Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M04455g71170036630.0
Sklu_1665.169970311101e-142
Kwal_27.1130170068910561e-134
KLLA0D16918g6826788481e-103
Scas_506.67427576984e-81
AGL167C7276176642e-76
YLR139C (SLS1)6437124714e-50
KLLA0E12397g146111750.22
Sklu_2099.380341693.6
Scas_621.1530774684.0
Sklu_2437.16107170675.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M04455g
         (700 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M04455g complement(489048..491183) weakly similar to sp|P42...  1415   0.0  
Sklu_1665.1 YLR139C, Contig c1665 672-2771                            432   e-142
Kwal_27.11301                                                         411   e-134
KLLA0D16918g complement(1432797..1434845) weakly similar to sp|P...   331   e-103
Scas_506.6                                                            273   4e-81
AGL167C [4145] [Homologous to ScYLR139C (SLS1) - SH] (382880..38...   260   2e-76
YLR139C (SLS1) [3549] chr12 complement(421543..423474) Protein i...   186   4e-50
KLLA0E12397g complement(1095073..1095513) no similarity, hypothe...    33   0.22 
Sklu_2099.3 YJL051W, Contig c2099 2510-4921                            31   3.6  
Scas_621.15                                                            31   4.0  
Sklu_2437.16 YOL100W, Contig c2437 35714-38929 reverse complement      30   5.6  

>CAGL0M04455g complement(489048..491183) weakly similar to sp|P42900
           Saccharomyces cerevisiae YLR139c SLS1 suppresses
           lethality of SSM4 deletion, hypothetical start
          Length = 711

 Score = 1415 bits (3663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 688/700 (98%), Positives = 688/700 (98%)

Query: 1   MLRALPLLRKRILPAFRTRIRLYSDDSLKEKLLSTRGKKKMPEKQKIVVLNPGQVTSFKR 60
           MLRALPLLRKRILPAFRTRIRLYSDDSLKEKLLSTRGKKKMPEKQKIVVLNPGQVTSFKR
Sbjct: 1   MLRALPLLRKRILPAFRTRIRLYSDDSLKEKLLSTRGKKKMPEKQKIVVLNPGQVTSFKR 60

Query: 61  RRRGPVTDHANTHTTTDSLITRHNRPISAPRTKLSILEGVDLGISTNGSKEEDKEKLTDT 120
           RRRGPVTDHANTHTTTDSLITRHNRPISAPRTKLSILEGVDLGISTNGSKEEDKEKLTDT
Sbjct: 61  RRRGPVTDHANTHTTTDSLITRHNRPISAPRTKLSILEGVDLGISTNGSKEEDKEKLTDT 120

Query: 121 VLEEIDQKRRKLMVFRSTVSEEQAVKAIGYQKPVKPIMSQKRYEQLENLLKSAYTVNQLR 180
           VLEEIDQKRRKLMVFRSTVSEEQAVKAIGYQKPVKPIMSQKRYEQLENLLKSAYTVNQLR
Sbjct: 121 VLEEIDQKRRKLMVFRSTVSEEQAVKAIGYQKPVKPIMSQKRYEQLENLLKSAYTVNQLR 180

Query: 181 AYSKKMFGPSLXXXXXXXXXXXXMNEYWQCQVDENINEKDDLIIERELDIKTRDTYLLLL 240
           AYSKKMFGPSL            MNEYWQCQVDENINEKDDLIIERELDIKTRDTYLLLL
Sbjct: 181 AYSKKMFGPSLFKKSKAFIIKKIMNEYWQCQVDENINEKDDLIIERELDIKTRDTYLLLL 240

Query: 241 TDNGKILHNLARIGAILAVAPEENKIIIRASANVIRYVEISLNRILENVKTEIVPIEKLI 300
           TDNGKILHNLARIGAILAVAPEENKIIIRASANVIRYVEISLNRILENVKTEIVPIEKLI
Sbjct: 241 TDNGKILHNLARIGAILAVAPEENKIIIRASANVIRYVEISLNRILENVKTEIVPIEKLI 300

Query: 301 RDHSIDGKLDGDMNVEQIIDLVQKQASVYIDLISDSSEEKQYNISAFGKKRIDTAKLYLT 360
           RDHSIDGKLDGDMNVEQIIDLVQKQASVYIDLISDSSEEKQYNISAFGKKRIDTAKLYLT
Sbjct: 301 RDHSIDGKLDGDMNVEQIIDLVQKQASVYIDLISDSSEEKQYNISAFGKKRIDTAKLYLT 360

Query: 361 WASKYTPHVQEEYITTGDKCMKEKCKEYPYTDMDSFNWLDKNKLWYRLQLPENKLLGKTD 420
           WASKYTPHVQEEYITTGDKCMKEKCKEYPYTDMDSFNWLDKNKLWYRLQLPENKLLGKTD
Sbjct: 361 WASKYTPHVQEEYITTGDKCMKEKCKEYPYTDMDSFNWLDKNKLWYRLQLPENKLLGKTD 420

Query: 421 KLEYPPTIEMLDVKRIYDFLTDKNISLKQKLLPVKGTRQHVISVTMGQLLKAGNSMIRTF 480
           KLEYPPTIEMLDVKRIYDFLTDKNISLKQKLLPVKGTRQHVISVTMGQLLKAGNSMIRTF
Sbjct: 421 KLEYPPTIEMLDVKRIYDFLTDKNISLKQKLLPVKGTRQHVISVTMGQLLKAGNSMIRTF 480

Query: 481 LPRIPTISNFLMDLPYFEETHEGDLSVLGENDDYYVQLKFKPDLSSIPPGIKSYPPNMEL 540
           LPRIPTISNFLMDLPYFEETHEGDLSVLGENDDYYVQLKFKPDLSSIPPGIKSYPPNMEL
Sbjct: 481 LPRIPTISNFLMDLPYFEETHEGDLSVLGENDDYYVQLKFKPDLSSIPPGIKSYPPNMEL 540

Query: 541 WFELDDRDNAIKASMDCIFSVSEKAVMLEAPQHPFDFKIVSDAVVSLNPSLENDDPGQWL 600
           WFELDDRDNAIKASMDCIFSVSEKAVMLEAPQHPFDFKIVSDAVVSLNPSLENDDPGQWL
Sbjct: 541 WFELDDRDNAIKASMDCIFSVSEKAVMLEAPQHPFDFKIVSDAVVSLNPSLENDDPGQWL 600

Query: 601 EGQDELKHYVDQAKLDFGQGNKMLLGNSVCVNIPTEEEGTVQVRYDFVNTYRHRITRLKF 660
           EGQDELKHYVDQAKLDFGQGNKMLLGNSVCVNIPTEEEGTVQVRYDFVNTYRHRITRLKF
Sbjct: 601 EGQDELKHYVDQAKLDFGQGNKMLLGNSVCVNIPTEEEGTVQVRYDFVNTYRHRITRLKF 660

Query: 661 RDRFLVQYSNINGGARGGQTNRIDLICDDNPDYNDFSNFI 700
           RDRFLVQYSNINGGARGGQTNRIDLICDDNPDYNDFSNFI
Sbjct: 661 RDRFLVQYSNINGGARGGQTNRIDLICDDNPDYNDFSNFI 700

>Sklu_1665.1 YLR139C, Contig c1665 672-2771
          Length = 699

 Score =  432 bits (1110), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 259/703 (36%), Positives = 415/703 (59%), Gaps = 47/703 (6%)

Query: 12  ILPAFRTRIRLYS-DDSLKE---------KLLSTRGKKKMPEKQKIVVLNPGQVTSFKRR 61
           + P++ +  RLYS  D +++         KL STRGKK  P K KIVVL+P Q   FK++
Sbjct: 23  LAPSYLSHRRLYSTQDDIEDQENSTPDGSKLTSTRGKKLKPTKAKIVVLSPKQAGLFKKK 82

Query: 62  RRGPVTDHANTHTTTDSLITRHNRPISAPRTKLSILEGVDLGISTNGSKEEDKEKLTDTV 121
           R  P     N          R+ R        L++LEGV+LG S + S        +  +
Sbjct: 83  R-TPGYFKQNEK--------RNER--------LTVLEGVELGKSVSNSTN------SSDI 119

Query: 122 LEEIDQKRRKLMVFRSTVSEEQAVKAIGYQKPVKPIMSQKRYEQLENLLKSAYTVNQLRA 181
           L++I+ +RRKL+VF+ +V +EQ +++I   +P    +S KRYEQL++LL+SAYT+ QLR 
Sbjct: 120 LQQIENQRRKLLVFKGSVPKEQVIQSIHDLRPTGTQVSSKRYEQLKSLLESAYTLPQLRD 179

Query: 182 YSKKMFGPSLXXXXXXXXXX-XXMNEYWQCQVDENINEKDDLIIERELDIKTRDTYLLLL 240
           Y  + +  S+             MN  W CQ+DE+I+E +DLI+ER +D++T+D YLLLL
Sbjct: 180 YVAQYYKTSVVKSAPKKVLIPRIMNRLWGCQIDESISEAEDLIVERIIDLETKDIYLLLL 239

Query: 241 TDNGKILHNLARIGAILAVAPEENKIIIRASANVIRYVEISLNRILENVKTEIVPIEKLI 300
           T+NGKIL+N AR+GA LAV   ENKII+RA++ +++YVE+SL +IL N+++E++P+  +I
Sbjct: 240 TNNGKILYNFARVGATLAVVLNENKIIVRATSAMVKYVEVSLRKILSNMQSEVLPVRDII 299

Query: 301 RDHSIDGKLDGDMNVEQIIDLVQKQASVYIDLISDSSEEKQYNISAFGKKRIDTAKLYLT 360
            +H+     +  +   ++I LVQK+++ Y + + D  E+  Y ++AFG KR++ AK  L 
Sbjct: 300 SNHTSLNS-NATLTPGEVISLVQKESAAYFEEMLD--EDGTYTLTAFGDKRVNHAKNLLL 356

Query: 361 WASKYTPHVQEEYITTGDKCMKEKCKEYPYTDMDSFNWLDKNKLWYRLQLPENKLLGKTD 420
           WA  Y P   EE++  G++  +   K YP+T+++  +WL+  K WYR Q P +K + K D
Sbjct: 357 WAMNYNPQRVEEHVFCGNE-ERSSYKLYPFTNIECLDWLESAKEWYRFQRPVSKKMAK-D 414

Query: 421 KLEYPPTIEMLD--VKRIYDFLTDKNISLKQKLLPVKGTRQHVISVTMGQLLKAGNSMIR 478
             E     EM D  V  +Y+F T +N +    +  +  ++  V+S+T+GQ+L    +   
Sbjct: 415 FDEKINKFEMSDKKVDELYNFFTKENRNNIATIDSLGDSK--VLSITLGQVLITATNKES 472

Query: 479 TFLPRIPTISNFLMDLPYFEETHEGDLSVLGENDDYYVQLKFKPDLSSIPPGIKSYPPNM 538
            F P+IP I+  L++LP ++     D     +  +YY+QLKF PDLS+   G K+ PP +
Sbjct: 473 IFQPKIPQITPRLLELPLYDSMATMDELYTVDQHEYYIQLKFIPDLSTTNSG-KNIPP-L 530

Query: 539 ELWFELDDRDNAIKASMDCIFSVSEKAVMLEAPQHPFDFKIVSDAVVSLNPSLENDDPGQ 598
           ELWFELDD D AI +S+  +  + E+ V L+ PQ   DFKI  D +  L    E ++P  
Sbjct: 531 ELWFELDDYDKAITSSVRSVVHLEERNVYLQTPQLSHDFKINMDRIGELVRPYE-ENPEN 589

Query: 599 WLEGQDELKHYVDQAKLDFGQGNKMLLGNSVCVNIPTEEEGTV-QVRYDFVNTYRHRITR 657
           WL+ Q  LK ++ ++ L F    K+++   + +N+  E   T  Q+ +D+VN    R+ +
Sbjct: 590 WLQDQPGLKEFLLKSNLTFQGRKKLVIPKKLVMNLNVEGSNTPEQISFDYVNVKYRRVLK 649

Query: 658 LKFRDRFLVQYSNINGGARGGQTNRIDLICDDNPDYNDFSNFI 700
           LK+ D++LVQ++++NGG  GG+  ++DL+  ++       NFI
Sbjct: 650 LKYMDKYLVQFTDVNGGPGGGRYTQVDLVNGEDVCRETLVNFI 692

>Kwal_27.11301
          Length = 700

 Score =  411 bits (1056), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 245/689 (35%), Positives = 395/689 (57%), Gaps = 52/689 (7%)

Query: 25  DDSLKEKLLSTRGKKKMPEKQKIVVLNPGQVTSFKRRRR-GPVTDHANTHTTTDSLITRH 83
           +D ++ +  STRGKK  P K KIVVLNP +   FK+R+  G   DH              
Sbjct: 44  EDCVEHEAKSTRGKKLKPSKAKIVVLNPREAGLFKQRQAPGFFNDH-------------- 89

Query: 84  NRPISAPRTKLSILEGVDLGISTNGSKEEDKEKLTDTVLEEIDQKRRKLMVFRSTVSEEQ 143
               + PR +LS LEGV+  +       + +   +D++L+EI+ +RRKL++F+S+V +EQ
Sbjct: 90  ----TKPRERLSALEGVEYDLRRGQIARQSQT--SDSILQEIESQRRKLLIFKSSVPKEQ 143

Query: 144 AVKAIGYQKPVKP--IMSQKRYEQLENLLKSAYTVNQLRAYSKKMFGPSL-XXXXXXXXX 200
            VK+I   +P K   ++S KRYEQL++LL+ AYT+ QL+AY+ + +   L          
Sbjct: 144 VVKSIHDLRPSKNSNLISSKRYEQLKSLLEMAYTLPQLKAYANEFYKLKLPKSTTKKAVI 203

Query: 201 XXXMNEYWQCQVDENINEKDDLIIERELDIKTRDTYLLLLTDNGKILHNLARIGAILAVA 260
              + ++WQC++DE+IN   DLIIER +D++TRD YLLLLT+NGKILHN AR+GA +AVA
Sbjct: 204 KTILQDFWQCEIDESINAGQDLIIERIIDVQTRDIYLLLLTNNGKILHNFARLGATVAVA 263

Query: 261 PEENKIIIRASANVIRYVEISLNRILENVKTEIVPIEKLIRDHSIDGKLDGDMNVEQIID 320
             ENKII+RA++ +++YVE+SL +IL+N + E++P+ ++IR H+    +   ++ ++I+ 
Sbjct: 264 LSENKIIVRATSALVKYVEVSLRKILDNAQREVIPVCEIIRSHTSYDSI--PVSPKEIVP 321

Query: 321 LVQKQASVYID-LISDSSEEKQYNISAFGKKRIDTAKLYLTWASKYTPHVQE--EYITTG 377
           LVQK+++ Y + ++ D S+   Y ++  G+KR+  AK+ L WA  Y P   E   +++  
Sbjct: 322 LVQKESATYFEKMLEDDSDS--YVVTGLGEKRLTNAKVLLLWALNYCPQRSERTRFVSNE 379

Query: 378 DKCMKEKCKEYPYTDMDSFNWLDKNKLWYRLQLPENKLLGKTDKLEYPPTIEM---LDVK 434
           D     +   +P+TD+   +W+   + WYRLQ P  K          PPT  +   L   
Sbjct: 380 DFSAYHR---FPFTDVQCLDWIQAKENWYRLQQPVLK--------NQPPTAALPVNLPEH 428

Query: 435 RIYDFLTDKNISLKQKLLPVKGTRQHVISVTMGQLLKAGNSMIRTFLPRIPTISNFLMDL 494
            I +  T+   S     +        ++S+T+GQ+L + N    TF  ++P ++  L+ L
Sbjct: 429 IIDELYTELLGSANTTAIAKAEHDFKIMSITLGQVLHSENEEKTTFQSKVPGVTKKLLQL 488

Query: 495 PYFEETHEGDLSVLGENDDYYVQLKFKPDLSSIPPGIKSYPPNMELWFELDDRDNAIKAS 554
           P +E     D     +  +Y++QLKF P L       K + P +ELWFELDD D AI  S
Sbjct: 489 PLYEGFDTPDELYSVDQHEYFIQLKFIPRLDGTE---KKHIPPLELWFELDDNDRAINTS 545

Query: 555 MDCIFSVSEKAVMLEAPQHPFDFKIVSDAVVSLNPSLENDDPGQWLEGQDELKHYVDQAK 614
           +  +    + +V L+ PQ   D+KI  D  + +    +  DP  WL  Q+ LK+Y+ QA+
Sbjct: 546 VRALLHAEDTSVYLQTPQISHDYKINIDRTLEVVKPYDQ-DPQTWLHDQEGLKNYLLQAR 604

Query: 615 LDFGQGNKMLLGNSVCVNIPTEEEGTVQ-VRYDFVNTYRHRITRLKFRDRFLVQYSNING 673
           LDFG   K+ +  ++ +N+  E     Q V +D+V+    R+ +LK+ D++LVQ+S++NG
Sbjct: 605 LDFGGKEKLHMPKTLNLNLHFEGSAEPQSVTFDYVSVMYRRVLKLKYLDKYLVQFSDLNG 664

Query: 674 GARGGQTNRIDLICDDNPDY--NDFSNFI 700
           G RGG+  +ID I  +      ++F+ FI
Sbjct: 665 GTRGGKYTQIDFIGPEAEHLTRDEFAKFI 693

>KLLA0D16918g complement(1432797..1434845) weakly similar to
           sp|P42900 Saccharomyces cerevisiae YLR139c SLS1
           suppresses lethality of SSM4 deletion singleton,
           hypothetical start
          Length = 682

 Score =  331 bits (848), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 226/678 (33%), Positives = 355/678 (52%), Gaps = 53/678 (7%)

Query: 32  LLSTRGKKKMPEKQKIVVLNPGQVTSFKRRRRGPVTDHANTHTTTDSLITRHNRPISAPR 91
           LLS  GKK  P++   +VL P Q T   R  R   T  +N+H                  
Sbjct: 43  LLSKHGKKLKPKQDHFLVLTPHQ-TGVMRLPRKSKTLQSNSH------------------ 83

Query: 92  TKLSILEGVDLGISTNGSKEEDKEKLTDTVLEEIDQKRRKLMVFRSTVSEEQAVKAIGYQ 151
             LSILEG D    T       + +  D +L  I     KLM F+     EQ  KAI   
Sbjct: 84  --LSILEGFDFKRHTENGTNHSQVRDVD-ILSNIQDTTSKLMKFKEQEDNEQMAKAIDSC 140

Query: 152 KPVKPIMSQKRYEQLENLLKSAYTVNQLRAYSKKMFGPSLXXXXXXXXXXXXMNEYWQCQ 211
           KP    +S+KRY QLE +L   +T+ QLR Y     G               + + W C 
Sbjct: 141 KPSSEAISEKRYLQLEKVLDEQFTLQQLRNYCYLKHGVRKARIPKKNLIPTIITKLWNCS 200

Query: 212 VDENINEKDDLIIERELDIKTRDTYLLLLTDNGKILHNLARIGAILAVAPEENKIIIRAS 271
           +D N +E DDLI+E E+ ++TRD YLLLLT NG+IL NLARIGA +AV  +ENK+++RA+
Sbjct: 201 IDYNKSEHDDLIVENEISLETRDIYLLLLTKNGRILQNLARIGATIAVVIDENKLVVRAT 260

Query: 272 ANVIRYVEISLNRILENVKTEIVPIEKLIRDHS-IDGKLDGDMNVEQIIDLVQKQASVYI 330
           +++ +YVE+S++RILENV ++   IE+ I+DHS IDG     M  E+II L+Q Q+S Y+
Sbjct: 261 SHIFKYVEVSISRILENVVSDDFSIEEFIKDHSQIDGV--HHMTPEEIIALMQTQSSSYV 318

Query: 331 DLISDSSEEKQYNISAFGKKRIDTAKLYLTWASKYTPHVQEEYITTGDKCMKEKCKEYPY 390
           ++  DS    +Y IS  G+K ++     L W   Y P   E  +        EK ++YP 
Sbjct: 319 EITDDS----KYKISTIGRKNMNIINSLLLWVLNYNPQTTEILVPYDG---GEKTEQYPL 371

Query: 391 TDMDSFNWLDKNKLWYRLQLPE--NKLLGKTDKLEYPPTIEMLDVKRIYDFLTDKNISLK 448
           T+ +  NW+ + + W+R+Q P   N+ +  T K++    I+     +I+D L    I+  
Sbjct: 372 TNYEWINWVARKQSWHRIQQPVAINQEIKDT-KIDLSEKID-----KIWDIL---EINKT 422

Query: 449 QKLLPVKGTRQHVISVTMGQLLKAGNSMIRTFLPRIPTISNFLMDLPYFEETH--EGDLS 506
           +   P+  T    +S+  G +L+   + I  F  +IP +   ++ LP +++    E DL 
Sbjct: 423 KCAKPLAFTETKSLSIAFGHILENAQNKI-LFQSKIPEVVPKVLRLPLWDKDGYVEDDLF 481

Query: 507 VLGENDDYYVQLKFKPDLSSIPPGIKSYPPNMELWFELDDRDNAIKASMDCIFSVSEKAV 566
            + ++  Y VQ+KF P+L+ +   +   P  +E+WF LD+ +NA  +++ CI + S+ + 
Sbjct: 482 SVDQH-LYLVQMKFVPNLADVSHKVNVSP--LEVWFTLDENNNADTSTVRCIHTYSDNSA 538

Query: 567 MLEAPQHPFDFKI-VSDAVVSLNPSLENDDPGQWLE-GQDELKHYVDQAKLDFGQGNKML 624
            ++ P    DFKI V+D V +L   LE+ +   WL+  Q   + ++ ++   FG   K  
Sbjct: 539 CIQTPTLSHDFKITVTDTVDALPEDLESSEFFDWLQREQPSFRKFLQESNFSFGGLKKPR 598

Query: 625 LGNSVCVNIPTEE-EGTVQVRYDFVNTYRHRITRLKFRDRFLVQYSNINGGARGGQTNRI 683
           +  S  +N+  E  E   ++RY++++ Y HR+ R K+++  LVQ S I GG+ GG+ + I
Sbjct: 599 IAPSFELNVKLEGMEEPQKIRYNYLHRYEHRLLRFKYKEDCLVQLSEIEGGSLGGKASSI 658

Query: 684 DLICDDNPDYNDF-SNFI 700
           D I  +     D   NFI
Sbjct: 659 DFISTNGSINKDIVRNFI 676

>Scas_506.6
          Length = 742

 Score =  273 bits (698), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 219/757 (28%), Positives = 366/757 (48%), Gaps = 128/757 (16%)

Query: 5   LPLLRKRILPAFRTRI-----------RLYS-------DDSLKE-----KLLSTRGKKKM 41
           LP+L + +LP+ R  +           RLYS       D ++ E     +   TRGKK  
Sbjct: 26  LPMLSRFVLPSKRVALSHYKCTFINSRRLYSHTEEQQQDQTVTEIEEDGEHAITRGKKLK 85

Query: 42  PEKQKIVVLNPGQVTSFKRRRRGPVTDHANTHTTTDSLITRHNRPISAPRTKLSILEGV- 100
           P K KIVVLN  +   FK R++     H  + TT + L                  +G+ 
Sbjct: 86  PSKAKIVVLNHQEAGLFKNRQQP----HFQSRTTQNPL-----------------FKGIF 124

Query: 101 DLGISTNGS-KEEDKEKLTDTVLEEIDQKRRKLMVFRSTVSEEQAVKAIGYQKPVKPIMS 159
           DL + ++ + KE  +      +L+EI+ +  KL+V +  V+  Q +++I  Q+P+   +S
Sbjct: 125 DLDVDSDMTLKELTQRPNKSNLLQEIESQTNKLLVSKINVTTPQVIQSIDVQRPITETIS 184

Query: 160 QKRYEQLENLLKSAYTVNQLRAYSKKMFGPSLXXXXXXXXXXXXMNEYWQCQVDENINEK 219
              Y  L   LK +YT+ QLR+Y+K+ F  SL            + + W C++   +   
Sbjct: 185 HYEYINLVEKLKGSYTLPQLRSYTKQNFNLSLPHVTKSKLIERIILKMWNCKI---VTNG 241

Query: 220 DDLIIERE----------------------LDIKTRDTYLLLLTDNGKILHNLARI-GAI 256
           DD  ++                        +D++  +  LLL T  GK+L NL RI G  
Sbjct: 242 DDGSLQSNSIEQVSATTNTSTASSSYEILTMDLQNTEITLLLFTQRGKLLQNLTRINGLT 301

Query: 257 LAVAPEENKIIIRASA-NVIRYVEISLNRILENVKTEIVPIEKLIRDHSIDGKLDGDMNV 315
           +A   +ENKIII+A+   V RYVE+S+ +IL NV  E V I     DH + G +   +N+
Sbjct: 302 IAFPLDENKIIIKAATRGVARYVEVSIRKILSNVINEFVNI-----DHLLQG-MSSTLNL 355

Query: 316 EQIIDLVQKQASVYIDLISDSSEEKQ-----YNISAFGKKRIDTAKLYLTWASKYTPH-- 368
           + +I+L++       + I + +         + ISAFG++RI+ AK  L W + Y  H  
Sbjct: 356 KDLINLIESHTDTVFEKIENDNNGNTNNKTIFKISAFGQRRIELAKKLLIWGT-YNDHSM 414

Query: 369 VQEEYITTGDKCMK---EKCKEYPYTDMDSFNWLDKNKLWYRLQLPENKLLGKTDKLEYP 425
             E+ +      +       K+YPY D+D+F+WL K+  W RLQ+P  K    T   E P
Sbjct: 415 TNEQILAVLPSSLNGNTNNLKKYPYNDIDAFDWLHKDNEWTRLQIPLKKGTMTTVPQE-P 473

Query: 426 PTIEMLDVKRIYDFLTDKNISLKQKLLPVKGTRQHVISVTMGQLLKA--GNSMIRTFLPR 483
            T+ + ++  IY     +    ++K          + S+++G  L+A      I+ F P+
Sbjct: 474 LTLSITNMDSIYQMFAPQQEDSQEK---------SMYSMSLGYSLQALSNGKTIQYFQPK 524

Query: 484 IPTISNFLMDLPYFEETHEGDLSVLGENDDYYVQLKFKPD--LSSIPPGIKSYPPNMELW 541
           IP +++ L++LP ++ +   D     +  +YYVQLKF P+  +S+      +YPP +ELW
Sbjct: 525 IPQLASRLLNLPLYDSSLTQDELFSIDKHEYYVQLKFIPNTLVSASFDSKITYPP-VELW 583

Query: 542 FELDDRDNAIKASMDCIFSVSEKAVMLEAPQHPFDFKIVSDAVVS-LNPSLEN------- 593
           FELD+  + I  S+ CI  +++K+++L+ P  PFD+ I  ++ +  L P+          
Sbjct: 584 FELDEEGHPIMDSLRCIAQLNKKSMILQTPTAPFDYAINMESYIDLLEPTATTLKTSSSS 643

Query: 594 ---------DDPGQWLEGQDELKHYVDQAKLDF-----GQGNKMLLGNSVCVNIPTEEEG 639
                         +L  QD +  ++  + L+F      + NK+LL NS+ VNI      
Sbjct: 644 SSSSSSSSSSSSSSFLTSQDGINQFLKNSTLNFQTNNKDKKNKLLLPNSMNVNISKNPTS 703

Query: 640 TVQ-VRYDFVNTYRHRITRLKFRDRFLVQYSNINGGA 675
             Q V Y ++ T+ H + RLK+ D+++VQ+S+IN G+
Sbjct: 704 KTQMVNYKYLITHHHSVLRLKYLDKYMVQFSDINAGS 740

>AGL167C [4145] [Homologous to ScYLR139C (SLS1) - SH]
           (382880..385063) [2184 bp, 727 aa]
          Length = 727

 Score =  260 bits (664), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 176/617 (28%), Positives = 322/617 (52%), Gaps = 33/617 (5%)

Query: 104 ISTNGSKEEDKEKLTDT-VLEEIDQKRRKLMVF-RSTVSEEQAVKAIGYQKPVKPI--MS 159
           +S   +K++DKEK+T   +L+ ++    K++   + + S+E+ +  I   +P +    MS
Sbjct: 117 LSEKPAKKQDKEKVTARDLLDALEWSGEKMLREEKRSTSDEETIGVINNMRPDQAALQMS 176

Query: 160 QKRYEQLENLLKSAYTVNQLRAYSKKMFGPSLXXXXXXXXXXXXMNEYWQCQVDENINEK 219
            +R+EQL   L  +++  QLR Y+ K++G               M E W+C+VD+ I++K
Sbjct: 177 PERFEQLRKALAKSFSYTQLRLYASKLYGLKKTNETKKAFVTKVMQECWKCKVDKTISKK 236

Query: 220 DDLIIERELDIKTRDTYLLLLTDNGKILHNLARIGAILAVAPEENKIIIRASANVIRYVE 279
            DLII+R +D+  +D YLLL+TD G+IL N+AR GA +A A  ENK+II AS ++  Y+E
Sbjct: 237 QDLIIKRTIDLSQKDMYLLLMTDGGRILQNMARTGASIAAAFTENKLIIHASKSLATYIE 296

Query: 280 ISLNRILENVKTEIVPIEKLIRDH-SIDGKLDGDMNVEQIIDLVQKQASVYIDLISDSSE 338
            S+  IL ++++  + + +  ++H ++        + EQ++ +V ++ SV+ +   +   
Sbjct: 297 ASIASILNSIQSSRLSLYEFAKEHTAVQDSRSPQYSPEQLLAMVCRECSVHQEKYPEVP- 355

Query: 339 EKQYNISAFGKKRIDTAKLYLTWASKYTPHVQEEYITTGDKCMKEKCKEYPYTDMDSFNW 398
                +SA  ++++  A+  L WA  Y P V  + I  G +  +    +YP +D + FNW
Sbjct: 356 -GLVALSALSQEKLAAARQLLLWAFDYKPEVTTDTIFCGLEDNQITYAKYPVSDPEWFNW 414

Query: 399 LDKNKLWYRLQLPENKLLGKTDKLEYPPTIEMLD--VKRIYDFLTDKNISLKQKLLPVKG 456
           L++   W+RLQ  E++L          P   + +  + ++YDF       ++Q    V  
Sbjct: 415 LERKTKWFRLQQVEHRLSPDMSGAAPAPVPVVPENVLNQVYDF------CMRQSTGNVAE 468

Query: 457 TRQH-----VISVTMGQLLKAGNSMIRTFLPRIPTISN--FLMDLPYFEETHEGDLSVLG 509
            + H     V+ V++GQ+L   +   + F P+ P ++     + L Y  E+     SV  
Sbjct: 469 IQNHAAEAKVLRVSLGQVLTDESGQRQMFQPQAPYMNQKLLQLPLYYPLESEHDYYSV-- 526

Query: 510 ENDDYYVQLKFKPDLSSIPPGIKSYPPNMELWFELDDRDNAIKASMDCIFSVSEKAVMLE 569
           +  DY++QL++ P LS+   G +   P +ELWF L + +     ++ CI  ++E++VML+
Sbjct: 527 DQHDYFLQLRYAPVLSAT--GFRYNLPPLELWFTLGENNRVEPHTVRCINRLAERSVMLQ 584

Query: 570 APQHPFDFKIVSDAVVSLNPSLENDDPGQW-LEGQDELKHYVDQA--KLDFGQGNKM--- 623
            P  P D ++  + V  + P   +D   +W L  Q  L+ Y+D+    LD     +M   
Sbjct: 585 LPGSPVDCRVTLERVSEMVPP-GDDASHEWLLTHQPALQQYLDRVTPTLDRHLRARMQNV 643

Query: 624 LLGNSVCVNIPTEEEGTVQVRYDFVNTYRHRITRLKFRDRFLVQYSNINGGARGGQTNRI 683
            L + + +N+         + Y FV+   HR+  L++ D++ VQ S ++GG  GG+ + +
Sbjct: 644 ALPDPIHLNVALPGSPPSPIPYRFVSMAHHRVLSLRYLDKYRVQLSTVSGGPAGGKHSEL 703

Query: 684 DLICDDNPDYNDFSNFI 700
           D++ D  PD   F+  I
Sbjct: 704 DVLPDAVPDRAAFAQLI 720

>YLR139C (SLS1) [3549] chr12 complement(421543..423474) Protein
           involved in mitochondrial transcription and/or
           translation processes [1932 bp, 643 aa]
          Length = 643

 Score =  186 bits (471), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 179/712 (25%), Positives = 311/712 (43%), Gaps = 112/712 (15%)

Query: 17  RTRIRLYSDDSLKEKLLSTRGKKKMPEKQKIVVLNPGQVTSFKRRRRGPVTDHANTHTTT 76
           R   RLYS       L    GKKK+P+  K VVLNP Q    K  ++ P           
Sbjct: 10  RLTYRLYSSSGPSSPL---HGKKKLPQNLKFVVLNPTQSGLVKNDQKQP----------- 55

Query: 77  DSLITRHNRPISAPRTKLSILEGVDLGISTNGSKEEDKEKLTDTVLEEIDQKRRKLMVFR 136
                RH RP      K +    +D G                           KL+VF 
Sbjct: 56  -----RH-RPSKKRSHKETGDNNLDFG--------------------------SKLLVFE 83

Query: 137 STVSEEQAVKAIGYQKPVKPIMSQKRYEQLENLLKSAYTVNQLRAYSKKMFGPS---LXX 193
              S + A+ +I  +KP    +    Y  L   L S+Y   QLR +       S   L  
Sbjct: 84  KQNSLDSALNSIRLKKPTSASLPSLEYNALLQSLTSSYNRYQLREFISTHQPDSSSHLTH 143

Query: 194 XXXXXXXXXXMNEYWQCQVDENINEKDDL---IIERELDIKTRDTYLLLLTDNGKILHNL 250
                     + + W CQ          +    +  + D   R+ +LLL+T NGKIL N 
Sbjct: 144 WKKSKLSQYIIEKIWNCQPISTPTTPTGIKSTSLTFQFD-SPREIFLLLITQNGKILTNF 202

Query: 251 ARIGAILAVAPEENKIIIRASANVIRYVEISLNRILENVKTEIVPIEKLIRDHSIDGKLD 310
            ++G    ++ ++N++ ++ S ++++Y EISLN+I  N+  E V +  L           
Sbjct: 203 NKLGLTFIISIQDNELTVKGSPSLLKYAEISLNKIWSNITHENVRMYSL----------- 251

Query: 311 GDMNVEQIIDLVQKQASVYIDLISDSSEEKQYNISAFGKKRIDTAKLYLTWASKYTPHVQ 370
             M  + +I+L+QK+   + + + D    + Y ISA   K+I  AK++L  A    P+  
Sbjct: 252 --MPSKDVINLIQKETHTFFEYLPD---LQMYKISALSTKKISMAKVFLLNAVASNPNTT 306

Query: 371 EEYITTGDKCMKEKCKEYPYTD-MDSFNWLDKNKLWYRLQ--LPEN--KLLGKTDKLEYP 425
           + + T     +K +   YP+ + +++ +WL+K++ W RLQ  +P+N   L+  T+     
Sbjct: 307 QHHHTIASPALKTEL--YPFNNTLENLDWLNKSQDWARLQSVVPKNCTDLMTPTEN---- 360

Query: 426 PTIEMLDVK-RIYDFLTDKNISLKQKLLPVKGTRQHVISVTMGQLLKAGNSMIRTFLPRI 484
            T E+ D +   ++    KNI     L P     Q  +S+T+G  L++  S    F P I
Sbjct: 361 ATPELTDAQVSQFESSLSKNIP---SLSPSDSISQS-LSITLGHSLQSA-SFSSIFQPLI 415

Query: 485 -PTISNFLMDLPYFEETHEGDLSVLGENDDY--------YVQLKFKPDLSSIPPGIKSYP 535
             +  + L++LP ++E+    + V    D +        ++QL F P   +       + 
Sbjct: 416 HKSFISKLLNLPMYKESSSSAVPVPVPLDQHLITNAHQSFIQLNFTPVPPTSGSSSSPF- 474

Query: 536 PNMELWFELDDRDNAIKASMDCIFSVSEKAVMLEAPQHPFDFKIVSDAVVSLNPSLENDD 595
             +++WFE+D+ DN +  SM  +  + E +V+L  PQ   D+KI SD +  L P  +  +
Sbjct: 475 --LQIWFEIDEFDNIVTTSMRPLLKLQENSVILRTPQCQTDYKITSDYIQDLLPDFDQTN 532

Query: 596 PGQWLEGQDELKHYVDQAKLDFGQGNKMLLGNSVCVNIPTEEEGTVQVRYDFVNTYRHRI 655
           P  WL  Q  L+ ++ ++     +   ++    + +++P   +  +Q +Y   +   HR+
Sbjct: 533 PDAWLSEQKGLQEFLLKSHWKLNKYQNLM--KKINISLP---DNLIQ-QYQLTDVLTHRV 586

Query: 656 TRLKFR------DRFLVQYSNIN-GGARGGQTNRIDLICDDNPDYNDFSNFI 700
             L+F       D++++QYS+I+ G    G   ++D I + NP       FI
Sbjct: 587 LNLRFPTNTAQDDKYIIQYSDISRGFLNNGSYRQLDFI-NVNPSETSLKTFI 637

>KLLA0E12397g complement(1095073..1095513) no similarity,
           hypothetical start
          Length = 146

 Score = 33.5 bits (75), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 45/111 (40%), Gaps = 14/111 (12%)

Query: 492 MDLPYFEETHEGDLSVLGENDDYYVQLKFKPDLSSIPPGIKSYPPNME------LWFELD 545
           M  P+F  +H  +  V+ +ND YY  +K +     +  GI  Y  + E       W E+ 
Sbjct: 1   MTTPFFSYSHSIEFKVIKKNDIYYSIIKIRIREKCMKRGINPYMYDYESELISRFWSEIS 60

Query: 546 DRDNAIKASMDCIFSVSEKAVMLEAPQHPFDFKIVSDAVVSLNPSLENDDP 596
           D +  +++   C     E  +     + PF   IV      L+PS    +P
Sbjct: 61  DGETEMESY--CHLFQWETGLGKSGGRSPFPNTIV------LDPSCRGAEP 103

>Sklu_2099.3 YJL051W, Contig c2099 2510-4921
          Length = 803

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 24/41 (58%)

Query: 6   PLLRKRILPAFRTRIRLYSDDSLKEKLLSTRGKKKMPEKQK 46
           P+ ++R+L  FR++  L    SLK+K+   R     PEKQ+
Sbjct: 246 PVSKRRVLSRFRSKKNLKRKFSLKDKITGHRAGIDQPEKQQ 286

>Scas_621.15
          Length = 307

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 37/74 (50%), Gaps = 7/74 (9%)

Query: 285 ILENVKTEIVPIEKLIRDHSID---GKLDGDMNVEQIIDLVQKQASVYIDLISDSSEEKQ 341
           IL  +  E+VP EKL+R+  +     K     NVE I  LV+K  S + D I+ + + KQ
Sbjct: 26  ILSRLDKEVVPTEKLLRETKVGVEVNKFKKSTNVE-IAKLVKKMISSWKDAINRNKKLKQ 84

Query: 342 YNISAFGKKRIDTA 355
               A   K +DT 
Sbjct: 85  QQQPA---KEMDTT 95

>Sklu_2437.16 YOL100W, Contig c2437 35714-38929 reverse complement
          Length = 1071

 Score = 30.4 bits (67), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 9/70 (12%)

Query: 356 KLYLTWASKYTPHVQEEYITTGD--KCMK-------EKCKEYPYTDMDSFNWLDKNKLWY 406
           KLY T+  + + +   EY   GD    MK       E C+ Y    +D+ +++ KN + +
Sbjct: 245 KLYFTFQDEASLYFLLEYAPNGDFLSVMKKFGSLNEECCRYYGAQMLDAIDFIHKNGVVH 304

Query: 407 RLQLPENKLL 416
           R   PEN LL
Sbjct: 305 RDIKPENILL 314

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.136    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 24,104,915
Number of extensions: 1120565
Number of successful extensions: 3624
Number of sequences better than 10.0: 30
Number of HSP's gapped: 3704
Number of HSP's successfully gapped: 31
Length of query: 700
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 591
Effective length of database: 12,822,747
Effective search space: 7578243477
Effective search space used: 7578243477
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)