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 29/60 (48%), Gaps = 3/60 (5%)

Query: 927 AIKDKKCDLCHITLELP---VIYFKCEHIYHQKCLNEEADLKNEGDLLYKCPKCVIDIET 983
           A+KD +C +C      P   V++ +C H + + CL E    +N+      CP C   +E+
Sbjct: 826 ALKDLECSICTCEAISPLTSVVFTRCGHPFCESCLLEYIQFQNKKGSETICPNCRAAVES 885

>YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded
           DNA-dependent ATPase of the Snf2p family of DNA
           helicases, member of the RAD6 epistasis group, involved
           in error-free DNA repair [3510 bp, 1169 aa]
          Length = 1169

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 902 SYSEELQDKKTQLRTYLSPDHEQHIAIKDKKCDLCHI-TLEL-PVIYFKCEHIYHQKCLN 959
           S+S+E  D   Q      PD++   +++   C +C    ++L   ++ +C H + +KCL 
Sbjct: 886 SFSKEELDAMIQRLKVKYPDNKSFQSLE---CSICTTEPMDLDKALFTECGHSFCEKCLF 942

Query: 960 EEADLKNEGDLLYKCPKC 977
           E  + +N  +L  KCP C
Sbjct: 943 EYIEFQNSKNLGLKCPNC 960

>Scas_700.47
          Length = 873

 Score = 33.9 bits (76), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 48/97 (49%), Gaps = 8/97 (8%)

Query: 131 ISSVSVSNELNCIVVGFVNGKILLIKGDLSRDRGSQQRILYEDSTGDPITSLFLNSDASS 190
           ISS+++ N  N + +GFV+G I ++  D   D   Q R+L      D + SL  N D + 
Sbjct: 252 ISSMAIDNNANQLALGFVSGVINIVSLD---DSKLQSRLLKWHI--DSVLSLSFNQDGTY 306

Query: 191 CFATTTSRIMMFNLMRKSKSIPEQVLSSKEGVALNCA 227
             +    ++++F  +  +    +Q L    G+ ++C+
Sbjct: 307 LLSGGWEKVLVFWQLSTNL---QQFLPRLNGIIIDCS 340

>Sklu_2433.17 YFR040W, Contig c2433 26349-29093 reverse complement
          Length = 914

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 8/54 (14%)

Query: 408 KCIDILDISDIITKLGANDVFDVKAMRNLADFVWELIRKGRADHDTVTLLLSVL 461
           +CID+L ++ I+ K GA       A+      V ELIRK  +D+D V LL + +
Sbjct: 409 QCIDLL-LNAIVNKRGA-------ALTTAVSIVIELIRKNNSDYDQVNLLTTTV 454

>CAGL0A00781g 77746..81366 similar to sp|P39702 Saccharomyces
            cerevisiae YAL002w VPS8, hypothetical start
          Length = 1206

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 5/48 (10%)

Query: 930  DKKCDLCHITLELPVIYFKCEHIYHQKCLNEEADLKNEGDLLYKCPKC 977
            + + D   ++L   V+ FKC H +H KCL    +L   G+  Y C  C
Sbjct: 1160 ENESDFYKLSLNHDVVVFKCRHAFHDKCL---GNLGQNGE--YHCLFC 1202

>CAGL0M04653g 505982..508861 similar to sp|P27801 Saccharomyces
            cerevisiae YLR148w PEP3 vacuolar membrane protein,
            hypothetical start
          Length = 959

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 8/74 (10%)

Query: 931  KKCDLCHITLEL-PVIYFKCEHIYHQKCLNEEADLKNEGDLLYKCPKCVIDIETSSKRIS 989
            K CD C   L+    + F C H +H  CL       N+ +L  K       IE   KR++
Sbjct: 862  KSCDQCQKMLQTRKFLVFPCGHCFHTDCLIRAILSSNDYNLKGK-------IENFQKRLN 914

Query: 990  KERELASRKELLDL 1003
            K+R+  + KEL +L
Sbjct: 915  KDRKSVNPKELEEL 928

>CAGL0B02695g complement(256863..258152) similar to tr|Q12508
           Saccharomyces cerevisiae YDR255c, start by similarity
          Length = 429

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 3/49 (6%)

Query: 939 TLELPVIYFKCEHIYHQKCLNEEADLKNEGDLLYKCPKCVIDIETSSKR 987
           T+E P     C HI  +K L+    L   G L +KCP C ++   ++ R
Sbjct: 377 TVENPPYSLACHHIISKKALDR---LSKNGSLTFKCPYCPVNTSMANTR 422

>YDR255C (RMD5) [1088] chr4 complement(966549..967814) Protein
           possibly involved in meiotic nuclear division [1266 bp,
           421 aa]
          Length = 421

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 3/49 (6%)

Query: 939 TLELPVIYFKCEHIYHQKCLNEEADLKNEGDLLYKCPKCVIDIETSSKR 987
           T E P     C HI  +K L+    L   G + +KCP C ++   SS +
Sbjct: 369 TTENPPYSLACHHIISKKALDR---LSKNGTITFKCPYCPVNTSMSSTK 414

>Scas_670.26
          Length = 1305

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 4/34 (11%)

Query: 944  VIYFKCEHIYHQKCLNEEADLKNEGDLLYKCPKC 977
            +  FKC H YH KCL        + +  YKC  C
Sbjct: 1271 IAVFKCHHGYHTKCLENMG----QSNTTYKCLMC 1300

>Kwal_26.8030
          Length = 660

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 10/55 (18%)

Query: 943 PVIYFK-CEHIYHQKCLNEEADLKNEGDLLYKCPKC---VIDIETSSKRISKERE 993
           PV+Y   C H  HQ C +E           YKCP C   V+++E   + + KE E
Sbjct: 399 PVVYMSPCGHAIHQHCFDEYTKHS------YKCPSCQVSVLNMEAQFRVLDKEIE 447

>KLLA0D17182g 1456620..1459394 similar to sp|P27801 Saccharomyces
           cerevisiae YLR148w PEP3 vacuolar membrane protein
           singleton, hypothetical start
          Length = 924

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 16/24 (66%)

Query: 385 INKLYGDYLYSKGLHTEAAQQYMK 408
           ++  YGDY Y K +  EAA+QY K
Sbjct: 384 VHSFYGDYYYEKQMWEEAAEQYSK 407

>Scas_721.100
          Length = 1137

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 26/49 (53%), Gaps = 4/49 (8%)

Query: 932 KCDLCHITLELP---VIYFKCEHIYHQKCLNEEADLKNEGDLLYKCPKC 977
           +C +C  T  +P   +++ +C H + + C+ E  + +   +L  KCP C
Sbjct: 883 ECSIC-TTDPIPLDKIVFTECGHPFCESCIEEYFEFQAGKNLELKCPNC 930

>Scas_600.10
          Length = 968

 Score = 30.8 bits (68), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 46/105 (43%), Gaps = 6/105 (5%)

Query: 855 NNIMSILDLLQILSSRDFITYGCVKDILLDRMKEEDAVAKRTKKLIASYSEELQDKKTQL 914
           N ++ I DLL + +  +F T   +KD L+  +++  +   +  + I        D + ++
Sbjct: 797 NEVVEIKDLLPLFN--EFTTIANLKDELIRSLEKHSSSMLQISEDIKKSIVLKNDIRNEI 854

Query: 915 RTYLSPDHEQHIAIKDKKCDLCHITLEL-PVIYFKCEHIYHQKCL 958
           +T+        I      CD CH  L+    + F C H +H  CL
Sbjct: 855 KTF---QQRYQILEPGVSCDSCHKFLQTRKFLVFPCGHCFHTDCL 896

>Scas_654.1*
          Length = 1668

 Score = 30.8 bits (68), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 47/101 (46%), Gaps = 8/101 (7%)

Query: 604 NNVVNTKTGTKSEKNPVFYS-YTAFLKYMNPLADASVLDASENGDRLDV---DRPTYHPP 659
           +N+  T   T  ++   F+S Y  FL+  +PL  A + D   + + +D+   DR  + PP
Sbjct: 398 DNLSGTLVRTHIDERERFFSLYNPFLQISSPLTKARIYDQDNHKNPIDLLINDRDFFLPP 457

Query: 660 KPSLV---FNAFLSRPFEFVVFLEACLESYKQFDGFKNDRQ 697
             +LV   F AF       + +  A +  Y  F+  KN ++
Sbjct: 458 STTLVSLCFKAFFWVCHPTIYYSLAYMWQYT-FEVLKNQQE 497

>AEL207W [2299] [Homologous to ScYNL299W (TRF5) - SH; ScYOL115W
           (TRF4) - SH] complement(244067..245947) [1881 bp, 626
           aa]
          Length = 626

 Score = 30.4 bits (67), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 39/86 (45%), Gaps = 22/86 (25%)

Query: 576 YLSPNETNLLL-----------IEVFT--------GKYRPSSYV--SDINNVVNTKTGTK 614
           Y+SPN+T + L           ++ F         G Y    Y+  SDI+ VVN+K+G K
Sbjct: 205 YISPNKTEIQLRNDALKRIRDAVQDFWPDANLHCFGSYATDLYLPGSDIDCVVNSKSGDK 264

Query: 615 SEKNPVFYSYTAFLKYMNPLADASVL 640
             KN   YS  ++LK        SV+
Sbjct: 265 DNKN-ALYSLASYLKRNGLATQVSVI 289

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.136    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 33,292,574
Number of extensions: 1511092
Number of successful extensions: 4794
Number of sequences better than 10.0: 49
Number of HSP's gapped: 4912
Number of HSP's successfully gapped: 49
Length of query: 1020
Length of database: 16,596,109
Length adjustment: 112
Effective length of query: 908
Effective length of database: 12,718,893
Effective search space: 11548754844
Effective search space used: 11548754844
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)