Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M04477g56355428200.0
Kwal_27.113034795215202e-59
KLLA0D16940g5402993936e-41
AGL166W4342553374e-34
Scas_506.54413993341e-33
YLR141W (RRN5)3632863202e-32
KLLA0F22066g3764100750.64
Kwal_23.582842443711.5
Scas_602.111186262702.3
KLLA0F18953g647106665.2
CAGL0K01397g30453648.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M04477g
         (554 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M04477g 491638..493329 some similarities with sp|Q02983 Sac...  1090   0.0  
Kwal_27.11303                                                         204   2e-59
KLLA0D16940g 1435379..1437001 some similarities with sp|Q02983 S...   155   6e-41
AGL166W [4146] [Homologous to ScYLR141W (RRN5) - SH] complement(...   134   4e-34
Scas_506.5                                                            133   1e-33
YLR141W (RRN5) [3550] chr12 (423684..424775) Component of the Up...   127   2e-32
KLLA0F22066g complement(2051033..2062327) similar to sp|P38811 S...    33   0.64 
Kwal_23.5828                                                           32   1.5  
Scas_602.11                                                            32   2.3  
KLLA0F18953g 1737522..1739465 similar to sp|P46944 Saccharomyces...    30   5.2  
CAGL0K01397g complement(122804..123718) similar to sp|P38913 Sac...    29   8.7  

>CAGL0M04477g 491638..493329 some similarities with sp|Q02983
           Saccharomyces cerevisiae YLR141w RRN5, hypothetical
           start
          Length = 563

 Score = 1090 bits (2820), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 531/554 (95%), Positives = 531/554 (95%)

Query: 1   MSDDRTHKKQKRIRVRTDVVADYFDLYNREVRRVLMPEFGLTEELTRSKVHVNSRVRCLE 60
           MSDDRTHKKQKRIRVRTDVVADYFDLYNREVRRVLMPEFGLTEELTRSKVHVNSRVRCLE
Sbjct: 1   MSDDRTHKKQKRIRVRTDVVADYFDLYNREVRRVLMPEFGLTEELTRSKVHVNSRVRCLE 60

Query: 61  PDHFSGQVLRRXXXXXXXXXXXXXXXXXXXXXXXTTDDEVEPAEDDDMGTEWTRYEKEQF 120
           PDHFSGQVLRR                       TTDDEVEPAEDDDMGTEWTRYEKEQF
Sbjct: 61  PDHFSGQVLRRDDYDDYDDDNDEEHDDSESDGDYTTDDEVEPAEDDDMGTEWTRYEKEQF 120

Query: 121 FYCMSRYSIHRVDEWCQTFTNKSKYEILVYYQVLRSNLEQLKTTRYKRLLPRSRFPIAYE 180
           FYCMSRYSIHRVDEWCQTFTNKSKYEILVYYQVLRSNLEQLKTTRYKRLLPRSRFPIAYE
Sbjct: 121 FYCMSRYSIHRVDEWCQTFTNKSKYEILVYYQVLRSNLEQLKTTRYKRLLPRSRFPIAYE 180

Query: 181 MSPEFIRLEEMLCEQVNDVVLHKAGSDEGSVEDNEDSIIDIEKWNARWEPLYANTHIEEL 240
           MSPEFIRLEEMLCEQVNDVVLHKAGSDEGSVEDNEDSIIDIEKWNARWEPLYANTHIEEL
Sbjct: 181 MSPEFIRLEEMLCEQVNDVVLHKAGSDEGSVEDNEDSIIDIEKWNARWEPLYANTHIEEL 240

Query: 241 RPISIEPLPIAPEAIRYLTELVKRHTRKLLWHSVLPSLESARISKAALLGRQAEKRQAEK 300
           RPISIEPLPIAPEAIRYLTELVKRHTRKLLWHSVLPSLESARISKAALLGRQAEKRQAEK
Sbjct: 241 RPISIEPLPIAPEAIRYLTELVKRHTRKLLWHSVLPSLESARISKAALLGRQAEKRQAEK 300

Query: 301 RPLAEEDIIEIQAHPRKKHHRDYYPHEITREDVLQAVITLKQEGSTQTYPLTLGECVLDT 360
           RPLAEEDIIEIQAHPRKKHHRDYYPHEITREDVLQAVITLKQEGSTQTYPLTLGECVLDT
Sbjct: 301 RPLAEEDIIEIQAHPRKKHHRDYYPHEITREDVLQAVITLKQEGSTQTYPLTLGECVLDT 360

Query: 361 IKKYEIETSTQGRLFHSKDIAKQSVLSNLVSSHQRHHNAEDDSALALTGELATRYYDGIS 420
           IKKYEIETSTQGRLFHSKDIAKQSVLSNLVSSHQRHHNAEDDSALALTGELATRYYDGIS
Sbjct: 361 IKKYEIETSTQGRLFHSKDIAKQSVLSNLVSSHQRHHNAEDDSALALTGELATRYYDGIS 420

Query: 421 YMDRKYMSRMNRLLTSTYADSELWHVTESTTASQGPPDLFVQYYSHSVPTPHENNVTEKL 480
           YMDRKYMSRMNRLLTSTYADSELWHVTESTTASQGPPDLFVQYYSHSVPTPHENNVTEKL
Sbjct: 421 YMDRKYMSRMNRLLTSTYADSELWHVTESTTASQGPPDLFVQYYSHSVPTPHENNVTEKL 480

Query: 481 ALQLHDTQLANAVLDNPCEVALACEESRRLDLEDLARSRKHENMLLRYLVGVSERAQPMR 540
           ALQLHDTQLANAVLDNPCEVALACEESRRLDLEDLARSRKHENMLLRYLVGVSERAQPMR
Sbjct: 481 ALQLHDTQLANAVLDNPCEVALACEESRRLDLEDLARSRKHENMLLRYLVGVSERAQPMR 540

Query: 541 VITDQTRSTAVSNK 554
           VITDQTRSTAVSNK
Sbjct: 541 VITDQTRSTAVSNK 554

>Kwal_27.11303
          Length = 479

 Score =  204 bits (520), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 156/521 (29%), Positives = 246/521 (47%), Gaps = 89/521 (17%)

Query: 18  DVVADYFDLYNREVRRVLMPEFGLTEELTRSKVHVNSRVRCLEPDHFSGQVLRRXXXXXX 77
           +++ DYF+++N E+   + P  G   EL  S +HVNSRVR    D               
Sbjct: 7   NILTDYFNVFNNELSTFMEP-LGRNSELEGSYIHVNSRVRWARGD--------------- 50

Query: 78  XXXXXXXXXXXXXXXXXTTDDEVEPAEDDDMGTEWTRYEKEQFFYCMSRYSIHRVDEWCQ 137
                            T + E +  EDD++G  W+  EKE FF+ +SR SIHR++EWC 
Sbjct: 51  -------SDLDEEDDYMTDEGECQDEEDDELGVYWSIEEKELFFHYLSRSSIHRLEEWCV 103

Query: 138 TFTNKSKYEILVYYQVLRSNLEQLK---TTRYKRLLPRSRFPIAYEMSPEFIRLEEMLCE 194
              +KS+YEIL YY+VL++NL  LK   +  + R+L +  FPIAYEM   F+ LEE +  
Sbjct: 104 HIPSKSRYEILAYYEVLQANLLSLKRLDSKSHGRILTKGEFPIAYEMDEFFVELEETMSA 163

Query: 195 QVNDVV-LHKAGSDEGSVEDNEDSIIDIEKWNARWEPLYANTHIEELRPISIEPLPIAPE 253
           + ++ + + +  S       N D +ID   W  RW P+Y+   +EE +P S E LPI+  
Sbjct: 164 RADEKLRILEEESFNALDPANNDCMIDFGNWEKRWNPIYSRLGVEEFQPASREALPISAH 223

Query: 254 AIRYLTELVKRHTRKLLWHSVLPSLESARISKAALLGRQAEKRQAEKRPLAEED---IIE 310
           A+  L +LV+++ R+LLW +VLP L+   ++     G   +   + K  + +ED   II 
Sbjct: 224 AMEALNQLVEKYLRRLLWFTVLPRLDQKFLAN----GDIQDGIVSIKSDIHDEDDEFIIC 279

Query: 311 IQAHPRKKHHRDYYPHEITREDVLQAVITLKQEGSTQTYPLTLGECVLDTIKKYEIETST 370
            +         D  PH + R+DVL  +  ++QE         L E VLDT++K+E+    
Sbjct: 280 TKGD-------DKLPHVVKRDDVLNGLTLMRQENLAAP---ALAETVLDTLRKFEL-NYE 328

Query: 371 QGRLFHSKDIAKQSVLSNLVSSHQRHHNAEDDSALALTGELATRYYDGISYMDRKYMSRM 430
           +GRLF S +IA     + +V     H   + ++ L   G L T      +  D  ++   
Sbjct: 329 EGRLFRSTEIA-----TGMVPRILAHARLDRETELYAKGTLGTPVVHTPNRSDDAFV--- 380

Query: 431 NRLLTSTYADSELWHVTESTTASQGPPDLFVQYYSHSVPTPHENNVTEKLALQLHDTQLA 490
                  +   +L+ +    T+S+     F++                       D Q  
Sbjct: 381 -------HIHKKLFKLNGKKTSSES----FIE-----------------------DDQFD 406

Query: 491 NAVLDNPCEVALACEESRRLDLEDLARSRKHENMLLRYLVG 531
           +  +DNP E  L   E+  LD +DL  SR +++ LL YL G
Sbjct: 407 S--IDNPLEQELCELEADTLDQQDLYESRIYQHALLTYLQG 445

>KLLA0D16940g 1435379..1437001 some similarities with sp|Q02983
           Saccharomyces cerevisiae YLR141w RRN5 RNA polymerase I
           specific transcription initiation factor singleton,
           hypothetical start
          Length = 540

 Score =  155 bits (393), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 102/299 (34%), Positives = 168/299 (56%), Gaps = 19/299 (6%)

Query: 108 MGTEWTRYEKEQFFYCMSRYSIHRVDEWCQTFTNKSKYEILVYYQVLRSNLEQLK---TT 164
           +G+ WT  EK+ FF+ +SR+SIH +D W      KSKYEIL+YYQVLR NLE+L+   T 
Sbjct: 144 LGSLWTGREKQVFFHNLSRHSIHTLDAWSSHIPGKSKYEILIYYQVLRKNLEELRRLQTK 203

Query: 165 RYKRLLPRSRFPIAYEMSPEFIRLEEMLCEQVND-VVLHKAGSDEGSVEDNEDSIIDIEK 223
           R+  +L    FPIAYEMS  +I LEE L  +V++ V L++  +    + D   ++ID   
Sbjct: 204 RHGGILEYGEFPIAYEMSETWITLEEELSNEVDEQVPLNQEEATNTEISDPV-AVIDWSN 262

Query: 224 WNARWEPLYANTHIEELRPISIEPLPIAPEAIRYLTELVKRHTRKLLWHSVLPSLESARI 283
           W  RW+  YA   + E  P +  P    PE+++ +  LV+R+T  LL  +++PSLE   +
Sbjct: 263 WYKRWDKFYARHRLLEYYPTNRRPNVFTPESMQIMELLVRRYTSNLLRETIIPSLEKKCV 322

Query: 284 SKAALLGRQAEKRQAEKRPLAEEDIIE-IQAHP--------RKKHHRDYYPHEITREDVL 334
            +  L+ ++  K    K+  +  +I + IQ           +  +H   +PH +T  DV+
Sbjct: 323 PRDLLMSQKTFKDARMKKLRSTCNITKTIQDDQDDDGSLVIQTSNHE--FPHIVTENDVI 380

Query: 335 QAVITLKQEGSTQTYPLTLGECVLDTIKKYEIETSTQGRLFHSKDIAKQ-SVLSNLVSS 392
            A++ L+     + + LT  E ++D++ K++IE   +G++F +K++ +   VL  L SS
Sbjct: 381 SALVRLRLYNKGKLF-LTYPESIVDSVDKFQIEME-RGKIFRNKNVLRHLKVLLYLQSS 437

>AGL166W [4146] [Homologous to ScYLR141W (RRN5) - SH]
           complement(385345..386649) [1305 bp, 434 aa]
          Length = 434

 Score =  134 bits (337), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 83/255 (32%), Positives = 134/255 (52%), Gaps = 23/255 (9%)

Query: 23  YFDLYNREVRRVLMPEFGLTEELTRSKVHVNSRVRCLEPDHFSGQVLRRXXXXXXXXXXX 82
           Y +++N+EV+RV  P +    E   S VH++S+VR L+                      
Sbjct: 25  YSEIFNQEVQRVFDPHWH-KNEFRDSVVHLSSKVRYLQ-----------DTDEEHDSDAR 72

Query: 83  XXXXXXXXXXXXTTDDEVEPAEDDDMGTEWTRYEKEQFFYCMSRYSIHRVDEWCQTFTNK 142
                       + D   +     ++GT W+  EK+ FF+ ++R SIHR+DEW     +K
Sbjct: 73  SDSGAESDSGDDSGDVRGQLLSSGELGTFWSAREKQVFFHWLARCSIHRLDEWAPRLPDK 132

Query: 143 SKYEILVYYQVLRSNLEQLKTTRYKR---LLPRSRFPIAYEMSPEFIRLEEMLCEQVNDV 199
           SKYEIL YY VL+SNL+ LK    K+   +L +   PIAYEM P F++LEE        +
Sbjct: 133 SKYEILAYYHVLKSNLQDLKRMNTKKRGGILTKRALPIAYEMDPFFVQLEEEY-----SL 187

Query: 200 VLHKAGSDEGSVEDN---EDSIIDIEKWNARWEPLYANTHIEELRPISIEPLPIAPEAIR 256
           ++H    +   +ED    ED +++ E W  RW+PLY++  + E +P + +PLP + ++  
Sbjct: 188 LIHSETENVVKLEDEADLEDGVVNWENWYKRWDPLYSHHRLGEYQPAARQPLPFSRQSEL 247

Query: 257 YLTELVKRHTRKLLW 271
            +  LV+ +TR+LL+
Sbjct: 248 LVERLVRAYTRRLLF 262

>Scas_506.5
          Length = 441

 Score =  133 bits (334), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 118/399 (29%), Positives = 183/399 (45%), Gaps = 74/399 (18%)

Query: 14  RVRTDVVADYFDLYNREVRRVLMPEFGLTEELTRSKVHVNSRVRCLEPDHFSGQVLRRXX 73
           R R D V  YF+ +N EV      +F +  EL  S++HV+S+++ LE +     +     
Sbjct: 3   RPRNDCVKLYFEQFNNEVDEFFNADFQVDYELRASRIHVDSKIKYLEREEAKKGI----- 57

Query: 74  XXXXXXXXXXXXXXXXXXXXXTTDDEVEPAEDDDMGTEWTRYEKEQFFYCMSRYSIHRVD 133
                                  DDE +  +   +G  W+  EK  FF+ +SRYSIHR+D
Sbjct: 58  ---------------TPDVEDDDDDEAKNKKPIPLGVHWSSREKRLFFHYLSRYSIHRLD 102

Query: 134 EWCQTF--TNKSKYEILVYYQVLRSNLEQL---------KTTRYKRLLPRSRFPIAYEMS 182
           EW +     +KSKYE+L YY+VLRSNL  +         K   +  +L R   PIAYEMS
Sbjct: 103 EWYRKVGSGSKSKYEVLTYYRVLRSNLHAIKRRNTIDKRKKGLFAGILRRKDLPIAYEMS 162

Query: 183 PEFIRLEEMLCEQVN---DVVLHKAGSDEGSVEDNEDSIIDIEKWNARWEPLYANTHIEE 239
             F++LEE +   +    D V  +  SDE         +I ++ W  RW  +   +    
Sbjct: 163 ESFVQLEETMAASLPTGIDAVYSETPSDET-------QLITLQPWERRWHSVLRRSPTVS 215

Query: 240 LRPISIEPLPIAPEAIRYLTELVKRHTRKLLWHSVLPSLESARISKAALLGRQAEKRQAE 299
            +  +   LP++ EA  YLT L KRH R++++ +VLP LE     + A+  R  +   ++
Sbjct: 216 TQQSA---LPVSVEAYDYLTRLAKRHLRQVIYSTVLPQLE-----RKAIAVRDKDDDNSD 267

Query: 300 KRPLAEEDIIEIQAHPRKKHHRDYYPHEITREDVLQAVITLK-QEGSTQTYPLTLGECVL 358
           K                      +  H +TR DVL  +  L+     T+  PL L E  L
Sbjct: 268 KL---------------------HTVHLVTRRDVLTGIHRLRLMLRDTKRVPL-LAETWL 305

Query: 359 DTIKKYEIETS-TQGRLFHSKDIAKQS-VLSNLVSSHQR 395
            T+ K+E++ S ++ +   S  I + S  L++LV    R
Sbjct: 306 QTLSKFELQISESKNKSNLSGSIIRNSRTLNDLVECFTR 344

>YLR141W (RRN5) [3550] chr12 (423684..424775) Component of the
           Upstream Activation Factor (UAF) complex, involved in
           activation of RNA polymerase I [1092 bp, 363 aa]
          Length = 363

 Score =  127 bits (320), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 88/286 (30%), Positives = 138/286 (48%), Gaps = 38/286 (13%)

Query: 104 EDDDMGTEWTRYEKEQFFYCMSRYSIHRVDEWCQTFTNKSKYEILVYYQVLRSNLEQLKT 163
           E   +G +W   EK  FF+C+SRYSIHRVDEW      KS  EIL YY++LR      ++
Sbjct: 54  EISSVGVDWDSEEKNTFFWCLSRYSIHRVDEWRSLLPRKSAMEILGYYRLLRRASASARS 113

Query: 164 TRYKRLLPRSRFPIAYEMSPEFIRLEEMLCEQVNDVVLHKAGSDEGSVEDNEDSIIDIEK 223
            +          PIAYEMS E++ LE  L E V  + + +  ++    E + + +ID E 
Sbjct: 114 RKAGD----DGAPIAYEMSAEWVALETKLSETV--MAITEGAAEVADEEGHCEGLIDYES 167

Query: 224 WNARWEPLYANTHIEELRPISIEPLPIAPEAIRYLTELVKRHTRKLLWHSVLPSLESARI 283
           W  RW  +Y+++ I E+RP+    LP++  A + L   V R+TR LLW + L  + S  +
Sbjct: 168 WKRRWVAIYSHSRIAEIRPLPRHALPLSRSATQTLERCVSRYTRTLLWCTALAGMASRSV 227

Query: 284 SKAALLGRQAEKRQAEKRPLAEEDIIEIQAHPRKKHHRDYYPHEITREDVLQAVITLKQE 343
           S      R AE R  +  P                         +TR  V +A+ T  + 
Sbjct: 228 S-----ARAAESRGHKSLPTV-----------------------VTRRQVERALCTEARS 259

Query: 344 GSTQTYPLTLGECVLDTIKKYEIETSTQGRLFHSKDIAKQSVLSNL 389
                 P      ++ T++K+E++   +G+LF +K++A   + S L
Sbjct: 260 RDLHVLPRR----IVLTLRKWELDYPREGKLFRTKEMAHLFLQSQL 301

>KLLA0F22066g complement(2051033..2062327) similar to sp|P38811
            Saccharomyces cerevisiae YHR099w TRA1 component of the
            Ada-Spt transcriptional regulatory complex, start by
            similarity
          Length = 3764

 Score = 33.5 bits (75), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 46/100 (46%), Gaps = 10/100 (10%)

Query: 196  VNDVVLH----KAGSDEGSVEDNED-SIIDIEKWNARWEPLYANTHIEELRPISIEPLPI 250
            VN +++H    K   DE    DNE  + ++   WN +   +  NT I +L  I  E L +
Sbjct: 1822 VNSIMIHESTTKNSVDELISPDNEIFAFLNQHIWNPKSSSVVLNTVIGKLDSIRFELLQL 1881

Query: 251  APEAIRY---LTELVKRHTRKLLWHSVLPSLESARISKAA 287
                ++Y   L E VKR   K  W  +   LE  ++ +AA
Sbjct: 1882 TSILLKYAPTLLEPVKRDLIKFAWKFI--KLEDIQLKQAA 1919

>Kwal_23.5828
          Length = 424

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 190 EMLCEQVNDVVLHKAGSDEGSVEDNEDSIIDIEKWNARWEPLY 232
           +ML E  ND V    GS  GS++D  D+I+D E+   R  P +
Sbjct: 101 QMLAESKNDRVGCVIGSGIGSIQDMYDTIVDFERGK-RVAPTF 142

>Scas_602.11
          Length = 1186

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 55/262 (20%), Positives = 113/262 (43%), Gaps = 43/262 (16%)

Query: 278 LESARISKAALL-----GRQAEKRQAEKRPLAEEDIIEIQAHPRKKHHRDYYPHEITRED 332
           L++ R+S    +      +   +R  EK P     I+E++ HP      D++      ED
Sbjct: 471 LQANRVSNVCSIEEYEAAKNVLQRLLEKNPSKRCSILELKYHPFICWDFDHFAE--LNED 528

Query: 333 VLQAVITLKQEGSTQTYPLTLGECVLDTIKKYEIETSTQGRLFHSKDIAKQSVLSNLVSS 392
           ++ +   LK++   Q   +   E +  ++ ++E++ +  G     K I K+S+L ++   
Sbjct: 529 LITS--KLKEKEIFQANQVDSLEQI--SVTQHELKNAVSGV---GKKI-KESILKSISLK 580

Query: 393 HQRHHNAEDDSALALTG---------ELATRYYDG-----ISYMDRKYMSRMNRLLTSTY 438
            + +H A D ++ ++ G         +L+    +G     I+ +D++Y    N   T T+
Sbjct: 581 QKNNHTAADSNSSSVLGMGKFPTDNSDLSVIVSEGSIMNNINGIDQQYTGPNNESTTDTF 640

Query: 439 ADSELW--------HVTESTTASQGPPDLFVQYY-SHSVPTPHENNVTEKLALQLHDTQL 489
             S  +        H  +S  AS    DL  Q Y  +S+     N+++      + +   
Sbjct: 641 TPSNNYTYMKHINDHTNQSNNASNNFNDLNDQNYKKNSI-----NDLSHNELQNVENENG 695

Query: 490 ANAVLDNPCEVALACEESRRLD 511
           +NAV++ P   + A  +S  +D
Sbjct: 696 SNAVVNLPINSSFASLDSFYID 717

>KLLA0F18953g 1737522..1739465 similar to sp|P46944 Saccharomyces
           cerevisiae YDR108w GSG1 sporulation specific protein
           singleton, start by similarity
          Length = 647

 Score = 30.0 bits (66), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 45/106 (42%), Gaps = 4/106 (3%)

Query: 324 YPHEITREDVLQAVITLKQEGSTQTYPLTLGECVLDTIKKYEIETSTQGRLFHSKDIAKQ 383
           +P  I   D+L   +    E S + +     + +  ++KK     S    LF   D  K 
Sbjct: 220 FPEFININDILPVFVLCYDENSREQWESV--QALTKSLKKQLFVESVSISLFTPHDNQKS 277

Query: 384 SVLSN--LVSSHQRHHNAEDDSALALTGELATRYYDGISYMDRKYM 427
           + L +   VS H++  N    +++ +   L T  YD IS++  + M
Sbjct: 278 TTLHSPITVSLHEQVFNMSHPTSINIPSRLLTHIYDTISFIVEEMM 323

>CAGL0K01397g complement(122804..123718) similar to sp|P38913
           Saccharomyces cerevisiae YDL045c FAD synthetase, start
           by similarity
          Length = 304

 Score = 29.3 bits (64), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 5/53 (9%)

Query: 291 RQAEKRQAEKRPLAEEDIIEIQAHPRKKHHRDYYPHEITREDVLQAVITLKQE 343
           +  E  +AE  P+A+ED+++I+       H DYYP     +D L+    +K++
Sbjct: 257 KHNEVTKAEPIPIADEDLVKIE-----NLHEDYYPGWYLVDDKLERAGRIKKK 304

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.131    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,667,171
Number of extensions: 755191
Number of successful extensions: 2397
Number of sequences better than 10.0: 18
Number of HSP's gapped: 2447
Number of HSP's successfully gapped: 21
Length of query: 554
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 447
Effective length of database: 12,891,983
Effective search space: 5762716401
Effective search space used: 5762716401
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)