Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M04829g1706168082930.0
YMR229C (RRP5)1729169852830.0
Scas_594.41722169851690.0
Sklu_2383.11720168647800.0
Kwal_26.91891726169944830.0
AFR566C1716168544470.0
KLLA0B08239g1729131833540.0
KLLA0F17996g6841941271e-06
Scas_713.426991971191e-05
Kwal_56.238756801491119e-05
YER013W (PRP22)1145721030.001
AGL184W6831931020.001
YLR117C (CLF1)687195980.004
AAR020W111290940.013
CAGL0D02376g69581930.013
Kwal_55.21029110594920.020
Sklu_2440.1882452870.082
KLLA0B11638g111147860.094
CAGL0F02915g835149850.12
KLLA0A01969g79879800.44
Scas_689.340092770.93
Scas_705.55907170771.2
AAR131W80382761.6
ACL086C120753752.1
Kwal_56.23079372118723.6
Kwal_47.17481124996724.3
CAGL0J09878g634117724.5
Sklu_2401.838760714.8
Kwal_23.3670802140715.0
Kwal_56.2306590796715.5
AER393C369726716.6
Sklu_1951.262843706.9
CAGL0E01903g42973697.8
YBR112C (SSN6)966140699.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M04829g
         (1680 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M04829g complement(524685..529805) similar to sp|Q05022 Sac...  3199   0.0  
YMR229C (RRP5) [4185] chr13 complement(725933..731122) Protein r...  2039   0.0  
Scas_594.4                                                           1995   0.0  
Sklu_2383.1 YMR229C, Contig c2383 993-6155                           1845   0.0  
Kwal_26.9189                                                         1731   0.0  
AFR566C [3758] [Homologous to ScYMR229C (RRP5) - SH] (1449324..1...  1717   0.0  
KLLA0B08239g 729850..735039 similar to sp|Q05022 Saccharomyces c...  1296   0.0  
KLLA0F17996g 1645592..1647646 similar to sgd|S0004107 Saccharomy...    54   1e-06
Scas_713.42                                                            50   1e-05
Kwal_56.23875                                                          47   9e-05
YER013W (PRP22) [1436] chr5 (178840..182277) Pre-mRNA splicing f...    44   0.001
AGL184W [4128] [Homologous to ScYLR117C (CLF1) - SH] complement(...    44   0.001
YLR117C (CLF1) [3530] chr12 complement(382472..384535) Essential...    42   0.004
AAR020W [206] [Homologous to ScYER013W (PRP22) - SH] complement(...    41   0.013
CAGL0D02376g complement(244241..246328) similar to tr|Q12309 Sac...    40   0.013
Kwal_55.21029                                                          40   0.020
Sklu_2440.18 YDR416W, Contig c2440 29476-31950                         38   0.082
KLLA0B11638g complement(1020591..1023926) similar to sp|P24384 S...    38   0.094
CAGL0F02915g 281010..283517 similar to sp|Q04048 Saccharomyces c...    37   0.12 
KLLA0A01969g complement(178458..180854) similar to sgd|S0002824 ...    35   0.44 
Scas_689.3                                                             34   0.93 
Scas_705.55                                                            34   1.2  
AAR131W [318] [Homologous to ScYDR416W (SYF1) - SH] complement(5...    34   1.6  
ACL086C [963] [Homologous to ScYNL091W - SH] (192736..196359) [3...    33   2.1  
Kwal_56.23079                                                          32   3.6  
Kwal_47.17481                                                          32   4.3  
CAGL0J09878g complement(964057..965961) similar to sp|P32367 Sac...    32   4.5  
Sklu_2401.8 , Contig c2401 16254-17417                                 32   4.8  
Kwal_23.3670                                                           32   5.0  
Kwal_56.23065                                                          32   5.5  
AER393C [2893] [Homologous to ScYHR099W (TRA1) - SH] (1375025..1...    32   6.6  
Sklu_1951.2 YMR036C, Contig c1951 1440-3326                            32   6.9  
CAGL0E01903g 190228..191517 similar to tr|Q12383 Saccharomyces c...    31   7.8  
YBR112C (CYC8) [302] chr2 complement(462826..465726) General rep...    31   9.2  

>CAGL0M04829g complement(524685..529805) similar to sp|Q05022
            Saccharomyces cerevisiae YMR229c RRP5, hypothetical start
          Length = 1706

 Score = 3199 bits (8293), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1592/1680 (94%), Positives = 1592/1680 (94%)

Query: 1    MSTSSDFPLSKEDGTRQPEKSTLVRTTEEISFPRGGSSALTPLELKHVANEAAHDVLFGN 60
            MSTSSDFPLSKEDGTRQPEKSTLVRTTEEISFPRGGSSALTPLELKHVANEAAHDVLFGN
Sbjct: 1    MSTSSDFPLSKEDGTRQPEKSTLVRTTEEISFPRGGSSALTPLELKHVANEAAHDVLFGN 60

Query: 61   EKRPLTEDDAGXXXXXXXXXXXXXXXXXXXXXXXQRSAIIEHLNFNNVKEGTILLGQIDS 120
            EKRPLTEDDAG                       QRSAIIEHLNFNNVKEGTILLGQIDS
Sbjct: 61   EKRPLTEDDAGKPKKKKKRSSKKDTETVTDDTTEQRSAIIEHLNFNNVKEGTILLGQIDS 120

Query: 121  ITKNDLRITFTDGLSGFVDLTHISEQLTSLLXXXXXXXXXXXXXXXXXXXXXXXXXXQKS 180
            ITKNDLRITFTDGLSGFVDLTHISEQLTSLL                          QKS
Sbjct: 121  ITKNDLRITFTDGLSGFVDLTHISEQLTSLLEDIDEDMDSDSKEDDAEYESSDDESEQKS 180

Query: 181  LPNLRHYFKVGQWLRCAVTKNTALKPKNAKQKKRIELTIEPSVVNNFDVEDINKNTIIQC 240
            LPNLRHYFKVGQWLRCAVTKNTALKPKNAKQKKRIELTIEPSVVNNFDVEDINKNTIIQC
Sbjct: 181  LPNLRHYFKVGQWLRCAVTKNTALKPKNAKQKKRIELTIEPSVVNNFDVEDINKNTIIQC 240

Query: 241  SVESIEDHGATLDLGVPSLTGFIAKKDCTNFDELKPGSVFISCITKKTDRSIVVSQDFSV 300
            SVESIEDHGATLDLGVPSLTGFIAKKDCTNFDELKPGSVFISCITKKTDRSIVVSQDFSV
Sbjct: 241  SVESIEDHGATLDLGVPSLTGFIAKKDCTNFDELKPGSVFISCITKKTDRSIVVSQDFSV 300

Query: 301  KKNKMTSISSIDSVLPGQVVDLLCEEITDSGIVGKVFGSISAFIGKPHLQTFSEEDIKHK 360
            KKNKMTSISSIDSVLPGQVVDLLCEEITDSGIVGKVFGSISAFIGKPHLQTFSEEDIKHK
Sbjct: 301  KKNKMTSISSIDSVLPGQVVDLLCEEITDSGIVGKVFGSISAFIGKPHLQTFSEEDIKHK 360

Query: 361  FSLGSNIPCRILASVINKSGDRVLILSTLPHVISLNNTLGSIESLEAFPIGFIIDESVVK 420
            FSLGSNIPCRILASVINKSGDRVLILSTLPHVISLNNTLGSIESLEAFPIGFIIDESVVK
Sbjct: 361  FSLGSNIPCRILASVINKSGDRVLILSTLPHVISLNNTLGSIESLEAFPIGFIIDESVVK 420

Query: 421  GRDSSYLYLAISDKFIGRVHQSNLGEIIKQDKLKSRVIGYDVADCIFELTTDPEKLKLKY 480
            GRDSSYLYLAISDKFIGRVHQSNLGEIIKQDKLKSRVIGYDVADCIFELTTDPEKLKLKY
Sbjct: 421  GRDSSYLYLAISDKFIGRVHQSNLGEIIKQDKLKSRVIGYDVADCIFELTTDPEKLKLKY 480

Query: 481  IRSKDIPVGEVFNNCEILKASSSGVELKLLGGQFTAFVPPLHISDIRLIYPERKFKIASK 540
            IRSKDIPVGEVFNNCEILKASSSGVELKLLGGQFTAFVPPLHISDIRLIYPERKFKIASK
Sbjct: 481  IRSKDIPVGEVFNNCEILKASSSGVELKLLGGQFTAFVPPLHISDIRLIYPERKFKIASK 540

Query: 541  TKCRILNVDNHGHIIATMKKSLVNDEELEKPVIESFETAKSIKNKNEKTVGTVQSFNGHG 600
            TKCRILNVDNHGHIIATMKKSLVNDEELEKPVIESFETAKSIKNKNEKTVGTVQSFNGHG
Sbjct: 541  TKCRILNVDNHGHIIATMKKSLVNDEELEKPVIESFETAKSIKNKNEKTVGTVQSFNGHG 600

Query: 601  CVIMFFGGVTGFLPKSEVSEVFVKRAEDHLRLGQTVQVKVLEVDEERRRIIVTCKVSNEE 660
            CVIMFFGGVTGFLPKSEVSEVFVKRAEDHLRLGQTVQVKVLEVDEERRRIIVTCKVSNEE
Sbjct: 601  CVIMFFGGVTGFLPKSEVSEVFVKRAEDHLRLGQTVQVKVLEVDEERRRIIVTCKVSNEE 660

Query: 661  AQQQKSIIESLKIGQSIIETVVVEKTKDSVIVEIPDVGIRGVIYVGHISDERIEQCRAEI 720
            AQQQKSIIESLKIGQSIIETVVVEKTKDSVIVEIPDVGIRGVIYVGHISDERIEQCRAEI
Sbjct: 661  AQQQKSIIESLKIGQSIIETVVVEKTKDSVIVEIPDVGIRGVIYVGHISDERIEQCRAEI 720

Query: 721  KKIRIGSKLTGLVIDKDSRTQIFNLSLKKSLMKDAQNKRLPTTFAEITKFKKTDPLHGYV 780
            KKIRIGSKLTGLVIDKDSRTQIFNLSLKKSLMKDAQNKRLPTTFAEITKFKKTDPLHGYV
Sbjct: 721  KKIRIGSKLTGLVIDKDSRTQIFNLSLKKSLMKDAQNKRLPTTFAEITKFKKTDPLHGYV 780

Query: 781  KSISSTGVFVAFTGKFVGLVLPSYAVESRQVDIEKAFYSNQSVTAYLLRTDDDNERFLLT 840
            KSISSTGVFVAFTGKFVGLVLPSYAVESRQVDIEKAFYSNQSVTAYLLRTDDDNERFLLT
Sbjct: 781  KSISSTGVFVAFTGKFVGLVLPSYAVESRQVDIEKAFYSNQSVTAYLLRTDDDNERFLLT 840

Query: 841  LKAPKVEKAAETISAENIIDTSIKSVKDIKLGKILDAKIKGVKKNQLNIILADNVHGRVD 900
            LKAPKVEKAAETISAENIIDTSIKSVKDIKLGKILDAKIKGVKKNQLNIILADNVHGRVD
Sbjct: 841  LKAPKVEKAAETISAENIIDTSIKSVKDIKLGKILDAKIKGVKKNQLNIILADNVHGRVD 900

Query: 901  ISEVFDNYNDIKDKKHPLSHYKANDKVRVKIIGHHDLKSHKSLPITHNFVKGTVFELTMK 960
            ISEVFDNYNDIKDKKHPLSHYKANDKVRVKIIGHHDLKSHKSLPITHNFVKGTVFELTMK
Sbjct: 901  ISEVFDNYNDIKDKKHPLSHYKANDKVRVKIIGHHDLKSHKSLPITHNFVKGTVFELTMK 960

Query: 961  PSQLKSKDVKELDIRDITVGDEIIAFVNNYQNSTLWLTVTPTIKAKLSIFDLSEETLMNI 1020
            PSQLKSKDVKELDIRDITVGDEIIAFVNNYQNSTLWLTVTPTIKAKLSIFDLSEETLMNI
Sbjct: 961  PSQLKSKDVKELDIRDITVGDEIIAFVNNYQNSTLWLTVTPTIKAKLSIFDLSEETLMNI 1020

Query: 1021 KNVEDDFPLGSVLKVNVTGKDQNKSILQVTQRNGKINSIDDLKVGGHTIGKIVKVTPKYL 1080
            KNVEDDFPLGSVLKVNVTGKDQNKSILQVTQRNGKINSIDDLKVGGHTIGKIVKVTPKYL
Sbjct: 1021 KNVEDDFPLGSVLKVNVTGKDQNKSILQVTQRNGKINSIDDLKVGGHTIGKIVKVTPKYL 1080

Query: 1081 LIELENKITGISTALEALNDFTEPLDQVFAGKENEFVKAKITSVIADEKKVQLQLAEDES 1140
            LIELENKITGISTALEALNDFTEPLDQVFAGKENEFVKAKITSVIADEKKVQLQLAEDES
Sbjct: 1081 LIELENKITGISTALEALNDFTEPLDQVFAGKENEFVKAKITSVIADEKKVQLQLAEDES 1140

Query: 1141 TVQKITSHSDLKVGEVVNGLVKTVTDKGLFVFLGKSVEAFVPVSKLSDSYLKEWKKFYKP 1200
            TVQKITSHSDLKVGEVVNGLVKTVTDKGLFVFLGKSVEAFVPVSKLSDSYLKEWKKFYKP
Sbjct: 1141 TVQKITSHSDLKVGEVVNGLVKTVTDKGLFVFLGKSVEAFVPVSKLSDSYLKEWKKFYKP 1200

Query: 1201 MQPVVGKIVSCNEDDRILLTLRETEVNGDLKVLKNYSDIKPGDIFNGTVRNVTDFGVFVK 1260
            MQPVVGKIVSCNEDDRILLTLRETEVNGDLKVLKNYSDIKPGDIFNGTVRNVTDFGVFVK
Sbjct: 1201 MQPVVGKIVSCNEDDRILLTLRETEVNGDLKVLKNYSDIKPGDIFNGTVRNVTDFGVFVK 1260

Query: 1261 LDNTANVTGLAHITEIADEVPEDIQSIFGVGDRVKAYVLKSNPEKKQLSLSLKASHFNTN 1320
            LDNTANVTGLAHITEIADEVPEDIQSIFGVGDRVKAYVLKSNPEKKQLSLSLKASHFNTN
Sbjct: 1261 LDNTANVTGLAHITEIADEVPEDIQSIFGVGDRVKAYVLKSNPEKKQLSLSLKASHFNTN 1320

Query: 1321 ETITEKAESQPQPRKIDEDQDELMDDEVVYNXXXXXXXXXXXXXXXXTTVISNDGGLSLS 1380
            ETITEKAESQPQPRKIDEDQDELMDDEVVYN                TTVISNDGGLSLS
Sbjct: 1321 ETITEKAESQPQPRKIDEDQDELMDDEVVYNSESEASDDEEAHSSKSTTVISNDGGLSLS 1380

Query: 1381 AGFDWTTSILDQANAXXXXXXXXXXFMEXXXXXXXXXXXXXLVEDKTIDINTRAPESVAD 1440
            AGFDWTTSILDQANA          FME             LVEDKTIDINTRAPESVAD
Sbjct: 1381 AGFDWTTSILDQANASSDSESDEEDFMESKRSKNKKKKSKNLVEDKTIDINTRAPESVAD 1440

Query: 1441 FERLIIGNPNSSVIWMNYMAFQLQLSEIDKARELAERALKTINYREEAEKLNIWIAMLNL 1500
            FERLIIGNPNSSVIWMNYMAFQLQLSEIDKARELAERALKTINYREEAEKLNIWIAMLNL
Sbjct: 1441 FERLIIGNPNSSVIWMNYMAFQLQLSEIDKARELAERALKTINYREEAEKLNIWIAMLNL 1500

Query: 1501 ENTFGSEETLEDVFTRSCQYMDSFTMHSKLIGIYQLSEKFDKASELFKITTKKFGSEKTS 1560
            ENTFGSEETLEDVFTRSCQYMDSFTMHSKLIGIYQLSEKFDKASELFKITTKKFGSEKTS
Sbjct: 1501 ENTFGSEETLEDVFTRSCQYMDSFTMHSKLIGIYQLSEKFDKASELFKITTKKFGSEKTS 1560

Query: 1561 IWVSWASFVLSQNEPDQVGTILSSALKSLPKRNHIEVVRKFAQLEFSEGNPERGRSLFEG 1620
            IWVSWASFVLSQNEPDQVGTILSSALKSLPKRNHIEVVRKFAQLEFSEGNPERGRSLFEG
Sbjct: 1561 IWVSWASFVLSQNEPDQVGTILSSALKSLPKRNHIEVVRKFAQLEFSEGNPERGRSLFEG 1620

Query: 1621 LLADAPKRIDIWNVYLDQEIKQKDNKSRVEELFERVIKMKITRKQAKFFFNKWLQFEESN 1680
            LLADAPKRIDIWNVYLDQEIKQKDNKSRVEELFERVIKMKITRKQAKFFFNKWLQFEESN
Sbjct: 1621 LLADAPKRIDIWNVYLDQEIKQKDNKSRVEELFERVIKMKITRKQAKFFFNKWLQFEESN 1680

>YMR229C (RRP5) [4185] chr13 complement(725933..731122) Protein
            required for processing of pre-rRNA to 18S and 5.8S rRNA,
            component of U3 snoRNP (also called small subunit
            processome), which is required for 18S rRNA biogenesis
            [5190 bp, 1729 aa]
          Length = 1729

 Score = 2039 bits (5283), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1010/1698 (59%), Positives = 1273/1698 (74%), Gaps = 32/1698 (1%)

Query: 6    DFPLSKEDGTRQPEKSTLVRTTEEISFPRGGSSALTPLELKHVANEAAHDVLFGNEK--- 62
            DFPLS+ED T+QP  S+LVR TEE+SFPRGG+SALTPLELK VANEAA DVLFGNE    
Sbjct: 12   DFPLSREDSTKQPSTSSLVRNTEEVSFPRGGASALTPLELKQVANEAASDVLFGNESVKA 71

Query: 63   -----RPLTEDDAGXXXXXXXXXXXXXXXXXXXXXXXQRSAIIEHLNFNNVKEGTILLGQ 117
                 RPL +                            R+ +IEH+NF  +K G+ LLGQ
Sbjct: 72   SEPASRPLKK------KKTTKKSTSKDSEASSANSDEARAGLIEHVNFKTLKNGSSLLGQ 125

Query: 118  IDSITKNDLRITFTDGLSGFVDLTHISEQLTSLLXXXXXXXXXXXXXXXXXXXXXXXXXX 177
            I +ITK DL ITFTDG+SG+V+LTHISE+ TS+L                          
Sbjct: 126  ISAITKQDLCITFTDGISGYVNLTHISEEFTSILEDLDEDMDSDTDAADEKKSKVEDAEY 185

Query: 178  QKS------------LPNLRHYFKVGQWLRCAVTKNTALKPKNAK-QKKRIELTIEPSVV 224
            + S            LPNLR YF +GQWLRC+V KNT+L+P   K +KKRIELTIEPS V
Sbjct: 186  ESSDDEDEKLDKSNELPNLRRYFHIGQWLRCSVIKNTSLEPSTKKSKKKRIELTIEPSSV 245

Query: 225  NNFDVEDINKNTIIQCSVESIEDHGATLDLGVPSLTGFIAKKDCTNFDELKPGSVFISCI 284
            N +  ED+ K+T IQC+V+SIEDHGATLD+G+P  TGFIAKKD  NF++L PG+VF+  I
Sbjct: 246  NIYADEDLVKSTSIQCAVKSIEDHGATLDVGLPGFTGFIAKKDFGNFEKLLPGAVFLGNI 305

Query: 285  TKKTDRSIVVSQDFSVKKNKMTSISSIDSVLPGQVVDLLCEEITDSGIVGKVFGSISAFI 344
            TKK+DRSIVV+ DFS KKNK+T ISSID+++PGQ+VDLLCE IT +GI GKVFG +S  +
Sbjct: 306  TKKSDRSIVVNTDFSDKKNKITQISSIDAIIPGQIVDLLCESITKNGIAGKVFGLVSGVV 365

Query: 345  GKPHLQTFSEEDIKHKFSLGSNIPCRILASVINKSGDRVLILSTLPHVISLNNTLGSIES 404
               HL+TFSEED+KHKF +GS+I CRI+A + NKSGD+VLILS LPH++ L + L S E 
Sbjct: 366  NVSHLRTFSEEDLKHKFVIGSSIRCRIIACLENKSGDKVLILSNLPHILKLEDALRSTEG 425

Query: 405  LEAFPIGFIIDESVVKGRDSSYLYLAISDKFIGRVHQSNLGEIIKQDKLKSRVIGYDVAD 464
            L+AFPIG+  +   +KGRDS YLYLA+ D  +G+VH S +GEI   + L SRV+GY   D
Sbjct: 426  LDAFPIGYTFESCSIKGRDSEYLYLALDDDRLGKVHSSRVGEIENSENLSSRVLGYSPVD 485

Query: 465  CIFELTTDPEKLKLKYIRSKDIPVGEVFNNCEILKASSSGVELKLLGGQFTAFVPPLHIS 524
             I++L+TDP+ LKLKY+R+ DIP+GE+  +CEI   SSSG+ELK+  GQF A VPPLHIS
Sbjct: 486  DIYQLSTDPKYLKLKYLRTNDIPIGELLPSCEITSVSSSGIELKIFNGQFKASVPPLHIS 545

Query: 525  DIRLIYPERKFKIASKTKCRILNVDNHGHIIATMKKSLVNDEELEKPVIESFETAKSIKN 584
            D RL+YPERKFKI SK K R+++V++ G++  T+KKSLVN E+ E P++ ++E AK+IK 
Sbjct: 546  DTRLVYPERKFKIGSKVKGRVISVNSRGNVHVTLKKSLVNIEDNELPLVSTYENAKNIKE 605

Query: 585  KNEKTVGTVQSFNGHGCVIMFFGGVTGFLPKSEVSEVFVKRAEDHLRLGQTVQVKVLEVD 644
            KNEKT+ T+Q F  +GC+I FFGG++GFLP SE+SEVFVKR E+HLRLGQTV VK+L+VD
Sbjct: 606  KNEKTLATIQVFKPNGCIISFFGGLSGFLPNSEISEVFVKRPEEHLRLGQTVIVKLLDVD 665

Query: 645  EERRRIIVTCKVSNEEAQQQKSIIESLKIGQSIIETVVVEKTKDSVIVEIPDVGIRGVIY 704
             +RRRII TCKVSNE+A QQK  IE++  G++II   V+EKTKDSVIVEIPDVG+RGVIY
Sbjct: 666  ADRRRIIATCKVSNEQAAQQKDTIENIVPGRTIITVHVIEKTKDSVIVEIPDVGLRGVIY 725

Query: 705  VGHISDERIEQCRAEIKKIRIGSKLTGLVIDKDSRTQIFNLSLKKSLMKDAQNKRLPTTF 764
            VGH+SD RIEQ RA++KK+RIG++LTGLVIDKD+RT++FN+SLK SL+KDA+ + LP T+
Sbjct: 726  VGHLSDSRIEQNRAQLKKLRIGTELTGLVIDKDTRTRVFNMSLKSSLIKDAKKETLPLTY 785

Query: 765  AEITKFKKTDPLHGYVKSISSTGVFVAFTGKFVGLVLPSYAVESRQVDIEKAFYSNQSVT 824
             ++    K  P+H Y+KSIS  G+FVAF GKF+GLVLPSYAV+SR +DI KAFY NQSVT
Sbjct: 786  DDVKDLNKDVPMHAYIKSISDKGLFVAFNGKFIGLVLPSYAVDSRDIDISKAFYINQSVT 845

Query: 825  AYLLRTDDDNERFLLTLKAPKVEKAAETISA--ENIIDTSIKSVKDIKLGKILDAKIKGV 882
             YLLRTDD N++FLL+LKAPKV++  + + +  E+ +D+SIKS  D+ +G I+ AKIK V
Sbjct: 846  VYLLRTDDKNQKFLLSLKAPKVKEEKKKVESNIEDPVDSSIKSWDDLSIGSIVKAKIKSV 905

Query: 883  KKNQLNIILADNVHGRVDISEVFDNYNDIKDKKHPLSHYKANDKVRVKIIGHHDLKSHKS 942
            KKNQLN+ILA N+HGRVDI+EVFD Y +I DKK PLS+YK +D ++VKIIG+HD+KSHK 
Sbjct: 906  KKNQLNVILAANLHGRVDIAEVFDTYEEITDKKQPLSNYKKDDVIKVKIIGNHDVKSHKF 965

Query: 943  LPITHNFVKGTVFELTMKPSQLKSKDVKELDIRDITVGDEIIAFVNNYQNSTLWLTVTPT 1002
            LPITH   K +V EL+MKPS+LKSK+V    + +I +G E+  FVNN   + LWLT++P 
Sbjct: 966  LPITHKISKASVLELSMKPSELKSKEVHTKSLEEINIGQELTGFVNNSSGNHLWLTISPV 1025

Query: 1003 IKAKLSIFDLSEETLMNIKNVEDDFPLGSVLKVNVTGKDQNKSILQVTQRNGKINSIDDL 1062
            +KA++S+ DL++      +N+E  FPLGS L+V V   D+    +    ++    ++  +
Sbjct: 1026 LKARISLLDLADNDSNFSENIESVFPLGSALQVKVASIDREHGFVNAIGKSHVDINMSTI 1085

Query: 1063 KVGGHTIGKIVKVTPKYLLIELENKITGISTALEALNDFTEPLDQVFAGKENEFVKAKIT 1122
            KVG    G+++K+  KY+L++L NK+TGIS   +ALNDF+  L + F  K N  +   + 
Sbjct: 1086 KVGDELPGRVLKIAEKYVLLDLGNKVTGISFITDALNDFSLTLKEAFEDKINNVIPTTVL 1145

Query: 1123 SVIADEKKVQLQLAEDESTVQKITSHSDLKVGEVVNGLVKTVTDKGLFVFLGKSVEAFVP 1182
            SV    KK++L L    +  + I SH DLK GE+V+G+VK V DKG+FV+L + VEAFVP
Sbjct: 1146 SVDEQNKKIELSLRPATAKTRSIKSHEDLKQGEIVDGIVKNVNDKGIFVYLSRKVEAFVP 1205

Query: 1183 VSKLSDSYLKEWKKFYKPMQPVVGKIVSCNEDDRILLTLRETEVNGDLKVLKNYSDIKPG 1242
            VSKLSDSYLKEWKKFYKPMQ V+GK+V+C+ED RI LTLRE+E+NGDLKVLK YSDIK G
Sbjct: 1206 VSKLSDSYLKEWKKFYKPMQYVLGKVVTCDEDSRISLTLRESEINGDLKVLKTYSDIKAG 1265

Query: 1243 DIFNGTVRNVTDFGVFVKLDNTANVTGLAHITEIADEVPEDIQSIFGVGDRVKAYVLKSN 1302
            D+F GT+++VTDFGVFVKLDNT NVTGLAHITEIAD+ PED+ ++FGVGDRVKA VLK+N
Sbjct: 1266 DVFEGTIKSVTDFGVFVKLDNTVNVTGLAHITEIADKKPEDLSALFGVGDRVKAIVLKTN 1325

Query: 1303 PEKKQLSLSLKASHFNTNETITEKAESQPQPRKID-EDQDELMDDEVVYNXXXXXXXXXX 1361
            PEKKQ+SLSLKASHF+    +     +     +++ ED+DE+M D    +          
Sbjct: 1326 PEKKQISLSLKASHFSKEAELASTTTTTTTVDQLEKEDEDEVMADAGFNDSDSESDIGDQ 1385

Query: 1362 XXXXXXTTVISNDGGLSLSAGFDWTTSILDQANAXXXXXXXXXXFMEXXXXXXXXXXXXX 1421
                      ++  GLSLSAGFDWT SILDQA            F E             
Sbjct: 1386 NTEVADRKPETSSDGLSLSAGFDWTASILDQAQEEEESDQDQEDFTE-NKKHKHKRRKEN 1444

Query: 1422 LVEDKTIDINTRAPESVADFERLIIGNPNSSVIWMNYMAFQLQLSEIDKARELAERALKT 1481
            +V+DKTIDINTRAPESVADFERL+IGNPNSSV+WMNYMAFQLQLSEI+KARELAERALKT
Sbjct: 1445 VVQDKTIDINTRAPESVADFERLLIGNPNSSVVWMNYMAFQLQLSEIEKARELAERALKT 1504

Query: 1482 INYREEAEKLNIWIAMLNLENTFGSEETLEDVFTRSCQYMDSFTMHSKLIGIYQLSEKFD 1541
            IN+REEAEKLNIWIAMLNLENTFG+EETLE+VF+R+CQYMDS+T+H+KL+GIY++SEKFD
Sbjct: 1505 INFREEAEKLNIWIAMLNLENTFGTEETLEEVFSRACQYMDSYTIHTKLLGIYEISEKFD 1564

Query: 1542 KASELFKITTKKFGSEKTSIWVSWASFVLSQNEPDQVGTILSSALKSLPKRNHIEVVRKF 1601
            KA+ELFK T KKFG EK SIWVSW  F++S NE  +  TIL +ALK+LPKRNHIEVVRKF
Sbjct: 1565 KAAELFKATAKKFGGEKVSIWVSWGDFLISHNEEQEARTILGNALKALPKRNHIEVVRKF 1624

Query: 1602 AQLEFSEGNPERGRSLFEGLLADAPKRIDIWNVYLDQEIKQKDNKSRVEELFERVIKMKI 1661
            AQLEF++G+PERGRSLFEGL+ADAPKRID+WNVY+DQE+K KD K +VE+LFER+I  KI
Sbjct: 1625 AQLEFAKGDPERGRSLFEGLVADAPKRIDLWNVYVDQEVKAKDKK-KVEDLFERIITKKI 1683

Query: 1662 TRKQAKFFFNKWLQFEES 1679
            TRKQAKFFFNKWLQFEES
Sbjct: 1684 TRKQAKFFFNKWLQFEES 1701

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 41/84 (48%), Gaps = 4/84 (4%)

Query: 1441 FERLIIGNPNSSVIWMNYMAFQLQLSEIDKARELAERAL-KTINYREEAEKLNIWIAMLN 1499
            FE L+   P    +W  Y+  +++  +  K  +L ER + K I  ++     N W   L 
Sbjct: 1641 FEGLVADAPKRIDLWNVYVDQEVKAKDKKKVEDLFERIITKKITRKQAKFFFNKW---LQ 1697

Query: 1500 LENTFGSEETLEDVFTRSCQYMDS 1523
             E + G E+T+E V  ++ +Y+ S
Sbjct: 1698 FEESEGDEKTIEYVKAKATEYVAS 1721

>Scas_594.4
          Length = 1722

 Score = 1995 bits (5169), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 995/1698 (58%), Positives = 1269/1698 (74%), Gaps = 39/1698 (2%)

Query: 6    DFPLSKEDGTRQPEKSTLVRTTEEISFPRGGSSALTPLELKHVANEAAHDVLFGNEKRPL 65
            +FPL++ED T+QP  S+L+R TEE+SFPRGGSSALTPLELK VANEAA+DVLFG E    
Sbjct: 12   EFPLAREDATQQPTASSLMRNTEEVSFPRGGSSALTPLELKQVANEAANDVLFGKE---- 67

Query: 66   TEDDAGXXXXXXXXXXXXXXXXXXXXXXXQRS------AIIEHLNFNNVKEGTILLGQID 119
            T  D                                  ++++H+NF  +K G+++LGQI 
Sbjct: 68   TSTDVAESTTRPKKKKKTGKKSKKDTEEKTEEEDEETLSVVQHVNFKTLKIGSLVLGQIS 127

Query: 120  SITKNDLRITFTDGLSGFVDLTHISEQLTSLLXXXXXXXXXXXXXXXXXXXXXXXXXXQK 179
             I+K D+ I+FTDGLSG+V+LTHIS    ++L                           +
Sbjct: 128  EISKTDMCISFTDGLSGYVNLTHISAPFMTILEELDDDMDDDDELEKKKTDEEYDSSDDE 187

Query: 180  -----------SLPNLRHYFKVGQWLRCAVTKNTALKPKNAKQKKR-IELTIEPSVVNNF 227
                        LP+L +YFKVGQWLRC+V  NTAL PK+ K KK+ IEL+IEPSVVN  
Sbjct: 188  EEKEKATKDSIGLPSLENYFKVGQWLRCSVISNTALLPKDKKNKKKKIELSIEPSVVNTL 247

Query: 228  DVEDINKNTIIQCSVESIEDHGATLDLGVPSLTGFIAKKDCTNFDELKPGSVFISCITKK 287
              EDI ++  +QC+V+SIEDHGA LD+G+   TGFI+KKD   F++L PG+VF+  +TKK
Sbjct: 248  TEEDIVRSASVQCAVKSIEDHGAMLDIGIDGFTGFISKKDYPEFEKLLPGAVFLGNVTKK 307

Query: 288  TDRSIVVSQDFSVKKNKMTSISSIDSVLPGQVVDLLCEEITDSGIVGKVFGSISAFIGKP 347
            +DR++ ++ DFS KK K+T ISS+D+V+PGQVVDLLC+ IT++GIVGK FG + +FI   
Sbjct: 308  SDRTVTINLDFSDKKAKITHISSVDAVVPGQVVDLLCQTITNNGIVGKTFGLVPSFISTA 367

Query: 348  HLQTFSEEDIKHKFSLGSNIPCRILASVINKSGDRVLILSTLPHVISLNNTLGSIESLEA 407
            HL+ F EE++KH F++GSNIPCRI+A +I K  D+ L+LSTLPH+ SL N LG +E+L A
Sbjct: 368  HLRVFKEEELKHNFAVGSNIPCRIIAVLITKENDKTLLLSTLPHIKSLKNVLGEVENLTA 427

Query: 408  FPIGFIIDESVVKGRDSSYLYLAISDKFIGRVHQSNLGEIIKQDKLKSRVIGYDVADCIF 467
            FPIG +ID   VKGRDS YLYLA+ D  +G VH S +GE+ K DKLK+RV+G++  D ++
Sbjct: 428  FPIGHLIDSCTVKGRDSDYLYLAMDDDRVGEVHSSRIGELEKFDKLKARVLGFNSIDNLY 487

Query: 468  ELTTDPEKLKLKYIRSKDIPVGEVFNNCEILKASSSGVELKLLGGQFTAFVPPLHISDIR 527
            EL+TDPE LKLKY+RSKDIP+GEV  NCEI   SS G+ELK+  GQF A VPP+HISD R
Sbjct: 488  ELSTDPEILKLKYLRSKDIPIGEVLPNCEITAVSSKGIELKIFNGQFKAIVPPMHISDTR 547

Query: 528  LIYPERKFKIASKTKCRILNVDNHGHIIATMKKSLVNDEELEKPVIESFETAKSIKNKNE 587
            L+YPERKFKI SK K R+LN++N G I  T+KK+LVN E+ +  ++ +F  AK I+ KN+
Sbjct: 548  LVYPERKFKIGSKVKGRVLNINNRGLIYVTLKKTLVNIEDDDIQLLSNFAIAKEIQEKNQ 607

Query: 588  KTVGTVQSFNGHGCVIMFFGGVTGFLPKSEVSEVFVKRAEDHLRLGQTVQVKVLEVDEER 647
            KTV TV +F   GC++ FFGG+T FLP +E+SEVFV++ E+HLRLGQT+ VK+L++D+E 
Sbjct: 608  KTVATVTAFRPSGCIVAFFGGMTAFLPNAEISEVFVRKPEEHLRLGQTIVVKLLKIDQEN 667

Query: 648  RRIIVTCKVSNEEAQQQKSIIESLKIGQSIIETVVVEKTKDSVIVEIPDVGIRGVIYVGH 707
             R++VTCK+SN++A+++K  IE L  G+S+++  VVEKTKDSVIVE+P+  +RGVIYVGH
Sbjct: 668  ARMLVTCKISNDQAEKKKETIEKLIPGRSMVKVNVVEKTKDSVIVELPETSLRGVIYVGH 727

Query: 708  ISDERIEQCRAEIKKIRIGSKLTGLVIDKDSRTQIFNLSLKKSLMKDAQNKRLPTTFAEI 767
            +SD RIEQ RA IKKI IGS+L GLVIDKD+RTQ+FNLSLK+SL+KDA+N+  P T+A+I
Sbjct: 728  LSDARIEQNRAAIKKIAIGSELKGLVIDKDARTQVFNLSLKQSLIKDAKNEVSPLTYADI 787

Query: 768  TKFKKTDPLHGYVKSISSTGVFVAFTGKFVGLVLPSYAVESRQVDIEKAFYSNQSVTAYL 827
                KT PLHGY+KSIS+ G+FVAF GKFVGLVLPSYAVESR VDI K FY NQSVTAYL
Sbjct: 788  KSKSKTTPLHGYIKSISNKGLFVAFNGKFVGLVLPSYAVESRDVDISKTFYINQSVTAYL 847

Query: 828  LRTDDDNERFLLTLKAPKVEKAAETISAENI---IDTSIKSVKDIKLGKILDAKIKGVKK 884
            LR+DDDNERFLLTL+ P  +  +  ++       ID ++K +KD   GK++  +IKG+KK
Sbjct: 848  LRSDDDNERFLLTLRTPSTKDDSSKVTGTETLKPIDPAMKDLKDFTTGKVVKVQIKGIKK 907

Query: 885  NQLNIILADNVHGRVDISEVFDNYNDIKDKKHPLSHYKANDKVRVKIIGHHDLKSHKSLP 944
            NQLN++LADN+HGR+DI+EVFD+++DIK+  HPL  +K  + +  KIIG HD+KSH+ LP
Sbjct: 908  NQLNVVLADNLHGRIDIAEVFDSFSDIKNATHPLIDFKKGNIIDAKIIGTHDIKSHRFLP 967

Query: 945  ITHNFVKGTVFELTMKPSQLKSKDVKELDIRDITVGDEIIAFVNNYQNSTLWLTVTPTIK 1004
            I+H+ VKG+V EL++KPSQ++SKD+K L I D+ VGDE+  FVNNY ++TLWLTV+PT+K
Sbjct: 968  ISHHAVKGSVLELSLKPSQMRSKDIKTLSISDVAVGDELTGFVNNYGSNTLWLTVSPTLK 1027

Query: 1005 AKLSIFDLSEETLMNIKNVEDDFPLGSVLKVNVTGKDQNKSILQVTQRNGKINSIDDLKV 1064
            AK+S+FDL+E+ L + + VED+FPLG  L V VT  D    ++ VT R+    S + LKV
Sbjct: 1028 AKISLFDLAEDGLKSSEKVEDNFPLGCALPVKVTSIDTEHGVVNVTGRSHTEISFESLKV 1087

Query: 1065 GGHTIGKIVKVTPKYLLIELENKITGISTALEALNDFTEPLDQVFAGKENEFVKAKITSV 1124
            G +   +I+K+   Y+L++L NKI GI+   +AL+DF+ PL + + G EN+ V AKI S+
Sbjct: 1088 GDNVPSRIIKIADSYVLLDLGNKIHGIAFITDALDDFSVPLKEAYKGMENDIVSAKIVSI 1147

Query: 1125 IADEKKVQLQLAEDESTVQKITSHSDLKVGEVVNGLVKTVTDKGLFVFLGKSVEAFVPVS 1184
             A+ KKV L L  + +    I+SH+D+  G+VV+GLVK+++DKG+FV+L +S+ AFVPVS
Sbjct: 1148 DAENKKVNLSLRTESAKTPSISSHTDISQGDVVHGLVKSISDKGIFVYLSRSINAFVPVS 1207

Query: 1185 KLSDSYLKEWKKFYKPMQPVVGKIVSCNEDDRILLTLRETEVNGDLKVLKNYSDIKPGDI 1244
            KLSD+YLK+WKKF+KPMQ V+GK+V+  ED RILLTLRE+EVNGDLK+LKNY DIK  +I
Sbjct: 1208 KLSDTYLKDWKKFFKPMQYVIGKVVNAEEDSRILLTLRESEVNGDLKILKNYDDIKVNEI 1267

Query: 1245 FNGTVRNVTDFGVFVKLDNTANVTGLAHITEIADEVPEDIQSIFGVGDRVKAYVLKSNPE 1304
            +NG+V+NVTDFGVFVKLDNT NVTGLAH +EIAD+ PED+ S+FGVGDRVKAYVLK NPE
Sbjct: 1268 YNGSVKNVTDFGVFVKLDNTVNVTGLAHNSEIADQKPEDLASLFGVGDRVKAYVLKVNPE 1327

Query: 1305 KKQLSLSLKASHF-NTNETITEKAESQPQPRKIDEDQDELMDDEVVYNXXXXXXXXXXXX 1363
            KKQLSLSLKAS F NTNE+  E+ E+      +D D DE+M + V YN            
Sbjct: 1328 KKQLSLSLKASRFGNTNESKVEEKET------VDADGDEIM-EAVDYNNAPSDNENETEE 1380

Query: 1364 XXXXTT--VISNDGGLSLSAGFDWTTSILDQANAXXXXXXXXXXFMEXXXXXXXXXXXXX 1421
                 +   IS D GLSLS GFDWT SILDQA A          F E             
Sbjct: 1381 ILETVSKPKISTD-GLSLSTGFDWTASILDQAQA-EESSEEDEDFTE-TKRNRHKKRKQT 1437

Query: 1422 LVEDKTIDINTRAPESVADFERLIIGNPNSSVIWMNYMAFQLQLSEIDKARELAERALKT 1481
            +VEDKTIDINTRAPESVADFERLIIGNPNSSVIWMNYMAFQLQLSEI+KARELAERALKT
Sbjct: 1438 IVEDKTIDINTRAPESVADFERLIIGNPNSSVIWMNYMAFQLQLSEIEKARELAERALKT 1497

Query: 1482 INYREEAEKLNIWIAMLNLENTFGSEETLEDVFTRSCQYMDSFTMHSKLIGIYQLSEKFD 1541
            IN+REE+EK NIW+AMLNLENTFGS+ETLEDVF R+CQYMDSFTMH++L+ IYQ+S K D
Sbjct: 1498 INFREESEKQNIWMAMLNLENTFGSDETLEDVFKRACQYMDSFTMHNRLLSIYQMSGKID 1557

Query: 1542 KASELFKITTKKFGSEKTSIWVSWASFVLSQNEPDQVGTILSSALKSLPKRNHIEVVRKF 1601
            KA+ELFKIT KKFGSE  SIWVSW  F+ S  +  +   ILS+ALK+LPKR+HIEVVRKF
Sbjct: 1558 KAAELFKITAKKFGSENVSIWVSWGDFLTSHGKAQEARGILSNALKALPKRDHIEVVRKF 1617

Query: 1602 AQLEFSEGNPERGRSLFEGLLADAPKRIDIWNVYLDQEIKQKDNKSRVEELFERVIKMKI 1661
            AQLEF++G+PE GRSLFEGL+ADAPKRIDIWNVYLDQEIK  + K +VE+LFERV+  KI
Sbjct: 1618 AQLEFAKGDPEGGRSLFEGLIADAPKRIDIWNVYLDQEIKANEKK-KVEDLFERVVSRKI 1676

Query: 1662 TRKQAKFFFNKWLQFEES 1679
            TRKQAKFFFNKWL+FEES
Sbjct: 1677 TRKQAKFFFNKWLEFEES 1694

>Sklu_2383.1 YMR229C, Contig c2383 993-6155
          Length = 1720

 Score = 1845 bits (4780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 908/1686 (53%), Positives = 1209/1686 (71%), Gaps = 22/1686 (1%)

Query: 8    PLSKEDGTRQPEKSTLVRTTEEISFPRGGSSALTPLELKHVANEAAHDVLFGNEKRPLTE 67
            PL+++D T QP KS+L++++EE SFPRGG+S LTPLELK VANEAA DVLF N      +
Sbjct: 15   PLTRQDNTSQPVKSSLLQSSEETSFPRGGASVLTPLELKQVANEAASDVLFDNGTSSAVK 74

Query: 68   DDAGXXXXXXXXXXXXXXXXXXXXXXXQRSAIIEHLNFNNVKEGTILLGQIDSITKNDLR 127
             +                         + + I+EH++F N+  G+ LLGQI ++ K+DL 
Sbjct: 75   PEV-ERPKKKKKTSKSTTGTKNETDEEESTTIVEHISFKNLTPGSQLLGQISAVNKHDLC 133

Query: 128  ITFTDGLSGFVDLTHISEQLTSLLXXXXXXXXXXXXXXXXXXXXX-------XXXXXQKS 180
            I+ +D L G+V L +ISEQ T+LL                                  K 
Sbjct: 134  ISLSDNLCGYVTLANISEQFTNLLEELDENMEKDQDSEDDDSDYDSSDEDEHSKNKKNKE 193

Query: 181  LPNLRHYFKVGQWLRCAVTKNTALKPKNAKQKKRIELTIEPSVVNNFDVEDINKNTIIQC 240
            LP+L+ YFK GQWLRC V  NTAL+ K  K++KRIELTIEPS  N    ED+++N  +QC
Sbjct: 194  LPDLKKYFKPGQWLRCTVQSNTALEAK--KKQKRIELTIEPSATNQLADEDLSRNCTVQC 251

Query: 241  SVESIEDHGATLDLGVPSLTGFIAKKDCTNFDELKPGSVFISCITKKTDRSIVVSQDFSV 300
            SV+SIEDHGA LDLG+  +TGFI+KKD    +EL PG+VF+  + K++DR++ V+ DF+ 
Sbjct: 252  SVKSIEDHGAILDLGIKGITGFISKKDYPGVEELLPGTVFLGNVAKRSDRTVNVNFDFTS 311

Query: 301  KKNKMTSISSIDSVLPGQVVDLLCEEITDSGIVGKVFGSISAFIGKPHLQTFSEEDIKHK 360
            K NK++ ISSID+V+PGQ VD LC++I+ +GI GK FG +S F+G  HL+TFS + IKH 
Sbjct: 312  KNNKVSHISSIDAVIPGQSVDFLCQKISSNGIFGKTFGLVSGFLGASHLRTFSADKIKHN 371

Query: 361  FSLGSNIPCRILASVINKSGDRVLILSTLPHVISLNNTLGSIESLEAFPIGFIIDESVVK 420
            +++GSNI  RI+A++ NK G++++++STLPH++SL   +   ++L+AFP+G+I++   VK
Sbjct: 372  YAIGSNIRARIVATLTNKKGEKIILVSTLPHILSLETKILEADALDAFPVGYILESCTVK 431

Query: 421  GRDSSYLYLAISDKFIGRVHQSNLGEIIKQDKLKSRVIGYDVADCIFELTTDPEKLKLKY 480
            GRDS Y YL++    IG+VH S +G+     ++K+RV+GY+V D  ++L+TDP+ L+LKY
Sbjct: 432  GRDSQYFYLSMDQDRIGQVHISRVGDEDPAGEVKARVMGYNVVDGYYQLSTDPKVLELKY 491

Query: 481  IRSKDIPVGEVFNNCEILKASSSGVELKLLGGQFTAFVPPLHISDIRLIYPERKFKIASK 540
            +R+KDIP+GEV + CEI+  S  G++L L G QF AFVPPLHISD++L+YPERKFKI SK
Sbjct: 492  LRTKDIPLGEVISGCEIVTVSDKGIQLTLFGSQFKAFVPPLHISDVKLVYPERKFKIGSK 551

Query: 541  TKCRILNVDNHGHIIATMKKSLVNDEELEKPVIESFETAKSIKNKNEKTVGTVQSFNGHG 600
             K R+LNVDN G +  T+KKSLVN +E E  ++ +F+  + + + +EKT  TV+ F  +G
Sbjct: 552  VKGRVLNVDNRGRVTVTLKKSLVNLDEDEIKLVSNFKQIEKLADNDEKTSATVEFFKTNG 611

Query: 601  CVIMFFGGVTGFLPKSEVSEVFVKRAEDHLRLGQTVQVKVLEVDEERRRIIVTCKVSNEE 660
            CV+ F G + GFLP  E+SE FVKR +DHLRLGQTV VKVL+ DEE+ R+I+TCKVS++ 
Sbjct: 612  CVVSFLGNLKGFLPNGEISEAFVKRPQDHLRLGQTVMVKVLQHDEEKNRVIITCKVSSDA 671

Query: 661  AQQQKSIIESLKIGQSIIETVVVEKTKDSVIVEIPDVGIRGVIYVGHISDERIEQCRAEI 720
            A QQK  IE++ IG+SI+   VV KTKDS ++E+ DVG+RGVIYVGH+SD RIEQ RA++
Sbjct: 672  AAQQKDAIENMVIGRSIVTVTVVGKTKDSAVIELVDVGLRGVIYVGHLSDSRIEQNRAQL 731

Query: 721  KKIRIGSKLTGLVIDKDSRTQIFNLSLKKSLMKDAQNKRLPTTFAEITKFKKTDPLHGYV 780
            KK+R+G++L GLVIDKD RT++FNLS KKSL+KDAQN  LP ++ E+     + P+HGYV
Sbjct: 732  KKLRVGTELEGLVIDKDIRTRVFNLSCKKSLIKDAQNGLLPLSYDEVKAKGNSFPMHGYV 791

Query: 781  KSISSTGVFVAFTGKFVGLVLPSYAVESRQVDIEKAFYSNQSVTAYLLRTDDDNERFLLT 840
            KS S  G+FVAF+G+FVGLVLPSYAVESR VDI K F+ NQS+TAYLLRTDD+NERFLLT
Sbjct: 792  KSFSDKGIFVAFSGRFVGLVLPSYAVESRDVDILKKFHINQSITAYLLRTDDENERFLLT 851

Query: 841  LKAPKVEKAAE---TISAENIIDTSIKSVKDIKLGKILDAKIKGVKKNQLNIILADNVHG 897
            LK PKV +  +   +++A N ID S+K + +  +GK+  AKIK VKKNQLN++LADN+HG
Sbjct: 852  LKEPKVAEKRQDNGSVNAVNPIDESVKELSEYVVGKVTKAKIKAVKKNQLNVLLADNLHG 911

Query: 898  RVDISEVFDNYNDIKDKKHPLSHYKANDKVRVKIIGHHDLKSHKSLPITHNFVKGTVFEL 957
            RVD+SE+FD + +IKD K PLS YK  D + VK+IG+HD+K+H+ LPI+H   K T+ EL
Sbjct: 912  RVDVSEIFDKFENIKDTKAPLSCYKKGDVIEVKVIGYHDIKTHRFLPISHRASKNTILEL 971

Query: 958  TMKPSQLKSKDVKELDIRDITVGDEIIAFVNNYQNSTLWLTVTPTIKAKLSIFDLSEETL 1017
            T KPS+L  ++   L I+++   DE++ FVNN+    LWLT++P +KAK+S  +LS++  
Sbjct: 972  TAKPSKLTEENESSLTIKNVKENDELVGFVNNFSKGFLWLTLSPVLKAKISNINLSDDGS 1031

Query: 1018 MNIKNVEDDFPLGSVLKVNVTGKDQNKSILQVTQRNGKINSIDDLKVGGHTIGKIVKVTP 1077
                ++ + FPLGS LKV     D   +++ VT R   I  I D+KVG     +I+ +  
Sbjct: 1032 TFASDIPESFPLGSALKVKAVDIDTEHNVVSVTGRFHSIKDITDVKVGDKLPARIIMIAD 1091

Query: 1078 KYLLIELENKITGISTALEALNDFTEPLDQVFAGKENEFVKAKITSVIADEKKVQLQLAE 1137
             YLL++L N + GIS   EAL+D++  L   F  ++N  V A + SV   +KKV+L L  
Sbjct: 1092 SYLLLDLGNDLKGISFVTEALDDYSVSLKTAFENRKNSIVPATVISVDLKDKKVKLSLRS 1151

Query: 1138 DESTVQKITSHSDLKVGEVVNGLVKTVTDKGLFVFLGKSVEAFVPVSKLSDSYLKEWKKF 1197
             +   ++I S+ DL  G+VV G +K V+DKG+FV+L  SV+AFVPVSKL+DS++K+WKKF
Sbjct: 1152 TKPKDREIKSYKDLSRGDVVRGFIKAVSDKGIFVYLSTSVQAFVPVSKLTDSFIKDWKKF 1211

Query: 1198 YKPMQPVVGKIVSCNEDDRILLTLRETEVNGDLKVLKNYSDIKPGDIFNGTVRNVTDFGV 1257
            YKPMQPV GK+V+C E+ RILLTL+E+EVNGDL +LK YS+I+ G+IF G + NVTDFGV
Sbjct: 1212 YKPMQPVTGKVVNCEEESRILLTLKESEVNGDLNILKGYSNIQAGEIFEGYITNVTDFGV 1271

Query: 1258 FVKLDNTANVTGLAHITEIADEVPEDIQSIFGVGDRVKAYVLKSNPEKKQLSLSLKASHF 1317
            FVKL+NT NVTGLAH ++IAD   +D+ ++FG GD+VKA VLK+NPEKKQ+SL LKAS+F
Sbjct: 1272 FVKLNNTLNVTGLAHRSQIADSQVDDLSALFGEGDKVKAIVLKTNPEKKQVSLGLKASYF 1331

Query: 1318 NTNETITEKAESQPQPRKIDEDQDELMDDEVVY----NXXXXXXXXXXXXXXXXTTVISN 1373
                   EK +        D  ++E  +DE++     N                + V   
Sbjct: 1332 KKE---VEKNQEVEDVEMEDVAENESEEDEIIAVDYENESELEAEPEKEATSQSSKVPVT 1388

Query: 1374 DGGLSLSAGFDWTTSILDQANAXXXXXXXXXXFMEXXXXXXXXXXXXXLVEDKTIDINTR 1433
            + GLSLS GFDWT SILDQA            F                VEDKTIDINTR
Sbjct: 1389 NDGLSLSTGFDWTASILDQAQE-DEESSEDEDFANTKKSRNRKKGRTNAVEDKTIDINTR 1447

Query: 1434 APESVADFERLIIGNPNSSVIWMNYMAFQLQLSEIDKARELAERALKTINYREEAEKLNI 1493
            APESV+DFERLI+GNPNSSV+WMNYMAFQLQLSE+DKARE+AERALKTI++R+E EKLNI
Sbjct: 1448 APESVSDFERLIMGNPNSSVVWMNYMAFQLQLSEVDKAREIAERALKTISFRDELEKLNI 1507

Query: 1494 WIAMLNLENTFGSEETLEDVFTRSCQYMDSFTMHSKLIGIYQLSEKFDKASELFKITTKK 1553
            WIAMLNLENTFG+EETL+D F RSCQYMDSFTMH+KLI IYQLSEKF++A+EL++ T KK
Sbjct: 1508 WIAMLNLENTFGTEETLDDAFKRSCQYMDSFTMHNKLISIYQLSEKFERAAELYRATAKK 1567

Query: 1554 FGSEKTSIWVSWASFVLSQNEPDQVGTILSSALKSLPKRNHIEVVRKFAQLEFSEGNPER 1613
            FGS+K SIWVSW  F++S+N+ D+   +L +ALK+LPKR+HIEVVRKFAQLEFS+G+ E+
Sbjct: 1568 FGSQKVSIWVSWGEFLISRNQNDEAHAVLGNALKALPKRDHIEVVRKFAQLEFSKGDAEQ 1627

Query: 1614 GRSLFEGLLADAPKRIDIWNVYLDQEIKQKDNKSRVEELFERVIKMKITRKQAKFFFNKW 1673
            GRSLFEGLLADAPKRID+WNVY+DQE K  + K +VE+LFER+I  KITRKQAKFFFNKW
Sbjct: 1628 GRSLFEGLLADAPKRIDLWNVYIDQETKAGE-KKKVEDLFERIISKKITRKQAKFFFNKW 1686

Query: 1674 LQFEES 1679
            LQFEES
Sbjct: 1687 LQFEES 1692

>Kwal_26.9189
          Length = 1726

 Score = 1731 bits (4483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 869/1699 (51%), Positives = 1166/1699 (68%), Gaps = 36/1699 (2%)

Query: 8    PLSKEDGTRQPEKSTLVRTTEEISFPRGGSSALTPLELKHVANEAAHDVLFGNEKR-PLT 66
            PL+++D T+QP  S+L++  +E SFPRGG+SALTPLELK VANEAA DVLFG E   P  
Sbjct: 14   PLTRQDQTQQPS-SSLLQNADEGSFPRGGASALTPLELKQVANEAAGDVLFGAESAAPAP 72

Query: 67   EDDAGXXXXXXXXXXXXXXXXXXXXXXXQRSAIIEHLNFNNVKEGTILLGQIDSITKNDL 126
              D+                            +I+HLNF N+  GT+LLGQI  + K+DL
Sbjct: 73   VSDSQRPKKKKKTHQKSATKAADEDSEDSSVTVIDHLNFRNLPVGTLLLGQISQVNKHDL 132

Query: 127  RITFTDGLSGFVDLTHISEQLTSLLX------------XXXXXXXXXXXXXXXXXXXXXX 174
             ++ +D L GFV L  ISE  T LL                                   
Sbjct: 133  CVSLSDNLCGFVTLPSISEPFTKLLEDLDESMNSDGEEEVNGSEAEYDSDEESSKASRAQ 192

Query: 175  XXXQKSLPNLRHYFKVGQWLRCAVTKNTALKPKNAKQKKRIELTIEPSVVNNFDVEDINK 234
                K LP+L+ +F  GQWLRC+V  N+AL  K+ K+ KRIEL+IEPS+ N    ED+ +
Sbjct: 193  DTKGKELPDLQRFFSQGQWLRCSVQSNSALD-KDNKKSKRIELSIEPSITNQLVEEDLVR 251

Query: 235  NTIIQCSVESIEDHGATLDLGVPSLTGFIAKKDCTNFDELKPGSVFISCITKKTDRSIVV 294
            N  +QC+V+SIEDHGA LDLG+  +TGFI+KKD      L PGSVF++ + KK+ R+  V
Sbjct: 252  NCTVQCAVKSIEDHGAILDLGIEGITGFISKKDYALLPNLLPGSVFLANVAKKSGRTATV 311

Query: 295  SQDFSVKKNKMTSISSIDSVLPGQVVDLLCEEITDSGIVGKVFGSISAFIGKPHLQTFSE 354
            + DF  KK+K++ ISSID+++PGQ VD LC++ T +G++GKVFG +  F+       F  
Sbjct: 312  NFDFKNKKSKVSHISSIDAIIPGQAVDFLCQKKTSNGVIGKVFGLVDGFLNVSQQSAFYS 371

Query: 355  EDIKH--KFSLGSNIPCRILASVINKSGDRVLILSTLPHVISLNNTLGSIESLEAFPIGF 412
               K+   +S+GSN   RILA+++NK+G++ +++S LPH++S         +L AFP+G+
Sbjct: 372  SGKKNDEAYSVGSNTRVRILATLMNKAGEKFVVVSELPHILSFATEALERPALNAFPVGY 431

Query: 413  IIDESVVKGRDSSYLYLAISDKFIGRVHQSNLGEIIKQDKLKSRVIGYDVADCIFELTTD 472
            I ++  + GRDS Y YL I++  +G+VH S +G      K+++RV+GY+  D  ++L+TD
Sbjct: 432  IFEDCDLMGRDSQYFYLKINNDLVGQVHISKIGTEEPSGKVRARVLGYNNLDGYYQLSTD 491

Query: 473  PEKLKLKYIRSKDIPVGEVFNNCEILKASSSGVELKLLGGQFTAFVPPLHISDIRLIYPE 532
            P+ L +KY+R+ DIPVG +  +CEI + S  G++L +LGGQF A VPPLHISDIRL+YPE
Sbjct: 492  PKTLSVKYLRTSDIPVGTIIPSCEITQVSDKGIQLSILGGQFKASVPPLHISDIRLVYPE 551

Query: 533  RKFKIASKTKCRILNVDNHGHIIATMKKSLVNDEELEKPVIESFETAKSIKNKNEKTVGT 592
            RKFKI SK K  +++ +N GH+  ++KKSLVN +  E  +  SF+    I     K   T
Sbjct: 552  RKFKIGSKVKAILISANNRGHLFVSLKKSLVNLDREEVQLASSFQDIDRIATDGLKVAAT 611

Query: 593  VQSFNGHGCVIMFFGGVTGFLPKSEVSEVFVKRAEDHLRLGQTVQVKVLEVDEERRRIIV 652
            V  F  +GCV+ F GG+ GFLP SE+SE FVKR +DHLRLGQTV VKVL+ + ++ R+IV
Sbjct: 612  VDIFKTNGCVVSFLGGLRGFLPNSEISEAFVKRPQDHLRLGQTVIVKVLQHNAQQNRVIV 671

Query: 653  TCKVSNEEAQQQKSIIESLKIGQSIIETVVVEKTKDSVIVEIPDVGIRGVIYVGHISDER 712
            TCKVS+E A QQK  IE++ +G+SII+  VVEKTKDS++VE   VG+RGV+YVGH+SD R
Sbjct: 672  TCKVSSEAASQQKEAIENMIVGRSIIKVAVVEKTKDSLVVEQVGVGLRGVVYVGHLSDSR 731

Query: 713  IEQCRAEIKKIRIGSKLTGLVIDKDSRTQIFNLSLKKSLMKDAQNKRLPTTFAEITKFKK 772
            IEQ RA++KKI+IG++  GLVIDKD+RT++FNLS KKSL+KDA+   LP  + ++ +   
Sbjct: 732  IEQNRAQLKKIKIGNEFEGLVIDKDARTRVFNLSCKKSLIKDAEKSLLPVNYQDVKERGT 791

Query: 773  TDPLHGYVKSISSTGVFVAFTGKFVGLVLPSYAVESRQVDIEKAFYSNQSVTAYLLRTDD 832
               ++GYVKS+S  GVFVAF G+FVGLVLPSYAV+SR VD+   FYSNQSVT YLLRTDD
Sbjct: 792  HSAMNGYVKSVSEKGVFVAFNGQFVGLVLPSYAVDSRDVDLASKFYSNQSVTVYLLRTDD 851

Query: 833  DNERFLLTLKAPKVEKAAETI----SAENIIDTSIKSVKDIKLGKILDAKIKGVKKNQLN 888
             NERFLLT+K PK EK+++ I     A N +D+SIK + D  +GKI  A +K VK+NQLN
Sbjct: 852  ANERFLLTMKEPKNEKSSKPIPEVRGAVNPVDSSIKDLSDFSVGKITKAMVKAVKRNQLN 911

Query: 889  IILADNVHGRVDISEVFDNYNDIKDKKHPLSHYKANDKVRVKIIGHHDLKSHKSLPITHN 948
            ++L+DN+HGR+DISEVFD   DI D K PL+ +K  D + VK+IG+HD+K+HK LP++H 
Sbjct: 912  VVLSDNLHGRIDISEVFDKIEDISDTKSPLATFKKGDLLDVKVIGYHDVKTHKFLPVSHR 971

Query: 949  FVKGTVFELTMKPSQLKSKDVKELDIRDITVGDEIIAFVNNYQNSTLWLTVTPTIKAKLS 1008
              K  + ELT KPS+L       +D  ++ VGD I+ FVNN     LWLTV+P +KAK+ 
Sbjct: 972  SSKNVLLELTAKPSRLNGAGGVAID--NVKVGDSIVGFVNNISKDILWLTVSPVLKAKID 1029

Query: 1009 IFDLSEETLMNIKNVEDDFPLGSVLKVNVTGKDQNKSILQVTQRNGKINSIDDLKVGGHT 1068
             FDL++E+  +  N+ED FPLGS L+  V   DQ+++ L V+ R+  ++ I D+ VG + 
Sbjct: 1030 FFDLTDESSQHNANIEDAFPLGSALRATVVKIDQDRNTLSVSGRSHSVSDIKDINVGDNL 1089

Query: 1069 IGKIVKVTPKYLLIELENKITGISTALEALNDFTEPLDQVFAGKENEFVKAKITSVIADE 1128
              +++ V   YLL+E+   + G++   +AL+D+T+ L  V+  ++N    AK+ SV    
Sbjct: 1090 PARLLNVADSYLLLEVGKDVKGVAFVTDALDDYTKSLKDVYGNQKNNIFSAKVISVDTKN 1149

Query: 1129 KKVQLQLAEDESTVQKITSHSDLKVGEVVNGLVKTVTDKGLFVFLGKSVEAFVPVSKLSD 1188
             K+ L L  +++    + +H DLK G++V GLVK  TDKG+FV+L  S++AFVPVSKL+D
Sbjct: 1150 GKLNLSLRSEDAQDGNVKTHKDLKRGQIVRGLVKKATDKGIFVYLSSSLQAFVPVSKLTD 1209

Query: 1189 SYLKEWKKFYKPMQPVVGKIVSCNEDDRILLTLRETEVNGDLKVLKNYSDIKPGDIFNGT 1248
            SY+KEWKKFY+PMQ VVGKIV+C++D  IL TL+E+EVNG L +LKNY+DIK G+IF G+
Sbjct: 1210 SYIKEWKKFYRPMQSVVGKIVNCDDDSHILATLKESEVNGTLNILKNYADIKVGEIFEGS 1269

Query: 1249 VRNVTDFGVFVKLDNTANVTGLAHITEIADEVPEDIQSIFGVGDRVKAYVLKSNPEKKQL 1308
            V+NVTDFG+FVKLDNT NVTGLAH +E+AD    D+ +IFG GD+VKA VLK N EKKQL
Sbjct: 1270 VKNVTDFGLFVKLDNTMNVTGLAHKSEVADAPVNDLSTIFGAGDKVKAVVLKVNAEKKQL 1329

Query: 1309 SLSLKASHFNTNETITEKAESQ--------PQPRKIDEDQDELMDDEVVYNXXXXXXXXX 1360
            SL LKAS+F  N+  + K E+            R +D   ++L+++    +         
Sbjct: 1330 SLGLKASYFKENKNTSPKLENSDVVSEDEVDDERDVDSASEDLVEEIGQESEPEEMEDIA 1389

Query: 1361 XXXXXXXTTVISNDGGLSLSAGFDWTTSILDQANAXXXXXXXXXXFMEXXXXXXXXXXXX 1420
                      +S D GLSLSAGFDWTTSILDQA            F E            
Sbjct: 1390 EDENHNGGKALSTD-GLSLSAGFDWTTSILDQAQ--DEDSSDEEDFTETKKSKKKKRSVG 1446

Query: 1421 XLVEDKTIDINTRAPESVADFERLIIGNPNSSVIWMNYMAFQLQLSEIDKARELAERALK 1480
              VED+TIDINTRAPESV DFER+I+GNPNSSV+WMN+MAFQLQL EIDKAR++AERALK
Sbjct: 1447 G-VEDQTIDINTRAPESVGDFERMIMGNPNSSVVWMNFMAFQLQLGEIDKARDVAERALK 1505

Query: 1481 TINYREEAEKLNIWIAMLNLENTFGSEETLEDVFTRSCQYMDSFTMHSKLIGIYQLSEKF 1540
            TI++REEAEK+NIWI MLNLENTFG+E +L +VF+R+CQYMDS+ +H+KLI IYQ+S   
Sbjct: 1506 TISFREEAEKMNIWIGMLNLENTFGNESSLNEVFSRACQYMDSYVIHTKLINIYQMSHNI 1565

Query: 1541 DKASELFKITTKKFGSEKTSIWVSWASFVLSQNEPDQVGTILSSALKSLPKRNHIEVVRK 1600
            DKA+ LFK T KKFGSEK  IWVSW  F++ Q + D+   +L+SALKSLP+R+HIEVVRK
Sbjct: 1566 DKAAALFKATAKKFGSEKVPIWVSWGEFLIDQGQADEAHQVLASALKSLPRRHHIEVVRK 1625

Query: 1601 FAQLEFSEGNPERGRSLFEGLLADAPKRIDIWNVYLDQEIKQKDNKSRVEELFERVIKMK 1660
            FAQLEF++G+ E+GRSLFEGLLAD PKRID+WNVY+DQEIK  D K +VE+LFER++  K
Sbjct: 1626 FAQLEFAKGDQEQGRSLFEGLLADTPKRIDLWNVYVDQEIKAGDKK-KVEDLFERIVNRK 1684

Query: 1661 ITRKQAKFFFNKWLQFEES 1679
            +TRKQAKFFF KWL+FEES
Sbjct: 1685 LTRKQAKFFFGKWLEFEES 1703

>AFR566C [3758] [Homologous to ScYMR229C (RRP5) - SH]
            (1449324..1454474) [5151 bp, 1716 aa]
          Length = 1716

 Score = 1717 bits (4447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 858/1685 (50%), Positives = 1162/1685 (68%), Gaps = 30/1685 (1%)

Query: 11   KEDGTRQPEKSTLVRTTEEISFPRGGSSALTPLELKHVANEAAHDVLFG-NEKRPLTEDD 69
            +E   RQ    +++ +  +++FPRGG+SALTPLELK VANEAA DVLFG ++ +P  E  
Sbjct: 18   EEAAGRQMASKSVLASGGDVAFPRGGASALTPLELKQVANEAASDVLFGRDDGKPAEE-- 75

Query: 70   AGXXXXXXXXXXXXXXXXXXXXXXXQRSAIIEHLNFNNVKEGTILLGQIDSITKNDLRIT 129
                                      R+ I+EHL+F  +  GT+LLGQ+  + + DL I 
Sbjct: 76   ----RPRKKKKTSKASKEDAVAGKEDRTDIVEHLSFKGLTSGTVLLGQLCGVNRTDLCIA 131

Query: 130  FTDGLSGFVDLTHISEQLTSLLXXXXXXXXXXXXXXXXXXXXXXXXXXQK--SLPNLRHY 187
             TDGL G+V LT+IS   TSLL                               LP L  Y
Sbjct: 132  LTDGLRGYVPLTNISAPFTSLLEQLDQSMDSGSEDEDDDSDDEQRDKPHTITELPELSKY 191

Query: 188  FKVGQWLRCAVTKNTALKPKNAKQKKRIELTIEPSVVNNFDVEDINKNTIIQCSVESIED 247
            F +GQWLRC V KN+AL  +  K+  RIEL+IEPS VN F+ ED+ K+T +QC+V+SIED
Sbjct: 192  FTLGQWLRCVVVKNSALDSQK-KKNSRIELSIEPSKVNLFETEDLAKHTTVQCAVKSIED 250

Query: 248  HGATLDLGVPSLTGFIAKKDCTNFDELKPGSVFISCITKKTDRSIVVSQDFSVKKNKMTS 307
            HGA LDLGV  +TGFI+ KD +   ++ PGSVF++ ITK+ DR+  V+ +F+ K +K++ 
Sbjct: 251  HGALLDLGVQDVTGFISNKDLSKMGDVMPGSVFLANITKRGDRTATVNFEFTAKNSKVSQ 310

Query: 308  ISSIDSVLPGQVVDLLCEEITDSGIVGKVFGSISAFIGKPHLQTFSEEDIKHKFSLGSNI 367
            ISS+D+V+PG  +D LCE+IT+ GI+GK FG +  F+ +   + FS  D+KHK+++GSNI
Sbjct: 311  ISSVDAVIPGHTIDFLCEKITNHGIIGKAFGVLDGFLSESQARVFSVTDMKHKYAIGSNI 370

Query: 368  PCRILASVINKSGDRVLILSTLPHVISLNNTLGSIESLEAFPIGFIIDESVVKGRDSSYL 427
              RI+A++  K G++V+++S LPH++SL   L   E++ AFP+G++ D   + GRDS YL
Sbjct: 371  KVRIIATLRTKQGNKVILVSALPHILSLERNLLETEAMHAFPVGYVFDNCKLLGRDSQYL 430

Query: 428  YLAISDKFIGRVHQSNLGEIIKQDKLKSRVIGYDVADCIFELTTDPEKLKLKYIRSKDIP 487
            Y+++SD+ IG++H S  G+ I Q+ +K+RV GY+  D  ++LT+DP+ L   Y+RS DIP
Sbjct: 431  YVSLSDERIGQIHISKAGDAITQEAVKARVTGYNTVDGYYQLTSDPKLLAKPYLRSADIP 490

Query: 488  VGEVFNNCEILKASSSGVELKLLGGQFTAFVPPLHISDIRLIYPERKFKIASKTKCRILN 547
            VG + + CEI   S +G+EL L  GQF AFV PLHISDIRL+YPERKFKI SK K R+L+
Sbjct: 491  VGTILSGCEITAVSGNGIELSLFDGQFKAFVAPLHISDIRLVYPERKFKIGSKVKGRVLH 550

Query: 548  VDNHGHIIATMKKSLVNDEELEKPVIESFETAKSIKNKNEKTVGTVQSFNGHGCVIMFFG 607
            VDN G +  T+KKSLV+  + + P++  FE    +  ++ KT+ TV+SF   GCV+ F G
Sbjct: 551  VDNKGRVYVTLKKSLVSANDSDIPLVSDFEQIAKLAEEDGKTLATVESFKPSGCVVTFLG 610

Query: 608  GVTGFLPKSEVSEVFVKRAEDHLRLGQTVQVKVLEVDEERRRIIVTCKVSNEEAQQQKSI 667
             +  FLP  E+SE FV+RA+DHLRLGQTV VKVLE   ++ ++IVT KVS+E++++QK+ 
Sbjct: 611  NLKAFLPNKEISEAFVQRAQDHLRLGQTVVVKVLEHVAKQSKVIVTRKVSSEDSEKQKAA 670

Query: 668  IESLKIGQSIIETVVVEKTKDSVIVEIPDVGIRGVIYVGHISDERIEQCRAEIKKIRIGS 727
            I  L +G+SI++  VVEKTKDSV+VE+ DVG+RGVIYVGH+SD ++EQ RA +KK+RIGS
Sbjct: 671  INDLVVGRSIVDVTVVEKTKDSVVVELNDVGLRGVIYVGHLSDSKLEQNRALLKKLRIGS 730

Query: 728  KLTGLVIDKDSRTQIFNLSLKKSLMKDAQNKRLPTTFAEITKFKKTDPLHGYVKSISSTG 787
             L G+V+DKD +T++FN+S KKSL+KDA    LP TF +I       P+HGYVKSIS  G
Sbjct: 731  SLQGVVMDKDVKTRVFNMSCKKSLIKDASKDILPLTFVDIKDKDPNTPMHGYVKSISDRG 790

Query: 788  VFVAFTGKFVGLVLPSYAVESRQVDIEKAFYSNQSVTAYLLRTDDDNERFLLTLKAP--- 844
            +FVAFTGKFVGLVLPSYA ESR VDI K FY NQSVT YLLRTD++NERFLLT+  P   
Sbjct: 791  IFVAFTGKFVGLVLPSYATESRDVDIFKKFYINQSVTVYLLRTDEENERFLLTMSPPQTS 850

Query: 845  -KVEKAAETISAENIIDTSIKSVKDIKLGKILDAKIKGVKKNQLNIILADNVHGRVDISE 903
             K E +   ++A N +D S+K +    +G +  A++K VKK QLN++LADN+HGRVD SE
Sbjct: 851  NKKEDSNHDVAAVNPVDASVKIISQYSVGTVTKARVKSVKKTQLNVVLADNLHGRVDASE 910

Query: 904  VFDNYNDIKDKKHPLSHYKANDKVRVKIIGHHDLKSHKSLPITHNFVKGTVFELTMKPSQ 963
            ++D + +I++ K PL+ +K+ D + VK+IG HD K+HK LPI+H     TV EL+ K S 
Sbjct: 911  IYDTFEEIENPKEPLAKFKSGDVIDVKVIGFHDSKTHKFLPISHRTGVNTVLELSAKKSA 970

Query: 964  LKSKDVKELDIRDITVGDEIIAFVNNYQNSTLWLTVTPTIKAKLSIFDLSEETLMNIKNV 1023
            LK    + ++   +  GDE+I FVNN+    +WLT++P +KAK+  F+LS++  +   N+
Sbjct: 971  LKGA-YQPIEFSGMKNGDELIGFVNNFAKGFIWLTLSPALKAKIPDFELSDDGSVFTGNL 1029

Query: 1024 EDDFPLGSVLKVNVTGKDQNKSILQVTQRNGKINSIDDLKVGGHTIGKIVKVTPKYLLIE 1083
            ++ FPLG  LKV V   D    I+ V+ R   I  I D+KV      +IVKV   YLL++
Sbjct: 1030 DESFPLGCALKVKVKELDPAHKIVSVSARKHAITDIKDIKVADKLPARIVKVADSYLLLD 1089

Query: 1084 LENKITGISTALEALNDFTEPLDQVFAGKENEFVKAKITSVIADEKKVQLQLAEDESTVQ 1143
            L N++TG++   +ALN+F+  L  V+  K    + A +  V  + KK+ L L  +++T +
Sbjct: 1090 LGNRLTGVAFVTDALNEFSLSLRSVYEDKIGSMILASVVGVDVENKKINLSLRTEDATDR 1149

Query: 1144 KITSHSDLKVGEVVNGLVKTVTDKGLFVFLGKSVEAFVPVSKLSDSYLKEWKKFYKPMQP 1203
             I SH DLK G+VV G +K+VTDKG+FV+L ++++AFVPVSKL+D+Y+KEWKKFYK MQP
Sbjct: 1150 YILSHKDLKQGDVVRGFIKSVTDKGIFVYLSRTLQAFVPVSKLTDAYIKEWKKFYKTMQP 1209

Query: 1204 VVGKIVSCNEDDRILLTLRETEVNGDLKVLKNYSDIKPGDIFNGTVRNVTDFGVFVKLDN 1263
            + GK+V+C  D RILLT++E+EVNG+LK+LK+Y+D+K GDIF+G+V+NVTDFGVFVKL N
Sbjct: 1210 ITGKVVNCESDSRILLTMKESEVNGELKILKSYADLKSGDIFDGSVKNVTDFGVFVKLHN 1269

Query: 1264 TANVTGLAHITEIADEVPEDIQSIFGVGDRVKAYVLKSNPEKKQLSLSLKASHF---NTN 1320
            T NVTGLAH +EI+D   +D+  +FG GD+VKA +LK+NPEK Q+SL LKAS+F   + +
Sbjct: 1270 TLNVTGLAHKSEISDSKIDDLSLLFGEGDKVKAIILKTNPEKNQVSLGLKASYFQKAHDD 1329

Query: 1321 ETITEKAES--QPQPRKID---EDQDELMDDEVVYNXXXXXXXXXXXXXXXXTTVISNDG 1375
            E   E AES  +    +I+    D+DE M+D + Y                    +    
Sbjct: 1330 EDEAEPAESIEEANGEEINGEASDEDEAMED-IEYEHTPADAPSHETSSKAHKEAVPT-- 1386

Query: 1376 GLSLSAGFDWTTSILDQANAXXXXXXXXXXFMEXXXXXXXXXXXXXLVEDKT-IDINTRA 1434
            GLSLSAGFDWT SILD                +                D+     +T+A
Sbjct: 1387 GLSLSAGFDWTGSILDPEQGKTMRMSSEDD--DFTFKKAKKNNKASRCNDRQDCRHHTKA 1444

Query: 1435 PESVADFERLIIGNPNSSVIWMNYMAFQLQLSEIDKARELAERALKTINYREEAEKLNIW 1494
            PESV DFERLI+GNPNSSVIWMNYMAFQLQLSE++KARELAERALKTI++REE EKLNIW
Sbjct: 1445 PESVGDFERLIMGNPNSSVIWMNYMAFQLQLSEVEKARELAERALKTISFREEHEKLNIW 1504

Query: 1495 IAMLNLENTFGSEETLEDVFTRSCQYMDSFTMHSKLIGIYQLSEKFDKASELFKITTKKF 1554
            IAMLNLENTFG++ETLEDVF R+CQYMD++T+H KLI IY +S K DKA EL+K   KKF
Sbjct: 1505 IAMLNLENTFGTDETLEDVFRRACQYMDAYTIHMKLISIYAMSSKDDKAVELYKAAAKKF 1564

Query: 1555 GSEKTSIWVSWASFVLSQNEPDQVGTILSSALKSLPKRNHIEVVRKFAQLEFSEGNPERG 1614
            GSE  S+WVSW  F+L+  +PD+   +L+ ALKSLP+R+HI+VVRKFAQLEF++G+PE+G
Sbjct: 1565 GSENVSLWVSWGEFLLTHEQPDEARAVLAQALKSLPRRSHIDVVRKFAQLEFAKGDPEQG 1624

Query: 1615 RSLFEGLLADAPKRIDIWNVYLDQEIKQKDNKSRVEELFERVIKMKITRKQAKFFFNKWL 1674
            R+LFEGLLADAPKRIDIWNVYLDQEIK   N++R + LFERV+  K++RKQAKFFFNKWL
Sbjct: 1625 RALFEGLLADAPKRIDIWNVYLDQEIKSS-NRARADALFERVLVAKLSRKQAKFFFNKWL 1683

Query: 1675 QFEES 1679
            Q  ES
Sbjct: 1684 QLAES 1688

>KLLA0B08239g 729850..735039 similar to sp|Q05022 Saccharomyces
            cerevisiae YMR229c RRP5 processing of pre-ribosomal RNA,
            start by similarity
          Length = 1729

 Score = 1296 bits (3354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 651/1318 (49%), Positives = 904/1318 (68%), Gaps = 10/1318 (0%)

Query: 8    PLSKEDGTRQPEKSTLVRTTEEISFPRGGSSALTPLELKHVANEAAHDVLFGNEKRPLTE 67
            PL ++D T  P KS L ++ EEISFPRGGSSAL+PLE+K V NE   DVLFG ++     
Sbjct: 15   PLVRQDATEAPAKSALSKS-EEISFPRGGSSALSPLEVKQVGNEVVADVLFGKDESATGA 73

Query: 68   DDAGXXXXXXXXXXXXXXXXXXXXXXXQRSAIIEHLNFNNVKEGTILLGQIDSITKNDLR 127
            +                           ++ +IEH     + +GTI+LGQI SI+K++L+
Sbjct: 74   EGPTKKKKKNAKNNFDQITTGDDEEKEDKTDLIEHFGMKQMTKGTIVLGQIQSISKHELK 133

Query: 128  ITFTDGLSGFVDLTHISEQLTSLLX----XXXXXXXXXXXXXXXXXXXXXXXXXQKSLPN 183
            I+  DGL G+V LT ISEQ+T +L                               K LP+
Sbjct: 134  ISLVDGLHGYVSLTDISEQMTKILENLDESMESDDEKNEDSEYDSSDDESDITTPKELPD 193

Query: 184  LRHYFKVGQWLRCAVTKNTALKPKNAKQKKRIELTIEPSVVNNFDVEDINKNTIIQCSVE 243
            L  YFK+GQWLRC V  N+AL+   + + K+++L+IEPSVVN F+ +D+ KN  +QCS++
Sbjct: 194  LNKYFKIGQWLRCMVQNNSALE---SNKNKKLDLSIEPSVVNVFEDDDLAKNCPLQCSLK 250

Query: 244  SIEDHGATLDLGVPSLTGFIAKKDCTNFDELKPGSVFISCITKKTDRSIVVSQDFSVKKN 303
            SIEDHGA LD+G+ +LTGFI+KKD   F  L PG VF++ +TK++ R++ V+ D + K  
Sbjct: 251  SIEDHGAILDIGIENLTGFISKKDIPEFSSLLPGMVFLATVTKRSGRTVNVNLDLASKNT 310

Query: 304  KMTSISSIDSVLPGQVVDLLCEEITDSGIVGKVFGSISAFIGKPHLQTFSEEDIKHKFSL 363
            K+  ISSID+++PGQ +D L + IT+ G++GK FG I+AF+  PH   F+ ED+KH +S+
Sbjct: 311  KVEKISSIDAIVPGQSIDFLPQTITNHGVIGKAFGLITAFLPLPHSNFFTVEDLKHHYSI 370

Query: 364  GSNIPCRILASVINKSGDRVLILSTLPHVISLNNTLGSIESLEAFPIGFIIDESVVKGRD 423
            G  +  RILA+ I KSGD+V ++ST PH+ISL+  L   E+LE+FP+G+I D   VKGRD
Sbjct: 371  GDLVNARILATTIVKSGDKVAVVSTQPHIISLHPKLQETEALESFPVGYIFDSCTVKGRD 430

Query: 424  SSYLYLAISDKFIGRVHQSNLGEIIKQDKLKSRVIGYDVADCIFELTTDPEKLKLKYIRS 483
            S + Y++I+++ +G++H S  GE      +K+R++GY+  D ++ LT+DP  L +KY+RS
Sbjct: 431  SQFFYVSINNEQVGQIHLSKAGETEPTGTVKARILGYNNVDKLYTLTSDPALLDVKYLRS 490

Query: 484  KDIPVGEVFNNCEILKASSSGVELKLLGGQFTAFVPPLHISDIRLIYPERKFKIASKTKC 543
             DIP GEV + CEI+  S  G+ELK+   QF AFVPPLHISD RL+YPERKFKI SK K 
Sbjct: 491  SDIPAGEVLSACEIVTVSGKGIELKIFNDQFKAFVPPLHISDTRLVYPERKFKIGSKVKG 550

Query: 544  RILNVDNHGHIIATMKKSLVNDEELEKPVIESFETAKSIKNKNEKTVGTVQSFNGHGCVI 603
            R+LNVD+ G +  T+KKS+VN +E    ++   +  ++++++  KT+GTV+ F  +GCVI
Sbjct: 551  RVLNVDSVGRVTVTLKKSIVNADEESVTLVCKNDDIQTVESQELKTIGTVEIFKPNGCVI 610

Query: 604  MFFGGVTGFLPKSEVSEVFVKRAEDHLRLGQTVQVKVLEVDEERRRIIVTCKVSNEEAQQ 663
             FF  +  F+P  E+SE FVK+ ++HLRLGQ+V VK+L  D ER RII +CK+S E + +
Sbjct: 611  SFFNNIKAFVPNKEISEAFVKKPQEHLRLGQSVLVKILNHDFERNRIIASCKISAESSSK 670

Query: 664  QKSIIESLKIGQSIIETVVVEKTKDSVIVEIPDVGIRGVIYVGHISDERIEQCRAEIKKI 723
            QKS IESL +G+SII+ +V+EKTKDSVIVE  D G+RGVIY GH+SD+RIEQ RA  KK+
Sbjct: 671  QKSAIESLVVGKSIIDAIVIEKTKDSVIVESKDSGLRGVIYTGHLSDDRIEQNRASQKKL 730

Query: 724  RIGSKLTGLVIDKDSRTQIFNLSLKKSLMKDAQNKRLPTTFAEITKFKKTDPLHGYVKSI 783
            +I S++ GLV+DKD RT +FN+S KKSL+KDA++  LP +F++I    KT+P+HGYVKS+
Sbjct: 731  KINSEVRGLVLDKDIRTHVFNMSCKKSLIKDAEDGTLPLSFSDIKNKDKTEPMHGYVKSV 790

Query: 784  SSTGVFVAFTGKFVGLVLPSYAVESRQVDIEKAFYSNQSVTAYLLRTDDDNERFLLTLKA 843
            S  GVFVAF GKFVGLVLPSYA E+R +DI K +Y NQSVT YLLRTD+++ERFLLT+  
Sbjct: 791  SDRGVFVAFNGKFVGLVLPSYAAETRDIDIHKKYYINQSVTVYLLRTDEEHERFLLTILK 850

Query: 844  PKVEKAAETISAENIIDTSIKSVKDIKLGKILDAKIKGVKKNQLNIILADNVHGRVDISE 903
             K +      S  N +D SIK + D  +GK+  A I  VKKNQLN+ LADNVHGR+ ISE
Sbjct: 851  QKTDVKKINSSVINPVDKSIKDLSDFTIGKVTKATITSVKKNQLNVTLADNVHGRISISE 910

Query: 904  VFDNYNDIKDKKHPLSHYKANDKVRVKIIGHHDLKSHKSLPITHNFVKGTVFELTMKPSQ 963
            VFD++ DIK++K PLS YK ND + V++IG HD+KS K LPI+H   K  + EL+ KPS 
Sbjct: 911  VFDSFEDIKEQKAPLSVYKKNDSLSVRVIGFHDIKSRKFLPISHTTSKSHLVELSAKPSS 970

Query: 964  LKSKDVKELDIRDITVGDEIIAFVNNYQNSTLWLTVTPTIKAKLSIFDLSEETLMNIKNV 1023
            L S  V E  ++D T       F+NNY N T WLT+TPT+KAKL IF++S+E       +
Sbjct: 971  LTSP-VSEKKLKDFTPEQTTFGFINNYSNDTAWLTITPTVKAKLPIFEISDEGHDFSLPI 1029

Query: 1024 EDDFPLGSVLKVNVTGKDQNKSILQVTQRNGKINSIDDLKVGGHTIGKIVKVTPKYLLIE 1083
            E+ +P+G+ ++V V   D     L V+ R+  I+SI ++K G     +++ V   Y+L+ 
Sbjct: 1030 EEKYPIGTAVRVTVKSIDTEHDSLVVSARSHAISSISEIKEGDVLPARVISVQDTYVLLS 1089

Query: 1084 LENKITGISTALEALNDFTEPLDQVFAGKENEFVKAKITSVIADEKKVQLQLAEDESTVQ 1143
            L   +TG+S   +AL+D++  L  V+  K+   V A + +V  D  K+ L L       +
Sbjct: 1090 LGKDVTGVSFITDALDDYSLSLKDVYDSKKKNIVSATVLNVDIDNNKINLSLRSSSPKDR 1149

Query: 1144 KITSHSDLKVGEVVNGLVKTVTDKGLFVFLGKSVEAFVPVSKLSDSYLKEWKKFYKPMQP 1203
             I S S+LK G++V G VK++TDKG+F+ L   ++AFVPVSKL+D+++K+WKKF++  Q 
Sbjct: 1150 TIISSSELKRGDIVRGFVKSITDKGVFISLSSVLQAFVPVSKLTDAFIKDWKKFFRRGQS 1209

Query: 1204 VVGKIVSCNEDDRILLTLRETEVNGDLKVLKNYSDIKPGDIFNGTVRNVTDFGVFVKLDN 1263
            VVGK+V+C+ DDR+LLTLRE+EVNG L VLK+YSDI  GDIF G+V+NVTDFGVFVKLD 
Sbjct: 1210 VVGKVVNCDNDDRVLLTLRESEVNGQLNVLKSYSDINVGDIFQGSVKNVTDFGVFVKLDG 1269

Query: 1264 TANVTGLAHITEIADEVPEDIQSIFGVGDRVKAYVLKSNPEKKQLSLSLKASHFNTNE 1321
            T NVTGLAH +E+AD   +++Q++FG GD+VKA VLK+NPEKKQ+SL LKAS+F TNE
Sbjct: 1270 TVNVTGLAHKSEVADAKIDNLQNLFGEGDKVKAIVLKTNPEKKQISLGLKASYF-TNE 1326

>KLLA0F17996g 1645592..1647646 similar to sgd|S0004107 Saccharomyces
            cerevisiae YLR117c CLF1, start by similarity
          Length = 684

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 81/194 (41%), Gaps = 17/194 (8%)

Query: 1441 FERLIIGNPNSSVIWMNYMAFQLQLSEIDKARELAERALKTINYREEAEKLNIWIAMLNL 1500
            +ER ++ +     +W+ Y+  +++   I+ AR L +RA   +      +KL  W   L L
Sbjct: 86   YERALLVDHGFIPLWIQYIDSEIKWKNINHARNLLDRATNAL---PRVDKL--WFKYLLL 140

Query: 1501 ENTFGSEETLEDVFTRSCQYMDSFTMHSKLIGIYQLSEKFDKASELFKITTKKF--GSEK 1558
            E + G++  +  ++TR C +          I        F+    ++     KF     +
Sbjct: 141  EESLGNQGIVRGIYTRWCSFEPGPDAWDSFIEFETRCLNFENVRNIY----SKFVLVHPQ 196

Query: 1559 TSIWVSWASFVLSQNEPDQVGTILSSALKSL------PKRNHIEVVRKFAQLEFSEGNPE 1612
               W+ W  F  +  +   V T+ S AL +L      P  +   V+  FA  E S+G  E
Sbjct: 197  IDTWLKWVRFEQTHGDISSVRTVFSFALDTLTSFSGTPLVDIERVIGSFASWEASQGEYE 256

Query: 1613 RGRSLFEGLLADAP 1626
            R R+L+   +   P
Sbjct: 257  RSRTLYRLAVERWP 270

 Score = 37.7 bits (86), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 3/61 (4%)

Query: 1591 KRNHIEVVR--KFAQLEFSEGNPERGRSLFEGLLADAPKRIDIWNVYLDQEIKQKD-NKS 1647
            KRN +++ +  ++AQ EF + +  R RS++E  L      I +W  Y+D EIK K+ N +
Sbjct: 57   KRNRLDLRQWMRYAQFEFDQKDIRRARSIYERALLVDHGFIPLWIQYIDSEIKWKNINHA 116

Query: 1648 R 1648
            R
Sbjct: 117  R 117

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 5/53 (9%)

Query: 1458 YMAFQLQLSEIDKARELAERALKTINYREEAEKLNIWIAMLNLENTFGSEETL 1510
            Y+AF+   +E +KAREL E+ L    Y      +NIWI     E+T  +E  L
Sbjct: 510  YIAFETDAAEYEKARELYEKYLILSRY-----DVNIWINQALFESTIPTETQL 557

>Scas_713.42
          Length = 699

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/197 (22%), Positives = 86/197 (43%), Gaps = 20/197 (10%)

Query: 1441 FERLIIGNPNSSVIWMNYMAFQLQLSEIDKARELAERALKTINYREEAEKLNIWIAMLNL 1500
            FER ++ N +   +W+ Y+  +L+L  I+ AR L +RA+ T+      +KL  W   L +
Sbjct: 94   FERALLVNNSYIPLWIRYIDAELKLKCINHARNLLDRAITTL---PRVDKL--WYKYLFV 148

Query: 1501 ENTFGSEETLEDVFTRSCQYMDSFTMHSKLIGIYQLSEKFDKASELFKITTKKFGS--EK 1558
            E +  + + +  +F + C            +        ++   E++     K+ +   K
Sbjct: 149  EESLQNWDVVRSLFRKWCSLEPGINAWKSYVDFETRQNNWNNVREVY----SKYVAIHPK 204

Query: 1559 TSIWVSWASFVLSQNEPDQVGTILS-------SALKSLP--KRNHIEVVRKFAQLEFSEG 1609
             + W+SW  F +   +   + T+ S          K+ P  K + IE    FA  E S+ 
Sbjct: 205  VATWLSWVKFEMVHGDVSTIRTVFSLGSDVLNEYEKTDPGFKEDCIEFAIAFANWEASQM 264

Query: 1610 NPERGRSLFEGLLADAP 1626
              +R R++++ L+   P
Sbjct: 265  EYDRSRAIYKILIDKWP 281

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 45/93 (48%), Gaps = 4/93 (4%)

Query: 1561 IWVSWASFVLSQNEPDQVGTILSSALKSLPKRNHIEVVRKFAQLEFSEGNPERGRSLFEG 1620
            IW+ ++ F + QN+      IL  +L   PK    +V R++ ++E S    +R R L+E 
Sbjct: 412  IWIMYSEFEIRQNDIGTARKILGRSLGLCPK---PKVFRRYIEIEISLREFDRVRRLYEK 468

Query: 1621 LLADAPKRIDIWNVYLDQEIKQKDNKSRVEELF 1653
             L   P  +  W  Y + E +  D++ R   +F
Sbjct: 469  FLEFDPSNLKTWIAYAELE-QNLDDEERARSIF 500

>Kwal_56.23875
          Length = 680

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 64/149 (42%), Gaps = 7/149 (4%)

Query: 1441 FERLIIGNPNSSVIWMNYMAFQLQLSEIDKARELAERALKTINYREEAEKLNIWIAMLNL 1500
            FER +  N     +W+ Y+  +L+   I+ AR L +RA    N     EKL  W+  + +
Sbjct: 82   FERALQVNNQYVPLWIKYIDSELKAKNINHARNLLDRA---CNLLPRVEKL--WLKYVIV 136

Query: 1501 ENTFGSEETLEDVFTRSCQYMDSFTMHSKLIGIYQLSEKFDKASELFKITTKKFGSEKTS 1560
            E + G+   +  +F+R C    S   +   +G      +F+KA +++        +  T 
Sbjct: 137  EESLGNVSLVRSLFSRWCSLSPSKNAYDAYVGFETRCGEFEKARKVYSGYVSVHPAVDT- 195

Query: 1561 IWVSWASFVLSQNEPDQVGTILSSALKSL 1589
             W+ W +F       D    + S  L +L
Sbjct: 196  -WLKWVAFEKRHGSLDTTRQVFSLGLDTL 223

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 41/91 (45%), Gaps = 5/91 (5%)

Query: 1549 ITTKKFGSEKTSIWVSWASFVLSQNEPDQVGTILSSALKSLPKRNHIEVVRKFAQLEFSE 1608
            I  KKF   K  IWV ++ F L Q    +   I   AL + PK+   ++ +++   E   
Sbjct: 387  IPHKKFTFAK--IWVMYSKFELRQENLAKARKIFGYALGTCPKQ---KIFKEYINFEIQL 441

Query: 1609 GNPERGRSLFEGLLADAPKRIDIWNVYLDQE 1639
               +R R ++E LLA  P     W  Y + E
Sbjct: 442  KEFDRVRKIYEQLLAFDPLSNANWIAYAELE 472

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 34/69 (49%), Gaps = 1/69 (1%)

Query: 1591 KRNHIEVVRKFAQLEFSEGNPERGRSLFEGLLADAPKRIDIWNVYLDQEIKQKDNKSRVE 1650
            KR  +    ++A+ E  + +  R RS+FE  L    + + +W  Y+D E+K K N +   
Sbjct: 55   KRFDVRQWIRYAKFEIGQHDMRRARSIFERALQVNNQYVPLWIKYIDSELKAK-NINHAR 113

Query: 1651 ELFERVIKM 1659
             L +R   +
Sbjct: 114  NLLDRACNL 122

>YER013W (PRP22) [1436] chr5 (178840..182277) Pre-mRNA splicing factor
            of DEAH box family, required for release of mature mRNA
            from the spliceosome [3438 bp, 1145 aa]
          Length = 1145

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 40/72 (55%), Gaps = 3/72 (4%)

Query: 1244 IFNGTVRNVTDFGVFVKLDNT--ANVTGLAHITEIADEVPEDIQSIFGVGDRVKAYVLKS 1301
            ++ G VRN+T FG FV++  T   N  GL HI+E++D+   D   +   G  +   V+K 
Sbjct: 180  VYEGKVRNITTFGCFVQIFGTRMKNCDGLVHISEMSDQRTLDPHDVVRQGQHIFVEVIKI 239

Query: 1302 NPEKKQLSLSLK 1313
                K +SLS+K
Sbjct: 240  QNNGK-ISLSMK 250

>AGL184W [4128] [Homologous to ScYLR117C (CLF1) - SH]
            complement(350805..352856) [2052 bp, 683 aa]
          Length = 683

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/193 (20%), Positives = 77/193 (39%), Gaps = 13/193 (6%)

Query: 1441 FERLIIGNPNSSVIWMNYMAFQLQLSEIDKARELAERALKTINYREEAEKLNIWIAMLNL 1500
            FER +   P   V+W+ Y+  +L+  +++ AR L  RA   +      +KL  W   + +
Sbjct: 83   FERALAVAPGDVVVWLRYVDCELRARDVNHARNLLVRATALLP---RVDKL--WYKYVLM 137

Query: 1501 ENTFGSEETLEDVFTRSCQYMDSFTMHSKLIGIYQLSEKFDKASELFKITTKKFGSEKTS 1560
            E + G  E +  V+T+ C    +       +       + +   E++           T 
Sbjct: 138  EESLGQVELVRGVYTKWCTLEPAAAAWDAFVDFETRQGQVEHVREVYSRYVMVHPVAAT- 196

Query: 1561 IWVSWASFVLSQNEPDQVGTILSSALKSLPKRNHIEV------VRKFAQLEFSEGNPERG 1614
             W+ W +F     +   V  + S A  +L      +V      V  FA+ E ++   ER 
Sbjct: 197  -WLKWVAFERKHGDAGTVRRVYSLACDTLTAFAGADVHEVEQLVVSFAEWEATQQELERS 255

Query: 1615 RSLFEGLLADAPK 1627
            R++    ++  P+
Sbjct: 256  RAVLSVAVSRWPE 268

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 38/61 (62%), Gaps = 3/61 (4%)

Query: 1591 KRNHIEVVR--KFAQLEFSEGNPERGRSLFEGLLADAPKRIDIWNVYLDQEIKQKD-NKS 1647
            KRN ++V +  ++A  E+ + +  R RS+FE  LA AP  + +W  Y+D E++ +D N +
Sbjct: 54   KRNRLDVRQWLRYAAFEYEQRDMRRARSVFERALAVAPGDVVVWLRYVDCELRARDVNHA 113

Query: 1648 R 1648
            R
Sbjct: 114  R 114

>YLR117C (CLF1) [3530] chr12 complement(382472..384535) Essential
            pre-mRNA splicing factor that plays a role in the
            initiation of DNA replication, has tetratricopeptide
            (TPR) repeats and has similarity to Drosophila crooked
            neck (crn) protein, component of Prp19p-associated
            complex [2064 bp, 687 aa]
          Length = 687

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/195 (17%), Positives = 82/195 (42%), Gaps = 16/195 (8%)

Query: 1441 FERLIIGNPNSSVIWMNYMAFQLQLSEIDKARELAERALKTINYREEAEKLNIWIAMLNL 1500
            FER ++ + +   +W+ Y+  +L++  I+ AR L  RA+ T+      +KL  W   L +
Sbjct: 88   FERALLVDSSFIPLWIRYIDAELKVKCINHARNLMNRAISTL---PRVDKL--WYKYLIV 142

Query: 1501 ENTFGSEETLEDVFTRSCQYMDSFTMHSKLIGIYQLSEKFDKASELFKITTKKFGSEKTS 1560
            E +  + E +  ++T+ C         +  +      + ++   E++  +       +  
Sbjct: 143  EESLNNVEIVRSLYTKWCSLEPGVNAWNSFVDFEIRQKNWNGVREIY--SKYVMAHPQMQ 200

Query: 1561 IWVSWASFVLSQNEPDQVGTILSSALKSLPKRNHIEV---------VRKFAQLEFSEGNP 1611
             W+ W  F       +   ++ S A+ ++    ++++         V  FA  E ++   
Sbjct: 201  TWLKWVRFENRHGNTEFTRSVYSLAIDTVANLQNLQIWSDMEVAKLVNSFAHWEAAQQEY 260

Query: 1612 ERGRSLFEGLLADAP 1626
            ER  +L++  +   P
Sbjct: 261  ERSSALYQIAIEKWP 275

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 1591 KRNHIEVVR--KFAQLEFSEGNPERGRSLFEGLLADAPKRIDIWNVYLDQEIKQK 1643
            KRN +++ +  ++AQ E  + +  R RS+FE  L      I +W  Y+D E+K K
Sbjct: 59   KRNRLDMGQWIRYAQFEIEQHDMRRARSIFERALLVDSSFIPLWIRYIDAELKVK 113

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 37/77 (48%), Gaps = 3/77 (3%)

Query: 1559 TSIWVSWASFVLSQNEPDQVGTILSSALKSLPKRNHIEVVRKFAQLEFSEGNPERGRSLF 1618
            + IW+ +A F++  ++  +   IL  A+   PK    +  + + +LE      +R R ++
Sbjct: 404  SKIWLMYAKFLIRHDDVPKARKILGKAIGLCPK---AKTFKGYIELEVKLKEFDRVRKIY 460

Query: 1619 EGLLADAPKRIDIWNVY 1635
            E  +   P  + IW+ Y
Sbjct: 461  EKFIEFQPSDLQIWSQY 477

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 35/166 (21%), Positives = 73/166 (43%), Gaps = 13/166 (7%)

Query: 1455 WMNYMAFQLQLSEIDKARELAERALKTINYREEAEKLNIWIAMLNLENTFGSEETLEDVF 1514
            W+ Y  F+++  ++ +AR + ERAL       ++  + +WI  ++ E          ++ 
Sbjct: 68   WIRYAQFEIEQHDMRRARSIFERALLV-----DSSFIPLWIRYIDAELKVKCINHARNLM 122

Query: 1515 TRSCQYMDSFTMHSKLIGIYQLSEKFDKASELFKITTKKFGSEKTSI--WVSWASFVLSQ 1572
             R+   + +     KL   Y + E+     E+ +    K+ S +  +  W S+  F + Q
Sbjct: 123  NRA---ISTLPRVDKLWYKYLIVEESLNNVEIVRSLYTKWCSLEPGVNAWNSFVDFEIRQ 179

Query: 1573 NEPDQVGTILSSALKSLPKRNHIEVVRKFAQLEFSEGNPERGRSLF 1618
               + V  I S  + + P+   ++   K+ + E   GN E  RS++
Sbjct: 180  KNWNGVREIYSKYVMAHPQ---MQTWLKWVRFENRHGNTEFTRSVY 222

>AAR020W [206] [Homologous to ScYER013W (PRP22) - SH]
            complement(376250..379588) [3339 bp, 1112 aa]
          Length = 1112

 Score = 40.8 bits (94), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 42/90 (46%), Gaps = 4/90 (4%)

Query: 1238 DIKP--GDIFNGTVRNVTDFGVFVK-LDNTANVTGLAHITEIADEVPEDIQSIFGVGDRV 1294
            D+ P  G I+   +RN+  FG F + L    +  GL HI++++         +  VGD V
Sbjct: 177  DVTPIEGKIYRAVIRNIKPFGCFARVLGTKRSCEGLIHISQLSHSRVGSPNDVVSVGDHV 236

Query: 1295 KAYVLKSNPEKKQLSLSLKASHFNTNETIT 1324
               + K     K LSLS++     T +T T
Sbjct: 237  YVKITKVQDNGK-LSLSMREVDQATGQTAT 265

>CAGL0D02376g complement(244241..246328) similar to tr|Q12309
            Saccharomyces cerevisiae YLR117c CLF1, start by
            similarity
          Length = 695

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 40/81 (49%), Gaps = 3/81 (3%)

Query: 1559 TSIWVSWASFVLSQNEPDQVGTILSSALKSLPKRNHIEVVRKFAQLEFSEGNPERGRSLF 1618
            + IW+ +A F + Q+  ++  +IL  +L   PKR   +  + +  LE      +R R L+
Sbjct: 400  SKIWILYAEFEIRQDNLEKARSILGRSLGLCPKR---KTFKYYIDLETKLREFDRVRILY 456

Query: 1619 EGLLADAPKRIDIWNVYLDQE 1639
            E  L   P  +D W  Y++ E
Sbjct: 457  ENFLKFDPLNLDTWRAYVEFE 477

 Score = 37.7 bits (86), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 41/211 (19%), Positives = 79/211 (37%), Gaps = 40/211 (18%)

Query: 1455 WMNYMAFQLQLSEIDKARELAERALKT--------INYREEAEKL--------------- 1491
            WM Y  F+++  ++ +AR + ERAL+         I Y E   KL               
Sbjct: 64   WMRYAVFEIEQHDMRRARSIFERALRVHISYVPLWIRYIESELKLGYINHARNILERAIT 123

Query: 1492 ------NIWIAMLNLENTFGSEETLEDVFTRSCQYMDSFTMHSKLIGIYQLSEKFDKASE 1545
                   +W   L +E +    + + ++F + C    +  +           E+++    
Sbjct: 124  KLPRVDKLWYKYLIVEESLAHFDIVRNLFQKWCSLEPAAHVWDSFTDFEVRQERYEDVRN 183

Query: 1546 LFKITTKKFGSEKTSIWVSWASFVLSQNEPDQVGTILSSALKSL----PKRNH-----IE 1596
            ++  +       + S W  W +F +       V ++ S AL +L      RN      I 
Sbjct: 184  IY--SKYVLIHPQFSTWRKWINFEVRYGSTKTVRSVYSLALDALIAYSESRNELVDDCIN 241

Query: 1597 VVRKFAQLEFSEGNPERGRSLFEGLLADAPK 1627
            ++ +F++ E  +    R +SL E  +   PK
Sbjct: 242  LIVEFSKWEALQKEYIRSKSLLEIAIQKWPK 272

>Kwal_55.21029
          Length = 1105

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 49/94 (52%), Gaps = 7/94 (7%)

Query: 1244 IFNGTVRNVTDFGVFVKLDNTAN--VTGLAHITEIADEVPEDIQSIFGVGDRVKAYVLKS 1301
            I++G+V+ +T FG F+++  T +    GL HI+E+A+   ED   +  +  +V   V++ 
Sbjct: 179  IYSGSVKKITTFGCFIRIQGTKDPRCDGLLHISEMANRRLEDPSELVSLNQQVYVKVIRI 238

Query: 1302 NPEKKQLSLSLK----ASHFNTNETITEKAESQP 1331
                K +SL +K    ++    NE     A+ +P
Sbjct: 239  QNNGK-ISLRMKNIDQSTGIEQNEFRGRTADKKP 271

>Sklu_2440.18 YDR416W, Contig c2440 29476-31950
          Length = 824

 Score = 38.1 bits (87), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%)

Query: 1629 IDIWNVYLDQEIKQKDNKSRVEELFERVIKMKITRKQAKFFFNKWLQFEESN 1680
             +IWN+YL + +K   +K R+ +LFE+ +K+       K F+  +  FEE N
Sbjct: 596  FEIWNIYLAEGLKNGLSKERMRDLFEQAMKLAQDGLDCKPFYTLYSDFEEKN 647

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 1/61 (1%)

Query: 1537 SEKFDKASELFKITTKKFGSEKTSIWVSWASFVLSQNEPDQVGTILSSALKSLPKRNHIE 1596
            SE+FDK ++LF+        E   IW  +  F+  Q++   +    +S+L SLP  +H  
Sbjct: 86   SEEFDKVNKLFE-KCLYLCYEHVDIWTQYLKFLTLQSDLKSLRVTFNSSLCSLPLESHAM 144

Query: 1597 V 1597
            V
Sbjct: 145  V 145

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 47/233 (20%), Positives = 96/233 (41%), Gaps = 38/233 (16%)

Query: 1448 NPNSSVIWMNYMAFQLQLSEIDKARELAERALKTINYREEAEKLNIWIAMLNLENTFGSE 1507
            +P    +W N + + ++L  +++  E     +  +  R+       WIA   L   F S 
Sbjct: 346  SPEKQTVWENDLKYHMRL--LEQLLETHPLQVNDLKLRQNINDAKTWIARAEL---FPSA 400

Query: 1508 ETLEDVFTRSCQYM------------DSFTMHSKLIGIYQLSEKFDKASELFKITTKKFG 1555
                +VF ++   +            D++  ++KL   Y   + +D A E+F   T+   
Sbjct: 401  PEKANVFAQALSKINPTKVDTPGILGDTWCRYAKL---YINKQDYDTAREIFDRATRVPY 457

Query: 1556 S---EKTSIWVSWASFVLSQNEPDQVGTILSSALKSLPKRNHIEVVRKFAQLEFSEGNPE 1612
            S   +   +W+ WA   L  +  ++   ++ +ALK +P+   + V+ K+ +         
Sbjct: 458  SHLIDLEDVWICWAEMELDIDGLEKAALVIKTALK-VPQSPEL-VLEKYQR--------S 507

Query: 1613 RGRSLFEGLLADAPKRIDIWNVYLDQEIKQKDNKSRV---EELFERVIKMKIT 1662
            + R L    +  +   + +W+ YLD      DNK  +      +E+ I +KI 
Sbjct: 508  KKRELPAQTVVFSS--LKLWSFYLDLLESTCDNKDAIPSTRAAYEQAISLKIA 558

>KLLA0B11638g complement(1020591..1023926) similar to sp|P24384
            Saccharomyces cerevisiae YER013w PRP22 pre-mRNA splicing
            factor, start by similarity
          Length = 1111

 Score = 37.7 bits (86), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 31/47 (65%), Gaps = 7/47 (14%)

Query: 1244 IFNGTVRNVTDFGVFVKL---DNTANVTGLAHITEIAD---EVPEDI 1284
            ++ G V+NVT FG FV++    NT NV GL H++E++    + PED+
Sbjct: 181  VYPGKVQNVTKFGCFVRIFGVRNT-NVDGLVHVSELSSSHVDKPEDV 226

>CAGL0F02915g 281010..283517 similar to sp|Q04048 Saccharomyces
            cerevisiae YDR416w SYF1 synthetic lethal with CDC40,
            hypothetical start
          Length = 835

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 66/149 (44%), Gaps = 20/149 (13%)

Query: 1524 FTMHSKLIGIYQLSEKFDKASELF------KITTKKFGSEKTSIWVSWASFVLSQNEPDQ 1577
            F +H+KL         F +A +L         T K+   ++  +W S  S       PD 
Sbjct: 661  FEIHNKL---------FSRAIDLLMSGARRPYTNKEQLKQRVDLWESAISKCEEFLGPDS 711

Query: 1578 VGTILSSALKSLPKRNHIEVVRKFAQLEFSEGNPERGRSLFE--GLLADAPKRIDIWNVY 1635
            +  +LS  ++ LP    I  V KF +LE S  +  R R L +    L    K  ++W ++
Sbjct: 712  LRQLLSECIQELPNSKAITYVLKFTKLEMSLSDYTRARELLQYGAQLLPPIKNEELWGLW 771

Query: 1636 LDQEIKQKDNKSRVEELFERVIKMKITRK 1664
               E++  D KS  +E+   ++K K+ ++
Sbjct: 772  EQFELEHGD-KSYYKEML--LLKQKLEKE 797

>KLLA0A01969g complement(178458..180854) similar to sgd|S0002824
            Saccharomyces cerevisiae YDR416w SYF1 synthetic lethal
            with CDC40, start by similarity
          Length = 798

 Score = 35.4 bits (80), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 2/79 (2%)

Query: 1601 FAQLEFSEGNPERGRSLFEGLLADAPKRID--IWNVYLDQEIKQKDNKSRVEELFERVIK 1658
            +A L  S G+     ++FE  +   P  +   IW++YLD  +K    K +  ++FE  IK
Sbjct: 542  YALLNESSGHQAEALAVFERSVEIFPPSVSKSIWDIYLDVALKADITKEQKRDIFESAIK 601

Query: 1659 MKITRKQAKFFFNKWLQFE 1677
            +  +      FF K+  FE
Sbjct: 602  LAASGVACVSFFEKYSDFE 620

>Scas_689.3
          Length = 400

 Score = 34.3 bits (77), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 47/92 (51%), Gaps = 9/92 (9%)

Query: 904 VFDNYNDIKDKKHPLSHYKANDKVRV----KIIGHHDLKSHKSLPITHNFVKGTVFELTM 959
            FD + D++  +  LSH+   D++++     I+G + LKS K+  IT   + G + E T 
Sbjct: 43  AFDEFRDVQINEDSLSHFNGTDEMKLDTSNNILGSNVLKSGKTFVITS--ITGGIVEDT- 99

Query: 960 KPSQLKSKDVKELDIRD-ITVGDEIIAFVNNY 990
             S +   D+ E ++R+ +   D++  F   Y
Sbjct: 100 -SSSINEDDIGEEELREMVNSNDKLSEFATVY 130

>Scas_705.55
          Length = 907

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 73/170 (42%), Gaps = 11/170 (6%)

Query: 1441 FERLIIGNPNSSVIWMNYMAFQLQLSEIDKARELAERALKTINYREEAEKLNIWIAMLNL 1500
            +ER +  NP  S +W       L L ++ +A    ++AL  ++      KL  W  +  L
Sbjct: 113  YERALSINPELSDVWATLGHCYLMLDDLQRAYNSYQQALYHLS-NPNVPKL--WHGIGIL 169

Query: 1501 ENTFGSEETLEDVFTR----SCQYMDSFTMHSKLIGIYQLSEKFDKASELFKITTKKFGS 1556
             + +GS +  E+ F +      Q+  +  ++ +L  IY+   K+ +A E F+    +  +
Sbjct: 170  YDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGKWTQALECFRYILNQPPA 229

Query: 1557 --EKTSIWVSWASFVLSQNEPDQVGTILSSALKSLPKRNHIEVVRKFAQL 1604
              ++  IW    S + S NE           L  L   NH +V+++   L
Sbjct: 230  PLQEWDIWFQLGSVLESMNEWQGAREAYEHVL--LQNENHAKVLQQLGCL 277

>AAR131W [318] [Homologous to ScYDR416W (SYF1) - SH]
            complement(574796..577207) [2412 bp, 803 aa]
          Length = 803

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 40/82 (48%), Gaps = 2/82 (2%)

Query: 1601 FAQLEFSEGNPERGRSLFEGLLADAPKR--IDIWNVYLDQEIKQKDNKSRVEELFERVIK 1658
            +A     +GN     S++E  +   P     +IW++Y+ + +K    K ++ +LFE  +K
Sbjct: 551  YAHYLQDKGNHVESFSIYERAVDIFPAETAFEIWDIYIGEALKYGLPKEQIRDLFESSLK 610

Query: 1659 MKITRKQAKFFFNKWLQFEESN 1680
            M     + K FF  + +FE  N
Sbjct: 611  MANEGVECKPFFLLYAKFERDN 632

>ACL086C [963] [Homologous to ScYNL091W - SH] (192736..196359) [3624
            bp, 1207 aa]
          Length = 1207

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 28/53 (52%)

Query: 1237 SDIKPGDIFNGTVRNVTDFGVFVKLDNTANVTGLAHITEIADEVPEDIQSIFG 1289
            + + P D F+G + N+T+F V  KL++ +    L  ++     +P    SI+G
Sbjct: 914  ASVDPNDTFSGDLTNLTNFLVQTKLEDVSTSAPLHSVSSSTTALPRGETSIYG 966

>Kwal_56.23079
          Length = 372

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 55/118 (46%), Gaps = 16/118 (13%)

Query: 603 IMFFGGVTGFLPKSEVSEVFVKRAEDHLRLGQTVQVKVLEVDEERRRIIVTCKVSNE--- 659
           ++  GG TG    +E     VK+ ++ L     V+ K+ E + + RRI++ C   N    
Sbjct: 239 VILRGGKTGTNYDAE----NVKKTQEEL-----VKAKIAEENGKTRRIMIDCSHGNSSKD 289

Query: 660 ---EAQQQKSIIESLKIGQSIIETVVVEKTKDSVIVEIPDVGIR-GVIYVGHISDERI 713
              + +  +SI E L  GQ+ I  V++E        ++P  G R G+ Y   I+D  I
Sbjct: 290 YRNQPKVAQSIYEQLTDGQNAICGVMIESNLVEGRQDVPAEGGREGLKYGCSITDACI 347

>Kwal_47.17481
          Length = 1249

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 44/96 (45%), Gaps = 14/96 (14%)

Query: 987  VNNYQNSTLWLTVTPTIKAKLSI------FDLSEETLMNIKNVEDDFPLGSVLKVNV--- 1037
            V+  Q+   W TV P  K++ ++      F  S + L++++ +E      SV + N+   
Sbjct: 779  VSGAQDDDAW-TVRPAAKSEATLPHQTSEFTGSMQDLLDLQPLEPKKTASSVPQPNIKDL 837

Query: 1038 ----TGKDQNKSILQVTQRNGKINSIDDLKVGGHTI 1069
                TG  +N + LQ  +    +  +D  K GGH +
Sbjct: 838  EPVKTGSSRNGASLQQDKTGASLAPLDPFKTGGHNM 873

>CAGL0J09878g complement(964057..965961) similar to sp|P32367
            Saccharomyces cerevisiae YBR123c TFC1, hypothetical start
          Length = 634

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 55/117 (47%), Gaps = 17/117 (14%)

Query: 1158 NGLVKTVTDKGLFVFLGKSVEAFVPVSKLSDSYLKEWKKFYKPMQPVVGKIVSCNEDDRI 1217
            N    +VTDKGL +FL   +    PV    D+     K F+    P++GK V   +D  +
Sbjct: 66   NSTEPSVTDKGLELFLNNGLS---PVDPWDDATSSARKPFFN-EHPIIGKRVPFRDDSIV 121

Query: 1218 L-LTLRE--TEVNGD--LKVLKNYSD----IKPGDIFNGTV--RNVTDFGVFVKLDN 1263
            L +T+ E   E NG+   K L++         P  + N T+  R ++DF V   LDN
Sbjct: 122  LKITMPEGTLEKNGNDVAKALRSLDSKDVCATPVAVVNNTIKFREMSDFQVI--LDN 176

>Sklu_2401.8 , Contig c2401 16254-17417
          Length = 387

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 29/60 (48%)

Query: 1511 EDVFTRSCQYMDSFTMHSKLIGIYQLSEKFDKASELFKITTKKFGSEKTSIWVSWASFVL 1570
            +D FTR  +Y+  +      + IY  S   + ASEL  +  +  G+E  + +  W + VL
Sbjct: 132  QDFFTRGTEYVTKYAEQFGKLHIYPTSGAPEGASELHVVYRRPDGNEVQNTFKDWTTSVL 191

>Kwal_23.3670
          Length = 802

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 63/140 (45%), Gaps = 9/140 (6%)

Query: 1441 FERLIIGNPNSSVIWMNYMAFQLQLSEIDKARELAERALKTINYREEAEKLNIWIAMLNL 1500
            ++R +  NP    IW       L L ++ +A    ++AL  ++      KL  W  +  L
Sbjct: 123  YQRALTVNPELGDIWATLGHCYLMLDDLQRAYAAYQQALYHLS-NPNVPKL--WHGIGIL 179

Query: 1501 ENTFGSEETLEDVFTR----SCQYMDSFTMHSKLIGIYQLSEKFDKASELFK--ITTKKF 1554
             + +GS +  E+ F +      Q+  +  ++ +L  IY+   K+++A E F+  +T    
Sbjct: 180  YDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGKWNQALECFRYILTQPPA 239

Query: 1555 GSEKTSIWVSWASFVLSQNE 1574
              ++  +W    S + S +E
Sbjct: 240  PLQEWDVWFQLGSVLESMSE 259

>Kwal_56.23065
          Length = 907

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 44/96 (45%), Gaps = 2/96 (2%)

Query: 1542 KASELFKITTKKFGSEKTSIWVSWASFVLSQ-NEPDQVGTILSSALKSLPKRNHIEVVRK 1600
            ++ E + I T+K   E  ++W++ A    S  N+P +  +    AL  +PK N   ++  
Sbjct: 694  QSRECYAIGTRKL-PENANLWIALAHADESLLNQPTRARSDFEIALLKVPKENSEPILVA 752

Query: 1601 FAQLEFSEGNPERGRSLFEGLLADAPKRIDIWNVYL 1636
              Q+E   GN ++ R L    L   P    +W  +L
Sbjct: 753  QVQMEKKLGNTDQARLLVTRALKQFPSSALLWVEHL 788

>AER393C [2893] [Homologous to ScYHR099W (TRA1) - SH]
            (1375025..1386118) [11094 bp, 3697 aa]
          Length = 3697

 Score = 32.0 bits (71), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 19/26 (73%)

Query: 1556 SEKTSIWVSWASFVLSQNEPDQVGTI 1581
            SE+ ++W++W   V+S++ P Q GT+
Sbjct: 1928 SEQPNVWINWVRRVISESNPHQSGTL 1953

>Sklu_1951.2 YMR036C, Contig c1951 1440-3326
          Length = 628

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 3/43 (6%)

Query: 704 YVGHISDERIEQCRAEIKKIRIGSKLTGLVIDKDSRTQIFNLS 746
           YVG  S E +++C +E++K R  SK    VI +++   IFN S
Sbjct: 433 YVGMDSQEHLDKCESEMEKFRKNSK---RVITRENSFHIFNSS 472

>CAGL0E01903g 190228..191517 similar to tr|Q12383 Saccharomyces
            cerevisiae YOL125w, start by similarity
          Length = 429

 Score = 31.2 bits (69), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 40/73 (54%), Gaps = 7/73 (9%)

Query: 1086 NKITGISTALEALNDFTEPLDQVFAGKENEFVKA----KITSVIADEKKVQLQLAEDEST 1141
            N I  +   LEALN++ EP +Q+   K+NEF+++    ++++ I    K Q  L ++   
Sbjct: 108  NLIESVQLLLEALNEYEEPQEQI---KKNEFMESNRLIELSNTIKKHAKQQSSLIQNLFD 164

Query: 1142 VQKITSHSDLKVG 1154
            V+ I S   ++ G
Sbjct: 165  VELIPSGKIMEFG 177

>YBR112C (CYC8) [302] chr2 complement(462826..465726) General
            repressor of RNA polymerase II transcription that is
            brought to target promoters by sequence-specific
            DNA-binding proteins, Sko1p-Ssn6p-Tup1p complex undergoes
            Hog1p-dependent conversion to a transcriptional activator
            [2901 bp, 966 aa]
          Length = 966

 Score = 31.2 bits (69), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 62/140 (44%), Gaps = 9/140 (6%)

Query: 1441 FERLIIGNPNSSVIWMNYMAFQLQLSEIDKARELAERALKTINYREEAEKLNIWIAMLNL 1500
            +ER ++ NP  S +W       L L ++ +A    ++AL  ++      KL  W  +  L
Sbjct: 103  YERALLVNPELSDVWATLGHCYLMLDDLQRAYNAYQQALYHLS-NPNVPKL--WHGIGIL 159

Query: 1501 ENTFGSEETLEDVFTRSCQYMDSF----TMHSKLIGIYQLSEKFDKASELFKITTKKFGS 1556
             + +GS +  E+ F +  +    F     ++ +L  IY+   K+ +A E F+    +  +
Sbjct: 160  YDRYGSLDYAEEAFAKVLELDPHFEKANEIYFRLGIIYKHQGKWSQALECFRYILPQPPA 219

Query: 1557 --EKTSIWVSWASFVLSQNE 1574
              ++  IW    S + S  E
Sbjct: 220  PLQEWDIWFQLGSVLESMGE 239

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.134    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 51,558,312
Number of extensions: 2248840
Number of successful extensions: 8296
Number of sequences better than 10.0: 76
Number of HSP's gapped: 8359
Number of HSP's successfully gapped: 110
Length of query: 1680
Length of database: 16,596,109
Length adjustment: 115
Effective length of query: 1565
Effective length of database: 12,615,039
Effective search space: 19742536035
Effective search space used: 19742536035
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)