Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M04851g63623266e-42
ADL066C56019571.2
YER022W (SRB4)68757562.0
KLLA0D10043g48830552.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M04851g
         (62 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M04851g 532127..532318 no similarity, hypothetical start         130   6e-42
ADL066C [1675] [Homologous to ScYER065C (ICL1) - SH] (563788..56...    27   1.2  
YER022W (SRB4) [1447] chr5 (198811..200874) Component of the RNA...    26   2.0  
KLLA0D10043g 849549..851015 some similarities with sp|P07269 Sac...    26   2.1  

>CAGL0M04851g 532127..532318 no similarity, hypothetical start
          Length = 63

 Score =  130 bits (326), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 62/62 (100%), Positives = 62/62 (100%)

Query: 1  MGLRRNKTLVLEYKRNSCTALSQSTYCTAGFHTNSQNYDNFSENYRRVQDYKILVLHYFC 60
          MGLRRNKTLVLEYKRNSCTALSQSTYCTAGFHTNSQNYDNFSENYRRVQDYKILVLHYFC
Sbjct: 1  MGLRRNKTLVLEYKRNSCTALSQSTYCTAGFHTNSQNYDNFSENYRRVQDYKILVLHYFC 60

Query: 61 KQ 62
          KQ
Sbjct: 61 KQ 62

>ADL066C [1675] [Homologous to ScYER065C (ICL1) - SH]
           (563788..565470) [1683 bp, 560 aa]
          Length = 560

 Score = 26.6 bits (57), Expect = 1.2,   Method: Composition-based stats.
 Identities = 10/19 (52%), Positives = 12/19 (63%)

Query: 29  AGFHTNSQNYDNFSENYRR 47
           AG HTN+   DNFS  + R
Sbjct: 475 AGLHTNALAIDNFSREFSR 493

>YER022W (SRB4) [1447] chr5 (198811..200874) Component of the RNA
           polymerase II holoenzyme and Kornberg's mediator (SRB)
           subcomplex [2064 bp, 687 aa]
          Length = 687

 Score = 26.2 bits (56), Expect = 2.0,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 6   NKTLVLEYKRNSCTALSQSTYCTAGFHTNSQNYDNFSENYRRVQDYKILVLHYFCKQ 62
           N +L+LE   N C AL    + +AG   N+ ++D    +++ V+D+   ++  + +Q
Sbjct: 630 NLSLMLE-SPNYCNALIHIKF-SAGTEANAVSFDTTFSDFKEVEDFLHFIVAEYIQQ 684

>KLLA0D10043g 849549..851015 some similarities with sp|P07269
           Saccharomyces cerevisiae YDL106c GRF10 homeodomain
           protein singleton, hypothetical start
          Length = 488

 Score = 25.8 bits (55), Expect = 2.1,   Method: Composition-based stats.
 Identities = 11/30 (36%), Positives = 17/30 (56%)

Query: 22  SQSTYCTAGFHTNSQNYDNFSENYRRVQDY 51
           SQS++ T   +  S  +DNFS N  +  D+
Sbjct: 432 SQSSFLTTNDNFTSMTFDNFSSNIPKTPDF 461

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.323    0.133    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,009,876
Number of extensions: 59998
Number of successful extensions: 254
Number of sequences better than 10.0: 5
Number of HSP's gapped: 254
Number of HSP's successfully gapped: 5
Length of query: 62
Length of database: 16,596,109
Length adjustment: 35
Effective length of query: 27
Effective length of database: 15,384,479
Effective search space: 415380933
Effective search space used: 415380933
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 54 (25.4 bits)