Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M04521g68867736300.0
Scas_506.368970117210.0
Kwal_27.1131068868616600.0
KLLA0D16984g69669415760.0
YLR143W68569415680.0
AGL164W68660614400.0
CAGL0M12386g1421091555e-12
Scas_715.531281091183e-07
YIL051C (MMF1)145891151e-06
YER057C (HMF1)1291101132e-06
KLLA0C08349g1401101122e-06
Scas_704.34148891081e-05
Sklu_2193.3128891033e-05
Kwal_55.21247134831024e-05
Kwal_23.58041411101017e-05
ADL077C1421051009e-05
Kwal_23.280712965972e-04
KLLA0B14817g13194890.003
KLLA0E03894g13783720.46
AFR189C63367712.1
Scas_701.28271103692.7
YDL024C (DIA3)46886693.4
Scas_504.1307662694.0
Scas_633.2684434676.0
KLLA0F22583g53477666.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M04521g
         (677 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M04521g 496157..498223 similar to tr|Q12429 Saccharomyces c...  1402   0.0  
Scas_506.3                                                            667   0.0  
Kwal_27.11310                                                         644   0.0  
KLLA0D16984g 1439669..1441759 similar to sgd|S0004133 Saccharomy...   611   0.0  
YLR143W (YLR143W) [3552] chr12 (427330..429387) Protein containi...   608   0.0  
AGL164W [4148] [Homologous to ScYLR143W - SH] complement(388842....   559   0.0  
CAGL0M12386g 1234993..1235421 similar to sp|P40037 Saccharomyces...    64   5e-12
Scas_715.53                                                            50   3e-07
YIL051C (MMF1) [2616] chr9 complement(257842..258279) Protein im...    49   1e-06
YER057C (HMF1) [1487] chr5 complement(270735..271124) Protein th...    48   2e-06
KLLA0C08349g 731629..732051 highly similar to sp|P40185 Saccharo...    48   2e-06
Scas_704.34                                                            46   1e-05
Sklu_2193.3 YIL051C, Contig c2193 5846-6232 reverse complement         44   3e-05
Kwal_55.21247                                                          44   4e-05
Kwal_23.5804                                                           44   7e-05
ADL077C [1664] [Homologous to ScYIL051C (MMF1) - SH; ScYER057C (...    43   9e-05
Kwal_23.2807                                                           42   2e-04
KLLA0B14817g 1301705..1302100 similar to sp|Q8XCD0 Escherichia c...    39   0.003
KLLA0E03894g complement(364475..364888) some similarities with s...    32   0.46 
AFR189C [3381] [Homologous to ScYLL035W (GRC3) - SH] (780916..78...    32   2.1  
Scas_701.28                                                            31   2.7  
YDL024C (DIA3) [837] chr4 complement(408448..409854) Protein inv...    31   3.4  
Scas_504.1                                                             31   4.0  
Scas_633.26                                                            30   6.0  
KLLA0F22583g 2107305..2108909 highly similar to sp|P39077 Saccha...    30   6.9  

>CAGL0M04521g 496157..498223 similar to tr|Q12429 Saccharomyces
           cerevisiae YLR143w, hypothetical start
          Length = 688

 Score = 1402 bits (3630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 677/677 (100%), Positives = 677/677 (100%)

Query: 1   MKFVALISGGKDSCYNILHCQRQGHELVALANLRPIDTDKQELDSFMFQTVGHDIVSLYE 60
           MKFVALISGGKDSCYNILHCQRQGHELVALANLRPIDTDKQELDSFMFQTVGHDIVSLYE
Sbjct: 1   MKFVALISGGKDSCYNILHCQRQGHELVALANLRPIDTDKQELDSFMFQTVGHDIVSLYE 60

Query: 61  NCTGLPLFRKEIHPKTSKNVELNYTPTKDDEIEVLYQLLSEVKQSIPDLQAVSVGAILSS 120
           NCTGLPLFRKEIHPKTSKNVELNYTPTKDDEIEVLYQLLSEVKQSIPDLQAVSVGAILSS
Sbjct: 61  NCTGLPLFRKEIHPKTSKNVELNYTPTKDDEIEVLYQLLSEVKQSIPDLQAVSVGAILSS 120

Query: 121 YQRTRVEDVCGRLGLVVLSYLWQRSQLELMTEMCSMSKQEDELNTSESCKLDARIIKVAA 180
           YQRTRVEDVCGRLGLVVLSYLWQRSQLELMTEMCSMSKQEDELNTSESCKLDARIIKVAA
Sbjct: 121 YQRTRVEDVCGRLGLVVLSYLWQRSQLELMTEMCSMSKQEDELNTSESCKLDARIIKVAA 180

Query: 181 IGLDNTDLGKSLPQLFPKMLKLNTRYEVHICGEGGEFESMVLDAPFFRKGFLKLEEVIDT 240
           IGLDNTDLGKSLPQLFPKMLKLNTRYEVHICGEGGEFESMVLDAPFFRKGFLKLEEVIDT
Sbjct: 181 IGLDNTDLGKSLPQLFPKMLKLNTRYEVHICGEGGEFESMVLDAPFFRKGFLKLEEVIDT 240

Query: 241 TDNENDGVYNAQLIVKFQKRELPDDIFQSELSRLPVPPLFDPAWNELYELIDNENFEDTK 300
           TDNENDGVYNAQLIVKFQKRELPDDIFQSELSRLPVPPLFDPAWNELYELIDNENFEDTK
Sbjct: 241 TDNENDGVYNAQLIVKFQKRELPDDIFQSELSRLPVPPLFDPAWNELYELIDNENFEDTK 300

Query: 301 TINTMNIRLPSVKTHTNRIGNLLYISNIQPQYKDGTVQEQVKDVLQQLDNILKDNHLTAK 360
           TINTMNIRLPSVKTHTNRIGNLLYISNIQPQYKDGTVQEQVKDVLQQLDNILKDNHLTAK
Sbjct: 301 TINTMNIRLPSVKTHTNRIGNLLYISNIQPQYKDGTVQEQVKDVLQQLDNILKDNHLTAK 360

Query: 361 NVLYSSLLLTDMSLFASVNQEYSKFFDIWKNGPLPPARACIESNIINDGSALQLSVVVKY 420
           NVLYSSLLLTDMSLFASVNQEYSKFFDIWKNGPLPPARACIESNIINDGSALQLSVVVKY
Sbjct: 361 NVLYSSLLLTDMSLFASVNQEYSKFFDIWKNGPLPPARACIESNIINDGSALQLSVVVKY 420

Query: 421 ADQTLGNDIEKCEKSGLHVQGRSYWAPCNIGPYSQSIWLSNDLNQLSYLSGQIALEPSQM 480
           ADQTLGNDIEKCEKSGLHVQGRSYWAPCNIGPYSQSIWLSNDLNQLSYLSGQIALEPSQM
Sbjct: 421 ADQTLGNDIEKCEKSGLHVQGRSYWAPCNIGPYSQSIWLSNDLNQLSYLSGQIALEPSQM 480

Query: 481 EMIDTNDAKQQAVLSLKHLDSIKQVINARNQVQLTCFISNNSIVPLLTQTWAQYSEDIIY 540
           EMIDTNDAKQQAVLSLKHLDSIKQVINARNQVQLTCFISNNSIVPLLTQTWAQYSEDIIY
Sbjct: 481 EMIDTNDAKQQAVLSLKHLDSIKQVINARNQVQLTCFISNNSIVPLLTQTWAQYSEDIIY 540

Query: 541 SSEMEEWCGKPSESQDCLIIVKVSNLPRNALCEWGGIAAKSLEVEHDDHDLTAELRKLNL 600
           SSEMEEWCGKPSESQDCLIIVKVSNLPRNALCEWGGIAAKSLEVEHDDHDLTAELRKLNL
Sbjct: 541 SSEMEEWCGKPSESQDCLIIVKVSNLPRNALCEWGGIAAKSLEVEHDDHDLTAELRKLNL 600

Query: 601 DGGINIINHHDLTLRRFKTTFANTAEQLITQIRGVTSKNTHCIIFFSEYLCVDKLQDTSA 660
           DGGINIINHHDLTLRRFKTTFANTAEQLITQIRGVTSKNTHCIIFFSEYLCVDKLQDTSA
Sbjct: 601 DGGINIINHHDLTLRRFKTTFANTAEQLITQIRGVTSKNTHCIIFFSEYLCVDKLQDTSA 660

Query: 661 EFIPVEKVYNYKGEEVK 677
           EFIPVEKVYNYKGEEVK
Sbjct: 661 EFIPVEKVYNYKGEEVK 677

>Scas_506.3
          Length = 689

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/701 (52%), Positives = 473/701 (67%), Gaps = 47/701 (6%)

Query: 1   MKFVALISGGKDSCYNILHCQRQGHELVALANLRPIDTDKQELDSFMFQTVGHDIVSLYE 60
           MKFVALISGGKDS YNILHCQ+  HELVALANL P    +QELDSFMFQTVGHDI+ LYE
Sbjct: 1   MKFVALISGGKDSFYNILHCQKINHELVALANLYPAIQTEQELDSFMFQTVGHDIIPLYE 60

Query: 61  NCTGLPLFRKEIHPKTSKNVELNYTPTKDDEIEVLYQLLSEVKQSIPDLQAVSVGAILSS 120
            C G+PLFR+ I  KTSKNV+LNY PTKDDEIE+L++LLSEVK + P L+AVSVGAILSS
Sbjct: 61  KCIGVPLFRRSIESKTSKNVDLNYLPTKDDEIEILFELLSEVKSNCPGLEAVSVGAILSS 120

Query: 121 YQRTRVEDVCGRLGLVVLSYLWQRSQLELMTEMCSMSKQ--EDELNTSESCKLDARIIKV 178
           YQRTRVE+VC RLGLVVLSYLWQR Q ELM+EMCSMSKQ  EDEL    SCKLDARIIKV
Sbjct: 121 YQRTRVENVCQRLGLVVLSYLWQRDQEELMSEMCSMSKQGEEDEL----SCKLDARIIKV 176

Query: 179 AAIGLDNTDLGKSLPQLFPKMLKLNTRYEVHICGEGGEFESMVLDAPFFRKGFLKLEEVI 238
           AAIGLD + LGKSLP++FP M KLN  Y+VHICGEGGEFE+MVLDAPFF+ G LKL  + 
Sbjct: 177 AAIGLDKSHLGKSLPEIFPHMQKLNRLYQVHICGEGGEFETMVLDAPFFKNGNLKLLSME 236

Query: 239 DTTDN-ENDGVYNAQLIVKFQKRELPDDIFQSELSRLPVPPLFDPAWNELYELIDNENFE 297
              DN +NDGVY+ +L V+FQ+R + +D     L +LP PP  +  W  +      E F 
Sbjct: 237 PQADNDDNDGVYSVRLNVEFQERVVSEDTVLQLLEQLPQPPRLNEKWTSILSSFQEETFA 296

Query: 298 DTKTINTMNIRLPSVK--THTNRIGNLLYISNIQPQYKDGTVQEQVKDVLQQLDNILKDN 355
            + T  T    +P  K     N++GNLLYISN+ P+  +  V++Q K V QQLD I+K+N
Sbjct: 297 KSVTKTTQLSTIPECKYRNSVNKVGNLLYISNLCPKDSELNVEQQAKQVFQQLDKIMKEN 356

Query: 356 HLTAKNVLYSSLLLTDMSLFASVNQEYSKFFDIWKNGPLPPARACIESNIINDGSALQLS 415
            L    +L+SSL+L +MS FA+VNQ Y+ FF I K GPLPP+RAC+ S ++++   LQLS
Sbjct: 357 SLFPSQILFSSLILANMSNFATVNQVYNDFFRINKWGPLPPSRACVGS-VLSNNVQLQLS 415

Query: 416 VVVKYADQTL-----GNDIEKCEKSGLHVQGRSYWAPCNIGPYSQSIWLSNDLNQLSYLS 470
           V +  + + +      + +    K GLHVQGRS+WAPCNIGPYSQ+IW  ND  +L+Y+S
Sbjct: 416 VTIDTSHKVIEIKNSSHTMLNKNKDGLHVQGRSFWAPCNIGPYSQAIWSKNDPRKLTYMS 475

Query: 471 GQIALEPSQMEMIDTNDAKQQAVLSLKHLDSIKQVINARNQVQLTCFISNNSIVPLLTQT 530
           GQIAL+P  M ++   D     +LSL+H D++K  I+ + Q+ +TCFIS+ S+V   T+ 
Sbjct: 476 GQIALDPPTMNLV--KDPILDPLLSLRHFDTLKCTIDTKYQLTMTCFISDLSMVEKTTKL 533

Query: 531 WAQYSEDIIYSSEMEEWCGKPSESQDCLIIVKVSNLPRNALCEWGGIAAKSLEVEHDDHD 590
           W+ YS++  Y    E   G       CLI+VK+S LPR+A CEWGGI  K L+ +++D D
Sbjct: 534 WSIYSDESDYQ---EVPVG-------CLIVVKISQLPRSASCEWGGITCKDLQ-DYNDTD 582

Query: 591 ---------LTAELRKLNLDGGIN-----IINHHDLTLRRFKTTFANTAEQLITQIRGVT 636
                    ++ +L  LNL   IN     I + +D   +   TTF N+ + L+  +  + 
Sbjct: 583 SDSDFSLDKVSIQLDSLNLVERINWFETCITSGND--KQYIATTFVNSNDSLLDLLNELA 640

Query: 637 SKNTHCIIFFSEYLCVDKLQDT--SAEFIPVEKVYNYKGEE 675
            + +  +  +   L VD +  T  + EF PVE++YNYKGEE
Sbjct: 641 KRPSQ-VTLYGNPLNVDAILPTFVNVEFYPVEQIYNYKGEE 680

>Kwal_27.11310
          Length = 688

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/686 (49%), Positives = 450/686 (65%), Gaps = 25/686 (3%)

Query: 1   MKFVALISGGKDSCYNILHCQRQGHELVALANLRPIDTDKQELDSFMFQTVGHDIVSLYE 60
           MKF+AL+SGGKDSCY+ILH  RQGHELVAL NL P D D+QELDSFMFQTVGHDIV+ Y+
Sbjct: 1   MKFLALVSGGKDSCYSILHSLRQGHELVALGNLYPADQDQQELDSFMFQTVGHDIVNWYQ 60

Query: 61  NCTGLPLFRKEIHPKTSKNVELNYTPTKDDEIEVLYQLLSEVKQSIPDLQAVSVGAILSS 120
            CTGLPLFR+ IHP+TSKNV LNY PT DDEIE L +LL E K+ +P+++AV+ GAILSS
Sbjct: 61  KCTGLPLFRRAIHPQTSKNVSLNYYPTDDDEIEDLLELLKEAKKQMPEIEAVNAGAILSS 120

Query: 121 YQRTRVEDVCGRLGLVVLSYLWQRSQLELMTEMCSMSKQEDELNTSESCKLDARIIKVAA 180
           YQRTRVEDVC RLGLVVLSYLWQR Q ELMTEMCSMSK   E     + K+DARIIK AA
Sbjct: 121 YQRTRVEDVCSRLGLVVLSYLWQRDQRELMTEMCSMSKHSSE---PAAQKMDARIIKTAA 177

Query: 181 IGLDNTDLGKSLPQLFPKMLKLNTRYEVHICGEGGEFESMVLDAPFFRKGFLKLEEVIDT 240
           +GLD+  L KSLP++FP + KLN  YEVHICGEGGE+E+MV D PFF  G+L+   +   
Sbjct: 178 VGLDDRHLAKSLPEMFPVLQKLNHMYEVHICGEGGEYETMVFDGPFFFHGYLEPTLLNVE 237

Query: 241 TDNENDGVYNAQLIVKFQKR--ELPDDIFQSELSRLPVPPLFDPAWNELYELIDNENFED 298
               +DGVY+A++ V F KR   LP +     L  LPVPP+ +  W EL + +   +   
Sbjct: 238 GSGNSDGVYSARMKVNFVKRSSHLPTEEL---LENLPVPPILEEKWIELLDEVSGLDAPS 294

Query: 299 TKTINTMNIRLPSVKTHTNRIGNLLYISNIQPQYKDGTVQEQVKDVLQQLDNILKDNHLT 358
                ++   L   K     IG+LL +SN+ P+    +  E+V+DV +QL +IL+D  L+
Sbjct: 295 KTHSPSVLDSLYRPKVAIKSIGHLLCVSNLTPK-GGSSPDEKVQDVFRQLSDILRDYELS 353

Query: 359 AKNVLYSSLLLTDMSLFASVNQEYSKFFDIWKNGPLPPARACIESNIINDGSALQLSVVV 418
              +L S +LL DM  F+ VN+ Y++FF + +NGPLPP+RAC+ S+++   + LQLSV+V
Sbjct: 354 PAQILSSLVLLADMGDFSKVNEHYNEFFHVARNGPLPPSRACVGSSLVGSENILQLSVIV 413

Query: 419 KYADQT--LGNDIEKCEKSGLHVQGRSYWAPCNIGPYSQSIWLSNDLNQLSYLSGQIALE 476
             +  T   G  I    K+GLHVQGRSYWAPCNIGPYSQ+ W   D NQ+SY+SGQIAL 
Sbjct: 414 DTSSHTHKQGEMILYENKNGLHVQGRSYWAPCNIGPYSQATWNKTDANQVSYISGQIALI 473

Query: 477 PSQMEMI-----DTNDAKQQAVLSLKHLDSIKQVINARNQVQLTCFISNNSIVPLLTQTW 531
           PS MEM+     D +    Q +LSL+H D++K  I A+ Q+ +TC+++   +VP+++  W
Sbjct: 474 PSSMEMVGTLHPDASPGVSQCLLSLRHFDTLKTTIQAQCQLNMTCYVAQEYMVPIVSNVW 533

Query: 532 AQYSEDIIYSSEMEEWCGKPSESQDCLIIVKVSNLPRNALCEWGGIAAKSLEV--EHDDH 589
           + Y  ++   SEM  W  K ++    LIIVKVS+LPR ALCEWGG   K+L+V  E DD 
Sbjct: 534 SLYCTEMGSKSEM--WFDKENDDPKSLIIVKVSSLPRQALCEWGGTTCKTLKVEDEEDDD 591

Query: 590 DLTAELRKLNLDGGINIINHHDLTLRRFKTTFANTAEQLITQIRGVTSKNTHCIIFFSEY 649
            +  E      D     + + D T R F T F ++ E+++  ++  +S +T   +F+   
Sbjct: 592 VICREAVNPRSDCFQAFVENKDET-RVFTTLFVDSKEEVVETLKEQSSCSTK--LFYRP- 647

Query: 650 LCVDKLQDTSAEFIPVEKVYNYKGEE 675
                      E  PVEK+Y+YKG E
Sbjct: 648 -STQAFDTDGVECCPVEKIYDYKGRE 672

>KLLA0D16984g 1439669..1441759 similar to sgd|S0004133 Saccharomyces
           cerevisiae YLR143w, start by similarity
          Length = 696

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/694 (48%), Positives = 453/694 (65%), Gaps = 35/694 (5%)

Query: 1   MKFVALISGGKDSCYNILHCQRQGHELVALANLRPIDTDKQELDSFMFQTVGHDIVSLYE 60
           MKFVALISGGKDS YNILHC +Q HEL+A ANL P + D+QELDSFMFQTVGHD++  Y 
Sbjct: 1   MKFVALISGGKDSNYNILHCLKQDHELIAFANLHPENEDEQELDSFMFQTVGHDLIRWYP 60

Query: 61  NCTGLPLFRKEIHPKTSKNVELNYTPTKDDEIEVLYQLLSEVKQSIPDLQAVSVGAILSS 120
            C+G+PL+R+ +H   SKN+ LNYT TKDDEIE LY+LL +++   PDL+AVSVGAILSS
Sbjct: 61  ECSGVPLYRQALHKNGSKNIALNYTETKDDEIEDLYKLLRKIQLDSPDLEAVSVGAILSS 120

Query: 121 YQRTRVEDVCGRLGLVVLSYLWQRSQLELMTEMCSMSKQEDELNTSESC----KLDARII 176
           YQRTRVEDVC RLGL  LSYLWQR Q ELM EMCSMSK  D + T++ C    KLDARII
Sbjct: 121 YQRTRVEDVCSRLGLTTLSYLWQRDQRELMQEMCSMSK--DTIVTTDDCDNVGKLDARII 178

Query: 177 KVAAIGLDNTDLGKSLPQLFPKMLKLNTRYEVHICGEGGEFESMVLDAPFFRKGFLKLEE 236
           KVAAIGL+   LGKSLP++ P MLKLN+ Y+VHICGEGGEFE+MVLD PFF+ G L+L  
Sbjct: 179 KVAAIGLNQNHLGKSLPEILPTMLKLNSLYDVHICGEGGEFETMVLDTPFFKHGHLQLNS 238

Query: 237 VIDTTDNENDGVYNAQLIVKFQKRELPDDIFQSELSRLPVPPLFDPAWNELYELIDNENF 296
           + D TD  NDGV+ A   V++    L     + EL +LPVP + +  W E+Y  +   + 
Sbjct: 239 INDVTDTSNDGVFAATFNVEYVPEALSPTKLEKELEKLPVPAVLNEKWYEMYLRLMTIDL 298

Query: 297 EDTKTINTMNIRLPSVKTHTNRIGNLLYISNIQPQYKDGTVQEQVKDVLQQLDNILKDNH 356
           +        +   PSV    N +G LLYISNI P  K  +++E+  DV  QL +IL    
Sbjct: 299 KKLNNCPNHHNVSPSVPVSINEVGKLLYISNIAPS-KGESLKEKCLDVFSQLTSILSSRS 357

Query: 357 LTAKNVLYSSLLLTDMSLFASVNQEYSKFFDIWKNGPLPPARACIESNIINDGSALQLSV 416
           + A  +L SSLLL+DM+ F  VN  Y+++F++ K GPLPPARAC+ES+ +     +QLSV
Sbjct: 358 IFACQILSSSLLLSDMNNFQEVNSYYNEYFNVTKIGPLPPARACVESSFLK--HPVQLSV 415

Query: 417 VVKYADQTLGND---IEKCEKSGLHVQGRSYWAPCNIGPYSQSIWLSNDLNQLSYLSGQI 473
           VV  +   +  D   I    K GLHVQGRSYW PCNIGPYSQ+ W  +D N+++Y+SGQI
Sbjct: 416 VVDLSADCVPTDNGIILNRSKDGLHVQGRSYWCPCNIGPYSQATWNQSDRNKVTYISGQI 475

Query: 474 ALEPSQMEMI-DT----NDAKQQAVLSLKHLDSIKQVINARNQVQLTCFISNNSIVPLLT 528
            LEPS M++  DT    N    + VLSL++  ++ + +N+   + + C+IS + ++P + 
Sbjct: 476 GLEPSSMKLWGDTTLLENPDIAEVVLSLRNYFTLSETVNSSIPLTMVCYISQSYVLPAVR 535

Query: 529 QTWAQYSEDIIYSSEMEEWCGKPSESQDCLIIVKVSNLPRNALCEWGGIAAKSLEVE--H 586
             W+ +++++   SE+  W  +     D L+IVKVSNLP+NALCEW G+  ++L +E  +
Sbjct: 536 SAWSLFAKELAEESEL--WFDQEPVGVDSLVIVKVSNLPKNALCEWTGMNCQNLAIEDDY 593

Query: 587 DDHDLTAELR---KLNLDGGINIINH-HDLTL------RRFKTTFANTAEQLITQIRGVT 636
           D+ DL A++     L     I + N+ HD+ +      R F T F ++ EQLI  +    
Sbjct: 594 DEDDLAAQIHMNLTLKSQTDIELPNYAHDVIISENGFKRHFITLFLDSHEQLILTLS--E 651

Query: 637 SKNTHCIIFFSEYLCVDKLQDTSAEFIPVEKVYN 670
            KN    +FFS+   V +   T  E+IPVE+VY+
Sbjct: 652 CKNAQITLFFSKDYAVPEY--THVEYIPVEQVYD 683

>YLR143W (YLR143W) [3552] chr12 (427330..429387) Protein containing
           an endoribonuclease L-PSP domain and a DUF71 domain of
           unknown function, has moderate similarity to
           uncharacterized C. albicans Orf6.3850p [2058 bp, 685 aa]
          Length = 685

 Score =  608 bits (1568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/694 (47%), Positives = 458/694 (65%), Gaps = 37/694 (5%)

Query: 1   MKFVALISGGKDSCYNILHCQRQGHELVALANLRPIDTDKQELDSFMFQTVGHDIVSLYE 60
           MKF+ALISGGKDS YNI HC +  HEL+AL N+ P ++++QELDSFMFQTVGHD++  Y 
Sbjct: 1   MKFIALISGGKDSFYNIFHCLKNNHELIALGNIYPKESEEQELDSFMFQTVGHDLIDYYS 60

Query: 61  NCTGLPLFRKEIHPKTSKNVELNYTPTKDDEIEVLYQLLSEVKQSIPDLQAVSVGAILSS 120
            C G+PLFR+ I   TS NVELNYT T+DDEIE L++LL  VK  IPDL+AVSVGAILSS
Sbjct: 61  KCIGVPLFRRSILRNTSNNVELNYTATQDDEIEELFELLRTVKDKIPDLEAVSVGAILSS 120

Query: 121 YQRTRVEDVCGRLGLVVLSYLWQRSQLELMTEMCSMSKQED--ELNTSESCKLDARIIKV 178
           YQRTRVE+VC RLGLVVLSYLWQR Q ELM EMC MSK  +  E +T+   K DARIIKV
Sbjct: 121 YQRTRVENVCSRLGLVVLSYLWQRDQAELMGEMCLMSKDVNNVENDTNSGNKFDARIIKV 180

Query: 179 AAIGLDNTDLGKSLPQLFPKMLKLNTRYEVHICGEGGEFESMVLDAPFFRKGFLKLEEVI 238
           AAIGL+   LG SLP + P + KLN  Y+VHICGEGGEFE+MVLDAPFF+ G+L+L +++
Sbjct: 181 AAIGLNEKHLGMSLPMMQPVLQKLNQLYQVHICGEGGEFETMVLDAPFFQHGYLELIDIV 240

Query: 239 DTTDNENDGVYNAQLIVKFQKRELPDDIFQSELSRLPVPPLFDPAWNELYELIDNENFE- 297
             +D E   V+NA+L VKFQ R L      ++L +LPVP +F   W +L + +  +  + 
Sbjct: 241 KCSDGE---VHNARLKVKFQPRNLSKSFLLNQLDQLPVPSIFGNNWQDLTQNLPKQQAKT 297

Query: 298 -DTKTINTMNIRLPSVKTHTNRIGNLLYISNIQPQYKDGTVQEQVKDVLQQLDNILKDNH 356
            + +  N M+  LP  +T  N+  + LYISN+Q + K  TV++Q +D+  +L +IL  N 
Sbjct: 298 GEQRFENHMSNALP--QTTINKTNDKLYISNLQSR-KSETVEKQSEDIFTELADILHSNQ 354

Query: 357 LTAKNVLYSSLLLTDMSLFASVNQEYSKFFDIWKNGPLPPARACIESNIINDGSALQLSV 416
           +   ++L +SLL+ DMS F  +N+ Y++F D+ K GPLPP+RAC+ S  + +   +QLSV
Sbjct: 355 IPRNHILSASLLIRDMSNFGKINKIYNEFLDLSKYGPLPPSRACVGSKCLPEDCHVQLSV 414

Query: 417 VVKYADQTLGNDIEKCEKSGLHVQGRSYWAPCNIGPYSQSIWLSNDLNQLSYLSGQIALE 476
           VV    +  G +     K GLHVQGRSYWAPCNIGPYSQS WL++D NQ+S++SGQI L 
Sbjct: 415 VVDV--KNTGKEKINKNKGGLHVQGRSYWAPCNIGPYSQSTWLNDDANQVSFISGQIGLV 472

Query: 477 PSQMEMIDTNDAKQQAVLSLKHLDSIKQVINARNQVQLTCFISNNSIVPLLTQTWAQYSE 536
           P  ME++ T     Q VL+L+H D++ + I A+ ++ +TC+IS+ S++  + +TWA Y  
Sbjct: 473 PQSMEILGT-PLTDQIVLALQHFDTLCETIGAQEKLLMTCYISDESVLDSVIKTWAFYCS 531

Query: 537 DIIYSSEMEEWCGKPSESQDCLIIVKVSNLPRNALCEWGGIAAKSLEVEHDDH------- 589
           ++ + S++  W  K  + + CL++VK+S LPR A+ E+GG+  K L V+ +D        
Sbjct: 532 NMNHRSDL--WMDKSDDVEKCLVLVKISELPRGAVAEFGGVTCKRLIVDDNDSDKKEREE 589

Query: 590 --DLTAELRKLNLDGGINIINHHDLTL------RRFKTTFANTAEQLITQIRGVTSKNTH 641
             D++   +KLNL    NI   H+ T+      R F T F ++ E+L   I   T K+  
Sbjct: 590 NDDVSTVFQKLNL----NIEGFHNTTVSAFGYNRNFITGFVDSREEL-ELILEKTPKSAQ 644

Query: 642 CIIFFSEYLCVDKLQDTSAEFIPVEKVYNYKGEE 675
             ++++    +         + PVEK+++Y+G+E
Sbjct: 645 ITLYYNPKEIITFHHHIG--YYPVEKLFDYRGKE 676

>AGL164W [4148] [Homologous to ScYLR143W - SH]
           complement(388842..390902) [2061 bp, 686 aa]
          Length = 686

 Score =  559 bits (1440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/606 (50%), Positives = 393/606 (64%), Gaps = 31/606 (5%)

Query: 1   MKFVALISGGKDSCYNILHCQRQGHELVALANLRPIDTDKQELDSFMFQTVGHDIVSLYE 60
           MKFVAL+SGGKDSCYNILHC + GHELVA ANL P + + QELDSFMFQTVGH+IVS Y 
Sbjct: 1   MKFVALVSGGKDSCYNILHCMKNGHELVAFANLHPKEENVQELDSFMFQTVGHEIVSYYG 60

Query: 61  NCTGLPLFRKEIHPKTSKNVELNYTPTKDDEIEVLYQLLSEVKQSIPDLQAVSVGAILSS 120
            CTGLP+FR+ I   TSKNV LNY  T  DE+E LY LL  VK S   ++AVSVGAILSS
Sbjct: 61  KCTGLPVFRQAIARDTSKNVALNYFATAGDEVEDLYLLLKRVKDSNLGVEAVSVGAILSS 120

Query: 121 YQRTRVEDVCGRLGLVVLSYLWQRSQLELMTEMCSMSKQEDELNTSESCKLDARIIKVAA 180
           YQRTRVEDVC RLGL  LSYLW+R Q +LM EMCSMSK+  +   +   KLDARIIKVAA
Sbjct: 121 YQRTRVEDVCSRLGLTALSYLWERDQEDLMREMCSMSKKPGDAPVA---KLDARIIKVAA 177

Query: 181 IGLDNTDLGKSLPQLFPKMLKLNTRYEVHICGEGGEFESMVLDAPFFRKGFLKLEEVIDT 240
           IGL+   LG SLP++FP +L LN RY VHICGEGGEFE+MVLDAPFF KG+L++   + T
Sbjct: 178 IGLNQNHLGLSLPEIFPTLLSLNRRYGVHICGEGGEFETMVLDAPFFTKGYLEIVG-LRT 236

Query: 241 TDNENDGVYNAQLIVKFQKRELPDDIFQSELSRLPVPPLFDPAWNELYELIDNENFEDTK 300
           T     GV  A L ++F  R L +    ++L+ LPVP L +  W E+Y  ++   F D  
Sbjct: 237 TVERGSGVCTAALDIQFVARHL-EGTTGADLANLPVPKL-ENKWEEIYHDLEPTKFGDIP 294

Query: 301 TINTMNIRLPSVKTHTNRIGNLLYISNIQPQYKDGTVQEQVKDVLQQLDNILKDNHLTAK 360
           + +  +     V    N +G LLY+SNIQP+ + G +++Q +DV  QL+  L  + +   
Sbjct: 295 S-SIHSSAETGVSLSENTVGGLLYVSNIQPRCR-GPLEKQARDVFDQLNESLTRHGVVKA 352

Query: 361 NVLYSSLLLTDMSLFASVNQEYSKFFDIWKNGPLPPARACIESNIINDGSALQLSVVVKY 420
            VL S LLL DM  FA +N  Y+ +F I + GPLPP+RACIES  +  G  LQLSVV+++
Sbjct: 353 QVLSSVLLLADMGTFAEINTAYNGYFSIQEIGPLPPSRACIESKSLAPGIGLQLSVVIQH 412

Query: 421 ADQTL--GNDIEKCEKSGLHVQGRSYWAPCNIGPYSQSIWLSNDLNQLSYLSGQIALEPS 478
             + +   N +    K GLHVQ RSYW PCNIGPYSQ+ W + D N+++Y+SGQIAL P+
Sbjct: 413 DIKIVPCANLLLNPGKGGLHVQSRSYWCPCNIGPYSQATWDTTDRNKVAYISGQIALLPN 472

Query: 479 QMEMIDT---------NDAKQQAVLSLKHLDSIKQVINARNQVQLTCFISNNSIVPLLTQ 529
            MEM +T          +   QA+L+L+H +++K+ I   +Q+ + C+I+ + + P    
Sbjct: 473 TMEMCNTLTGTSGNPYQEGLSQAILALRHFNTLKKSIETCHQLFMCCYIAEDFMAP---- 528

Query: 530 TWAQYSEDIIYSSEMEEWCGKPSESQDCLIIVKVSNLPRNALCEWGGIAAKSLEVEHDDH 589
                   I  S         P  +   L+IV+VS LPR+ALCEWGG A + L VE DD 
Sbjct: 529 --------IASSVWSSYCSSNPDNTLGTLLIVRVSALPRSALCEWGGSACQRLLVEDDDD 580

Query: 590 DLTAEL 595
           D + EL
Sbjct: 581 DYSDEL 586

>CAGL0M12386g 1234993..1235421 similar to sp|P40037 Saccharomyces
           cerevisiae YER057c HIG1 Heat-shock induceable Inhibiter
           of cell Growth, hypothetical start
          Length = 142

 Score = 64.3 bits (155), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 63/109 (57%), Gaps = 10/109 (9%)

Query: 314 THTNRIGNLLYISNIQPQYKD-----GTVQEQVKDVLQQLDNILKDNHLTAKNVLYSSLL 368
           +H  ++ NL+Y+S   P  KD     G++ ++ + V+Q + NILKD++     ++  ++ 
Sbjct: 34  SHAMKVNNLIYVSGQIPYTKDNKPVEGSISDKAEQVIQNVQNILKDSNSDLNRIVKVNIF 93

Query: 369 LTDMSLFASVNQEYSKFFDIWKNGPLPPARACIESNIINDGSALQLSVV 417
           L DM+ FA  N+ Y+K+F++ K     PAR+C+    +  G  L++ V+
Sbjct: 94  LADMNNFAEFNKVYAKYFNVHK-----PARSCVAVAALPLGVDLEMEVI 137

>Scas_715.53
          Length = 128

 Score = 50.1 bits (118), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 25/109 (22%), Positives = 61/109 (55%), Gaps = 10/109 (9%)

Query: 314 THTNRIGNLLYISNIQPQYKD-----GTVQEQVKDVLQQLDNILKDNHLTAKNVLYSSLL 368
           +H  +  NL+++S   P   +     G++ ++ + V+Q + N+L+ ++ + + ++  ++ 
Sbjct: 20  SHAMKANNLIFLSGQIPMTAENKPVEGSIADKAEQVIQNIKNVLEASNSSLEKIVKVNIF 79

Query: 369 LTDMSLFASVNQEYSKFFDIWKNGPLPPARACIESNIINDGSALQLSVV 417
           L D++ FA  N  Y+K+F++ K     PAR+C+    +   + L++ V+
Sbjct: 80  LADINSFAEFNTVYAKYFNVHK-----PARSCVAVAALPLNADLEMEVI 123

>YIL051C (MMF1) [2616] chr9 complement(257842..258279) Protein
           important for maintenance of mitochondrial DNA, may be
           involved in isoleucine-dependent transaminase activity,
           member of the p14.5 family [438 bp, 145 aa]
          Length = 145

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 27/89 (30%), Positives = 46/89 (51%), Gaps = 10/89 (11%)

Query: 318 RIGNLLYISNIQPQYKD-----GTVQEQVKDVLQQLDNILKDNHLTAKNVLYSSLLLTDM 372
           +  N +Y+S   P   D     G++ E+ + V Q + NIL +++ +  N++  ++ L DM
Sbjct: 41  KANNFVYVSGQIPYTPDNKPVQGSISEKAEQVFQNVKNILAESNSSLDNIVKVNVFLADM 100

Query: 373 SLFASVNQEYSKFFDIWKNGPLPPARACI 401
             FA  N  Y+K F   K     PAR+C+
Sbjct: 101 KNFAEFNSVYAKHFHTHK-----PARSCV 124

>YER057C (HMF1) [1487] chr5 complement(270735..271124) Protein that
           inhibits cell growth and contributes to cell death at
           high temperature, member of the p14.5 family [390 bp,
           129 aa]
          Length = 129

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 26/110 (23%), Positives = 58/110 (52%), Gaps = 10/110 (9%)

Query: 318 RIGNLLYISNIQPQYKD-----GTVQEQVKDVLQQLDNILKDNHLTAKNVLYSSLLLTDM 372
           ++ NL+++S   P   D     G++ ++ + V+Q + N+L+ ++ +   V+  ++ L D+
Sbjct: 25  KVNNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQNIKNVLEASNSSLDRVVKVNIFLADI 84

Query: 373 SLFASVNQEYSKFFDIWKNGPLPPARACIESNIINDGSALQLSVVVKYAD 422
           + FA  N  Y+K+F+  K     PAR+C+    +  G  +++  +    D
Sbjct: 85  NHFAEFNSVYAKYFNTHK-----PARSCVAVAALPLGVDMEMEAIAAERD 129

>KLLA0C08349g 731629..732051 highly similar to sp|P40185
           Saccharomyces cerevisiae YIL051c MMD1 required for
           maintenance of mitochondrial DNA, start by similarity
          Length = 140

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 26/110 (23%), Positives = 58/110 (52%), Gaps = 10/110 (9%)

Query: 318 RIGNLLYISNIQPQYKD-----GTVQEQVKDVLQQLDNILKDNHLTAKNVLYSSLLLTDM 372
           ++ NL+++S   P   +     G++ ++ + V+Q + NIL + +     ++  ++ L D+
Sbjct: 36  KVNNLIFVSGQIPYTAENKPVEGSIADKAEQVIQNVKNILVEANSDLDKIVKVNIFLADI 95

Query: 373 SLFASVNQEYSKFFDIWKNGPLPPARACIESNIINDGSALQLSVVVKYAD 422
           + FA  N  Y+K+F++ K     PAR+C+ +  +     L++ V+    D
Sbjct: 96  NSFAEFNSVYAKYFNVHK-----PARSCVAAKALPLNVDLEMEVIAVEKD 140

>Scas_704.34
          Length = 148

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 25/89 (28%), Positives = 50/89 (56%), Gaps = 10/89 (11%)

Query: 318 RIGNLLYISN---IQPQYK--DGTVQEQVKDVLQQLDNILKDNHLTAKNVLYSSLLLTDM 372
           +  N +Y+S      P+ K  +GT+ ++ + V Q + NILK++  +   ++  ++ L D+
Sbjct: 41  KANNFVYVSGQIPYTPENKPVEGTISDKAEQVFQNIKNILKESGSSMDKIVKVNVFLADI 100

Query: 373 SLFASVNQEYSKFFDIWKNGPLPPARACI 401
           + F   N  Y+K+F++ K     PAR+C+
Sbjct: 101 NNFKEFNGVYAKYFNVHK-----PARSCV 124

>Sklu_2193.3 YIL051C, Contig c2193 5846-6232 reverse complement
          Length = 128

 Score = 44.3 bits (103), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 52/89 (58%), Gaps = 10/89 (11%)

Query: 318 RIGNLLYISNIQP-----QYKDGTVQEQVKDVLQQLDNILKDNHLTAKNVLYSSLLLTDM 372
           ++ N++++S   P     +  +G++ ++ + V+Q + NIL++ + +   ++  ++ L D+
Sbjct: 24  KVNNMVFVSGQIPYTHENKPVEGSIADKAEQVIQNVKNILEEANSSLNKIVKVNVFLADI 83

Query: 373 SLFASVNQEYSKFFDIWKNGPLPPARACI 401
           + FA  N  Y+K+F+  K     PAR+C+
Sbjct: 84  NDFAEFNGVYAKYFNEHK-----PARSCV 107

>Kwal_55.21247
          Length = 134

 Score = 43.9 bits (102), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 23/83 (27%), Positives = 47/83 (56%), Gaps = 6/83 (7%)

Query: 337 VQEQVKDVLQQLDNILKDNHLTAKNVLYSSLLLTDMSLFASVNQEYSKFFDIWKNGPLPP 396
           +++QV++ L+ L N+L+ +  + + V+   L ++D S   +VN+ YS++F      P  P
Sbjct: 50  LEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSEYF------PGAP 103

Query: 397 ARACIESNIINDGSALQLSVVVK 419
           AR+CI  +  N    ++L  + +
Sbjct: 104 ARSCIVVSFPNASLKVELECIAE 126

>Kwal_23.5804
          Length = 141

 Score = 43.5 bits (101), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 27/110 (24%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 318 RIGNLLYISNIQP-----QYKDGTVQEQVKDVLQQLDNILKDNHLTAKNVLYSSLLLTDM 372
           R+  ++++S   P     +  +GT+ ++ + V+Q + NIL++ +     ++  ++ L D+
Sbjct: 37  RVNKMVFVSGQIPYTAENKRVEGTIADKAEQVIQNVRNILEEANSGLDKIVKVNIFLADI 96

Query: 373 SLFASVNQEYSKFFDIWKNGPLPPARACIESNIINDGSALQLSVVVKYAD 422
             FA  N  Y K+F+  K     PAR+C+    +     L++ VV    D
Sbjct: 97  KDFAEFNGVYGKYFNEHK-----PARSCVAVKALPLDVDLEMEVVAVEKD 141

>ADL077C [1664] [Homologous to ScYIL051C (MMF1) - SH; ScYER057C
           (HMF1) - SH] (549526..549954) [429 bp, 142 aa]
          Length = 142

 Score = 43.1 bits (100), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 51/105 (48%), Gaps = 10/105 (9%)

Query: 318 RIGNLLYISNIQPQYKD-----GTVQEQVKDVLQQLDNILKDNHLTAKNVLYSSLLLTDM 372
           R   ++++S   P   D     G+V ++ + V+  + N+L+ ++     V   ++ L DM
Sbjct: 38  RANGMVFVSGQIPYTPDNKPVEGSVADKTEQVIANVRNVLEASNSGLDRVAKVNVFLADM 97

Query: 373 SLFASVNQEYSKFFDIWKNGPLPPARACIESNIINDGSALQLSVV 417
           + FA  N  Y+K+F     G   PAR+C+    +     L++ V+
Sbjct: 98  AYFAEFNSVYAKYF-----GEHKPARSCVAVRALPLNVDLEMEVI 137

>Kwal_23.2807
          Length = 129

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/65 (32%), Positives = 39/65 (60%), Gaps = 6/65 (9%)

Query: 337 VQEQVKDVLQQLDNILKDNHLTAKNVLYSSLLLTDMSLFASVNQEYSKFFDIWKNGPLPP 396
           +++Q+ + L+ L N+L  +  + + VL   L ++D S  ++VN+ YS++F      P  P
Sbjct: 51  LEQQIINALENLKNVLHASGSSLERVLKVLLFVSDASYASTVNEVYSRYF------PNAP 104

Query: 397 ARACI 401
           AR+CI
Sbjct: 105 ARSCI 109

>KLLA0B14817g 1301705..1302100 similar to sp|Q8XCD0 Escherichia coli
           O157:H7 Orf, hypothetical protein, start by similarity
          Length = 131

 Score = 38.9 bits (89), Expect = 0.003,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 46/94 (48%), Gaps = 21/94 (22%)

Query: 337 VQEQVKDVLQQLDNILKDNHLTAKNVLYSSLLLTDMSLFASVNQEYSKFFDIWKNGPLPP 396
           +++QV++ L  L  +LK ++ +  +VL   L + D S  ++VN  Y ++F      P  P
Sbjct: 51  LEKQVRNALDNLGRVLKASNSSFDDVLKILLFVADGSYASTVNAVYKEYF------PERP 104

Query: 397 ARACIESNIINDGSALQLSVVVKYADQTLGNDIE 430
           AR+CI               VV + D TL  ++E
Sbjct: 105 ARSCI---------------VVSFPDPTLKVELE 123

>KLLA0E03894g complement(364475..364888) some similarities with
           sp|Q87LF6 Vibrio parahaemolyticus Conserved hypothetical
           protein, hypothetical start
          Length = 137

 Score = 32.3 bits (72), Expect = 0.46,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 42/83 (50%), Gaps = 6/83 (7%)

Query: 337 VQEQVKDVLQQLDNILKDNHLTAKNVLYSSLLLTDMSLFASVNQEYSKFFDIWKNGPLPP 396
           +++Q ++ +  L  +L+ +  +  +VL   L ++D S    VN+ + +FF      P  P
Sbjct: 51  LEQQARNSMINLKKVLEVSGSSVDSVLKILLFVSDGSYAGIVNKVFKEFF------PNQP 104

Query: 397 ARACIESNIINDGSALQLSVVVK 419
           AR+CI     N+   ++L  + +
Sbjct: 105 ARSCIVVAFPNNKLKVELECIAE 127

>AFR189C [3381] [Homologous to ScYLL035W (GRC3) - SH]
           (780916..782817) [1902 bp, 633 aa]
          Length = 633

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 32/67 (47%)

Query: 165 TSESCKLDARIIKVAAIGLDNTDLGKSLPQLFPKMLKLNTRYEVHICGEGGEFESMVLDA 224
           TSE+  L   + +     +  T +G S PQ +P+M      + +H     G+  + +L+ 
Sbjct: 304 TSETLSLGQHLAQGHREMIQTTYIGSSTPQTWPEMYLTAMEHIIHKWEMEGQMNTALLNL 363

Query: 225 PFFRKGF 231
           P + KGF
Sbjct: 364 PGWIKGF 370

>Scas_701.28
          Length = 271

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 45/103 (43%), Gaps = 26/103 (25%)

Query: 9   GGKDSCYNILHCQRQGHELVALANLRPIDTDKQELDSFMFQTVGHDIVSLYENCTGLPLF 68
           GG  S  N +  Q + H    L+   P+DT KQ++ S + +TVG                
Sbjct: 24  GGATSRLNKITGQAESH----LSTESPLDTPKQKITSPVLETVGAP-------------- 65

Query: 69  RKEIHPKTSKNVELNYTPTKDDEIEVLYQL--LSEVKQSIPDL 109
           R+   P T+K+         D ++E+L +L  +    QS PDL
Sbjct: 66  REASIPTTNKDAN------ADPQVELLKKLADMQNQDQSTPDL 102

>YDL024C (DIA3) [837] chr4 complement(408448..409854) Protein
           involved in invasive and pseudohyphal growth, has
           similarity to acid phosphatases [1407 bp, 468 aa]
          Length = 468

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 35/86 (40%), Gaps = 12/86 (13%)

Query: 58  LYENCTGLPLFRKEIHPKTSKNVELNYTPTKDDEIEVLYQLLSE----------VKQSIP 107
           L ENCT  P+F    + K   +    +     D   +  Q LSE           K S P
Sbjct: 160 LMENCTNFPIF--TTNSKRIYDTAQYFAEALGDGFNISLQTLSENSSSGANTLAAKSSCP 217

Query: 108 DLQAVSVGAILSSYQRTRVEDVCGRL 133
           +  + +   IL SY R  +E++  RL
Sbjct: 218 NWNSNANNDILMSYSRDYLENISDRL 243

>Scas_504.1
          Length = 3076

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 3/62 (4%)

Query: 403 SNIINDGSALQLSVVVKYADQTLGNDIEKCEKSGLHVQGRSYWAPCNIGPYSQSIWLSND 462
           S +IN+G A  L +++KY  +    D     KS +H +  S    CN+G   ++  L  D
Sbjct: 56  SRMINNGIAAMLDLLLKYEPELYSGDAIVNTKSKIHEKSTSV---CNLGTIEETPRLLKD 112

Query: 463 LN 464
           +N
Sbjct: 113 IN 114

>Scas_633.26
          Length = 844

 Score = 30.4 bits (67), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 21/34 (61%)

Query: 329 QPQYKDGTVQEQVKDVLQQLDNILKDNHLTAKNV 362
           +P  +DGT  ++  ++L  LDN+  D +L  +N+
Sbjct: 477 RPATQDGTSNQKTTELLHHLDNVEFDENLAGRNI 510

>KLLA0F22583g 2107305..2108909 highly similar to sp|P39077
           Saccharomyces cerevisiae YJL014w CCT3 chaperonin of the
           TCP1 ring complex, cytosolic, start by similarity
          Length = 534

 Score = 30.0 bits (66), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 35/77 (45%), Gaps = 7/77 (9%)

Query: 342 KDVLQQLDNILKDNHLTAKNVLYSSLL-----LTDMSLFASVNQEYSKFFDI--WKNGPL 394
           KD+L ++D  L+D    A+NV+ S  L      T+M+L   + ++  +   I  W    +
Sbjct: 386 KDILNEIDRNLQDAMAVARNVMLSPSLSPGGGATEMALSVKLTEKAKQLEGIQQWPYQAV 445

Query: 395 PPARACIESNIINDGSA 411
             A  CI   +I +   
Sbjct: 446 ADAMECIPRTLIQNAGG 462

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 22,885,941
Number of extensions: 1032585
Number of successful extensions: 3482
Number of sequences better than 10.0: 40
Number of HSP's gapped: 3566
Number of HSP's successfully gapped: 41
Length of query: 677
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 569
Effective length of database: 12,857,365
Effective search space: 7315840685
Effective search space used: 7315840685
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)