Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M03223g1209119157960.0
YJL080C (SCP160)1222113633500.0
Scas_711.361219114031620.0
Kwal_14.23971206113427520.0
AAL177W1198112726710.0
KLLA0D02398g1205109725140.0
YBL032W (HEK2)381198830.10
AER186C316220800.27
CAGL0G04037g778160790.47
Kwal_27.12486299265750.86
YLL032C82560751.4
Scas_667.637838741.5
KLLA0E00847g713142722.6
Scas_515.634298694.6
YGR167W (CLC1)23346676.5
CAGL0F00693g45543687.1
Kwal_55.2065269469688.7
Scas_718.23364184679.1
Kwal_14.115159457679.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M03223g
         (1191 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M03223g complement(366828..370457) similar to sp|P06105 Sac...  2237   0.0  
YJL080C (SCP160) [2834] chr10 complement(285474..289142) Protein...  1295   0.0  
Scas_711.36                                                          1222   0.0  
Kwal_14.2397                                                         1064   0.0  
AAL177W [10] [Homologous to ScYJL080C (SCP160) - SH] complement(...  1033   0.0  
KLLA0D02398g complement(202446..206063) similar to sp|P06105 Sac...   972   0.0  
YBL032W (HEK2) [162] chr2 (160149..161294) Protein with four KH ...    37   0.10 
AER186C [2688] [Homologous to ScYBL032W (HEK2) - SH] (982057..98...    35   0.27 
CAGL0G04037g 383068..385404 similar to tr|Q07834 Saccharomyces c...    35   0.47 
Kwal_27.12486                                                          33   0.86 
YLL032C (YLL032C) [3388] chr12 complement(74269..76746) Protein ...    33   1.4  
Scas_667.6                                                             33   1.5  
KLLA0E00847g complement(87991..90132) some similarities with sgd...    32   2.6  
Scas_515.6                                                             31   4.6  
YGR167W (CLC1) [2119] chr7 (832459..833160) Clathrin light chain...    30   6.5  
CAGL0F00693g 79324..80691 highly similar to sp|P54885 Saccharomy...    31   7.1  
Kwal_55.20652                                                          31   8.7  
Scas_718.23                                                            30   9.1  
Kwal_14.1151                                                           30   9.3  

>CAGL0M03223g complement(366828..370457) similar to sp|P06105
            Saccharomyces cerevisiae YJL080c SCP160 required for
            maintenance of exact ploidy, hypothetical start
          Length = 1209

 Score = 2237 bits (5796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1120/1191 (94%), Positives = 1120/1191 (94%)

Query: 1    MSLTFATEKELAVDNTPAESSLDSLDGTTFDSDEXXXXXXXXXXXXXXXXXXXXXXXXXX 60
            MSLTFATEKELAVDNTPAESSLDSLDGTTFDSDE                          
Sbjct: 1    MSLTFATEKELAVDNTPAESSLDSLDGTTFDSDEESKPVEEAPKPEPKPLPSLKDLPSLV 60

Query: 61   XXNSFKPATKVEWGPNMKPXXXXXXXXXXXXXXXXXXXXGRMRSNNIQETFTLDLQSQLS 120
              NSFKPATKVEWGPNMKP                    GRMRSNNIQETFTLDLQSQLS
Sbjct: 61   DSNSFKPATKVEWGPNMKPAAISSSVSPSMSRSASATSAGRMRSNNIQETFTLDLQSQLS 120

Query: 121  VTKLELSRILQTVKQANNVSVESTLSRNSRTFLISGPAPKVKEAKRELIKMLTRPITENI 180
            VTKLELSRILQTVKQANNVSVESTLSRNSRTFLISGPAPKVKEAKRELIKMLTRPITENI
Sbjct: 121  VTKLELSRILQTVKQANNVSVESTLSRNSRTFLISGPAPKVKEAKRELIKMLTRPITENI 180

Query: 181  EVPSRCKAVIIGSGGKNIREISDRYDVKIHISKEPKPDSYNEXXXXXXXXXXXFGDFESV 240
            EVPSRCKAVIIGSGGKNIREISDRYDVKIHISKEPKPDSYNE           FGDFESV
Sbjct: 181  EVPSRCKAVIIGSGGKNIREISDRYDVKIHISKEPKPDSYNEDLDDDLSDISIFGDFESV 240

Query: 241  KQAKAKILSIVNEDLKNITARLSVEDSTLGSFVNVKEVSSDDVKVQYYQDTGSFTITGSL 300
            KQAKAKILSIVNEDLKNITARLSVEDSTLGSFVNVKEVSSDDVKVQYYQDTGSFTITGSL
Sbjct: 241  KQAKAKILSIVNEDLKNITARLSVEDSTLGSFVNVKEVSSDDVKVQYYQDTGSFTITGSL 300

Query: 301  DDIKNAKTKIKDYLQKLSNELAEENVKIPSKFQFLIDADEVKDRFGVIVKFPKSSSDETV 360
            DDIKNAKTKIKDYLQKLSNELAEENVKIPSKFQFLIDADEVKDRFGVIVKFPKSSSDETV
Sbjct: 301  DDIKNAKTKIKDYLQKLSNELAEENVKIPSKFQFLIDADEVKDRFGVIVKFPKSSSDETV 360

Query: 361  QFAGLKDKVAEAISFARTSSKQYIVDSLDISKAHNKNLDHAKRLVIYFQKYNVLDKVAEE 420
            QFAGLKDKVAEAISFARTSSKQYIVDSLDISKAHNKNLDHAKRLVIYFQKYNVLDKVAEE
Sbjct: 361  QFAGLKDKVAEAISFARTSSKQYIVDSLDISKAHNKNLDHAKRLVIYFQKYNVLDKVAEE 420

Query: 421  FPDVKYVLPSIEDLQNAKEVFIYLSAKNDKTSXXXXXXXXXXXXVNDITPAETLVIDDLD 480
            FPDVKYVLPSIEDLQNAKEVFIYLSAKNDKTS            VNDITPAETLVIDDLD
Sbjct: 421  FPDVKYVLPSIEDLQNAKEVFIYLSAKNDKTSEIKAARREIIAIVNDITPAETLVIDDLD 480

Query: 481  YELFHRNIKHILLGHESEAKFIQIGDYFKGDDSVVLFATSTDEDFKPSTDEIKESLEKVN 540
            YELFHRNIKHILLGHESEAKFIQIGDYFKGDDSVVLFATSTDEDFKPSTDEIKESLEKVN
Sbjct: 481  YELFHRNIKHILLGHESEAKFIQIGDYFKGDDSVVLFATSTDEDFKPSTDEIKESLEKVN 540

Query: 541  ANLNDLRKKQNSLEVATYDLESEKQDEFFGKDSVALKLILEDISGDDGHIQIKLHSPEKN 600
            ANLNDLRKKQNSLEVATYDLESEKQDEFFGKDSVALKLILEDISGDDGHIQIKLHSPEKN
Sbjct: 541  ANLNDLRKKQNSLEVATYDLESEKQDEFFGKDSVALKLILEDISGDDGHIQIKLHSPEKN 600

Query: 601  KMTLRGDERAVKKANKDIKSIVENPSTTAKITVEVPVASVSRLIGNKGANLQKLRNKYNC 660
            KMTLRGDERAVKKANKDIKSIVENPSTTAKITVEVPVASVSRLIGNKGANLQKLRNKYNC
Sbjct: 601  KMTLRGDERAVKKANKDIKSIVENPSTTAKITVEVPVASVSRLIGNKGANLQKLRNKYNC 660

Query: 661  SIDIPQQGESDQDKTVEITIKGLQFIIEHAKKDIANEAKRLADIVTKELVAQAKYHRNLS 720
            SIDIPQQGESDQDKTVEITIKGLQFIIEHAKKDIANEAKRLADIVTKELVAQAKYHRNLS
Sbjct: 661  SIDIPQQGESDQDKTVEITIKGLQFIIEHAKKDIANEAKRLADIVTKELVAQAKYHRNLS 720

Query: 721  GPQGMYRTRLQEKYNVFINFLKENNTITIKGPSRGVNKAYDELKALLDFEMENGHKTIVN 780
            GPQGMYRTRLQEKYNVFINFLKENNTITIKGPSRGVNKAYDELKALLDFEMENGHKTIVN
Sbjct: 721  GPQGMYRTRLQEKYNVFINFLKENNTITIKGPSRGVNKAYDELKALLDFEMENGHKTIVN 780

Query: 781  VPVEHMSRIIGKNGDTINGLSDEFGVELDFLQKSDDPKAVETGVVELEITGNRNAIKEAS 840
            VPVEHMSRIIGKNGDTINGLSDEFGVELDFLQKSDDPKAVETGVVELEITGNRNAIKEAS
Sbjct: 781  VPVEHMSRIIGKNGDTINGLSDEFGVELDFLQKSDDPKAVETGVVELEITGNRNAIKEAS 840

Query: 841  TKIAAIVSEAADHVTEKLDIDRKYHKTIVGAGGHTLREIISNAGGDEVRGRAVDIPNADS 900
            TKIAAIVSEAADHVTEKLDIDRKYHKTIVGAGGHTLREIISNAGGDEVRGRAVDIPNADS
Sbjct: 841  TKIAAIVSEAADHVTEKLDIDRKYHKTIVGAGGHTLREIISNAGGDEVRGRAVDIPNADS 900

Query: 901  ESSIITIQGPKKFVSNVVKAINKIVEESQNSITKKIEVPGERLGALIGPGGIVRKQLESE 960
            ESSIITIQGPKKFVSNVVKAINKIVEESQNSITKKIEVPGERLGALIGPGGIVRKQLESE
Sbjct: 901  ESSIITIQGPKKFVSNVVKAINKIVEESQNSITKKIEVPGERLGALIGPGGIVRKQLESE 960

Query: 961  FNIQLYVPKRDEEETRVSLTGLPENIEKAEKKIFTEIIRDNFDLEIMVPANVQNYVSDRG 1020
            FNIQLYVPKRDEEETRVSLTGLPENIEKAEKKIFTEIIRDNFDLEIMVPANVQNYVSDRG
Sbjct: 961  FNIQLYVPKRDEEETRVSLTGLPENIEKAEKKIFTEIIRDNFDLEIMVPANVQNYVSDRG 1020

Query: 1021 NLPQRLRLEKFVNVRYGNATKKANNLNRTPVDIPYEKVAGAEGEKVKFTVEETGPSVVEN 1080
            NLPQRLRLEKFVNVRYGNATKKANNLNRTPVDIPYEKVAGAEGEKVKFTVEETGPSVVEN
Sbjct: 1021 NLPQRLRLEKFVNVRYGNATKKANNLNRTPVDIPYEKVAGAEGEKVKFTVEETGPSVVEN 1080

Query: 1081 VDGEIPWRLIYEPIDFDSILDEENGEKKEASVDENKKQQLLKEAKEIIENRINDAPNATY 1140
            VDGEIPWRLIYEPIDFDSILDEENGEKKEASVDENKKQQLLKEAKEIIENRINDAPNATY
Sbjct: 1081 VDGEIPWRLIYEPIDFDSILDEENGEKKEASVDENKKQQLLKEAKEIIENRINDAPNATY 1140

Query: 1141 SGYVWTSDPSKFFKVVGMGGSNVKKIRESTNCIVYVPKKSDKINNVIFIKG 1191
            SGYVWTSDPSKFFKVVGMGGSNVKKIRESTNCIVYVPKKSDKINNVIFIKG
Sbjct: 1141 SGYVWTSDPSKFFKVVGMGGSNVKKIRESTNCIVYVPKKSDKINNVIFIKG 1191

 Score = 73.9 bits (180), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 121/513 (23%), Positives = 214/513 (41%), Gaps = 84/513 (16%)

Query: 561  ESEKQDEFFGKDSVALKLILEDISGDDGHIQIKLHSP---------EKNKMTLRGDERAV 611
            E+++  +   K+ VA      ++SG  G  + +L            E N +T++G  R V
Sbjct: 697  EAKRLADIVTKELVAQAKYHRNLSGPQGMYRTRLQEKYNVFINFLKENNTITIKGPSRGV 756

Query: 612  KKANKDIKSIVE-NPSTTAKITVEVPVASVSRLIGNKGANLQKLRNKYNCSIDIPQQGES 670
             KA  ++K++++       K  V VPV  +SR+IG  G  +  L +++   +D  Q+  S
Sbjct: 757  NKAYDELKALLDFEMENGHKTIVNVPVEHMSRIIGKNGDTINGLSDEFGVELDFLQK--S 814

Query: 671  DQDKTVE-----ITIKGLQFIIEHAKKDIANEAKRLADIVTKELVAQAKYHRNLSGPQGM 725
            D  K VE     + I G +  I+ A   IA      AD VT++L    KYH+ + G  G 
Sbjct: 815  DDPKAVETGVVELEITGNRNAIKEASTKIAAIVSEAADHVTEKLDIDRKYHKTIVGAGGH 874

Query: 726  YRTRL---------QEKYNVFINFLKENNTITIKGPSRGVNKAYDELKALLDFEMENGHK 776
                +         + +     N   E++ ITI+GP + V+     +  +++ E +N   
Sbjct: 875  TLREIISNAGGDEVRGRAVDIPNADSESSIITIQGPKKFVSNVVKAINKIVE-ESQNSIT 933

Query: 777  TIVNVPVEHMSRIIGKNGDTINGLSDEFGVELDFLQKSDD----------PKAVE----- 821
              + VP E +  +IG  G     L  EF ++L ++ K D+          P+ +E     
Sbjct: 934  KKIEVPGERLGALIGPGGIVRKQLESEFNIQL-YVPKRDEEETRVSLTGLPENIEKAEKK 992

Query: 822  --TGVV----ELEITGNRNAIKEAS--------TKIAAIVSEAADHVTEKLD------ID 861
              T ++    +LEI    N     S         ++   V+    + T+K +      +D
Sbjct: 993  IFTEIIRDNFDLEIMVPANVQNYVSDRGNLPQRLRLEKFVNVRYGNATKKANNLNRTPVD 1052

Query: 862  RKYHKTIVGAGGHTLREIISNAGGDEVRGRAVDIP------NADSESSIITIQGPKKFVS 915
              Y K + GA G  ++  +   G   V     +IP        D +S +    G KK  S
Sbjct: 1053 IPYEK-VAGAEGEKVKFTVEETGPSVVENVDGEIPWRLIYEPIDFDSILDEENGEKKEAS 1111

Query: 916  NVVKAINKIVEESQNSITKKI-EVPG------------ERLGALIGPGGIVRKQLESEFN 962
                   ++++E++  I  +I + P              +   ++G GG   K++    N
Sbjct: 1112 VDENKKQQLLKEAKEIIENRINDAPNATYSGYVWTSDPSKFFKVVGMGGSNVKKIRESTN 1171

Query: 963  IQLYVPKR-DEEETRVSLTGLPENIEKAEKKIF 994
              +YVPK+ D+    + + G  EN+EKA + I 
Sbjct: 1172 CIVYVPKKSDKINNVIFIKGAKENVEKAGEAII 1204

>YJL080C (SCP160) [2834] chr10 complement(285474..289142) Protein
            involved in control of mitotic chromosome transmission,
            contains 14 KH domains which are found in RNA-binding
            proteins such as Mer1p and mouse hnRNP X [3669 bp, 1222
            aa]
          Length = 1222

 Score = 1295 bits (3350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 651/1136 (57%), Positives = 844/1136 (74%), Gaps = 16/1136 (1%)

Query: 70   KVEWGPNMKPXXXXXXXXXXXXXXXXXXXXG-RMRSNNIQETFTLDLQSQLSVTKLELSR 128
            KV WGPNMKP                      RMRS NIQE FTLDLQSQLS+TK ELSR
Sbjct: 71   KVSWGPNMKPAVSNSPSPSPSAPSLTTGLGAKRMRSKNIQEAFTLDLQSQLSITKPELSR 130

Query: 129  ILQTVKQANNVSVESTLSRNSRTFLISGPAPKVKEAKRELIKMLTRPITENIEVPSRCKA 188
            I+Q+VK+ ++VSVESTLS+N+RTFL+SG A  V EAKREL+K LT+PI   IEVPS+CKA
Sbjct: 131  IVQSVKKNHDVSVESTLSKNARTFLVSGVAANVHEAKRELVKKLTKPINAVIEVPSKCKA 190

Query: 189  VIIGSGGKNIREISDRYDVKIHISKEPKPDSYNEXXXXXXXXXXXFGDFESVKQAKAKIL 248
             IIGSGG+ IREISD Y+VKI++SKE   +SY+E           FGDFESV  AKAKIL
Sbjct: 191  SIIGSGGRTIREISDAYEVKINVSKEVNENSYDEDMDDTTSNVSLFGDFESVNLAKAKIL 250

Query: 249  SIVNEDLKNITARLSVEDSTLGSFVNVKEVSSDD----VKVQYYQDTGSFTITGSLDDIK 304
            +IV E+ KN T +L VED     +++V E +SD+    VKVQ+Y+ +G   I G  +  K
Sbjct: 251  AIVKEETKNATIKLVVEDEKYLPYIDVSEFASDEGDEEVKVQFYKKSGDIVILGPREKAK 310

Query: 305  NAKTKIKDYLQKLSNELAEENVKIPSKFQFLIDADEVKDRFGVIVKFPKSSSDETVQFAG 364
              KT I+DYL+KL++ L EE VKIPSKFQFLIDA+E+K+++ VIV FP +  DE V F G
Sbjct: 311  ATKTSIQDYLKKLASNLDEEKVKIPSKFQFLIDAEELKEKYNVIVTFPSTPDDELVSFVG 370

Query: 365  LKDKVAEAISFARTSSKQYIVDSLDISKAHNKNLDHAKRLVIYFQKYNVLDKVAEEFPDV 424
            L+DKV EAI++AR+SSK Y+V+SLDISKAH+KNL HAK L++YF KY+VL  + E  P+V
Sbjct: 371  LRDKVGEAITYARSSSKSYVVESLDISKAHSKNLTHAKNLIMYFTKYSVLKGLEESHPNV 430

Query: 425  KYVLPSIEDLQNAKEVFIYLSAKNDKTSXXXXXXXXXXXXVNDITPAETLVIDDLDYELF 484
            K  LPSI+ L  A+ V I++SAK+D+ +            VN+I P+ETLVI DLDYELF
Sbjct: 431  KISLPSIQSLPTAETVTIHISAKSDEANDIKAVRKELISFVNNIPPSETLVITDLDYELF 490

Query: 485  HRNIKHILLGHESEAKFIQIGDYFKGDDSVVLFATSTDEDFKPSTDEIKESLEKVNANLN 544
              +IKH LL  ES   F+Q GDY+  D+S++L A + DEDFKPS +EI+ SL K N +LN
Sbjct: 491  GGSIKHCLLASESSVAFVQFGDYYPNDNSILLVALTEDEDFKPSIEEIQASLNKANESLN 550

Query: 545  DLRKKQNSLEVATYDLESEKQDEFFGKDSVALKLILEDISGDDGHIQIKLHSPEKNKMTL 604
             LR KQN++E  TY+   E QD  F   S   KLI+EDIS  +GH+QIKLH+PE+N++T+
Sbjct: 551  SLRTKQNNMETKTYEFSEEVQDSLFKPSSATWKLIMEDISEQEGHLQIKLHTPEENQLTV 610

Query: 605  RGDERAVKKANKDIKSIVENPSTTAKITVEVPVASVSRLIGNKGANLQKLRNKYNCSIDI 664
            RGDE+A K ANK  +SI+ +PS+ +K+TV +P  SV+RLIGNKG+NLQ++R K+ C IDI
Sbjct: 611  RGDEKAAKAANKIFESILNSPSSKSKMTVNIPANSVARLIGNKGSNLQQIREKFACQIDI 670

Query: 665  PQQ--GESDQDKTVEITIKGLQFIIEHAKKDIANEAKRLADIVTKELVAQAKYHRNLSGP 722
            P +    + +DKTVE+T+ GL++ + HAKK +A EAK+ ADI+TKEL+   K+H +L GP
Sbjct: 671  PNEENNNASKDKTVEVTLTGLEYNLTHAKKYLAAEAKKWADIITKELIVPVKFHGSLIGP 730

Query: 723  QGMYRTRLQEKYNVFINFLKENNTITIKGPSRGVNKAYDELKALLDFEMENGHKTIVNVP 782
             G YR RLQEKYNVFINF ++N  +TI+GPSRGVNKA++ELKALLDFEMENGHK ++NVP
Sbjct: 731  HGTYRNRLQEKYNVFINFPRDNEIVTIRGPSRGVNKAHEELKALLDFEMENGHKMVINVP 790

Query: 783  VEHMSRIIGKNGDTINGLSDEFGVELDFLQKSDDPKAVETGVVELEITGNRNAIKEASTK 842
             EH+ RIIGKNGD IN +  E+GVE+DFLQKS DPKA ETG VELEITG+R  IK+A+ +
Sbjct: 791  AEHVPRIIGKNGDNINDIRAEYGVEMDFLQKSTDPKAQETGEVELEITGSRQNIKDAAKR 850

Query: 843  IAAIVSEAADHVTEKLDIDRKYHKTIVGAGGHTLREIISNAGGDEVRGRAVDIPNADSES 902
            + +IV+EA+D VTE L ID KYHK+IVG+GGH LREIIS AGG+E+R ++VDIPNADSE+
Sbjct: 851  VESIVAEASDFVTEVLKIDHKYHKSIVGSGGHILREIISKAGGEEIRNKSVDIPNADSEN 910

Query: 903  SIITIQGPKKFVSNVVKAINKIVEESQNSITKKIEVPGERLGALIGPGGIVRKQLESEFN 962
              IT+QGP+KFV  VV+ INKIV++++NS+TK I++P ER GALIGPGGIVR+QLESEFN
Sbjct: 911  KDITVQGPQKFVKKVVEEINKIVKDAENSVTKTIDIPAERKGALIGPGGIVRRQLESEFN 970

Query: 963  IQLYVPKRDEEETRVSLTGLPENIEKAEKKIFTEIIRDNFDLEIMVPANVQNYVSDRGNL 1022
            I L+VP +D+   ++++TG PEN+EKAEKKI  EIIR+NFD E+ VPA++  YVS+RG  
Sbjct: 971  INLFVPNKDDPSGKITITGAPENVEKAEKKILNEIIRENFDREVDVPASIYEYVSERGAF 1030

Query: 1023 PQRLRLEKFVNVRYGNATKKANNLNRTPVDIPYEKVAGA-EG---EKVKFTVEETG-PSV 1077
             Q+LR++  VNVR+GN +KKAN L R P++IP EKV G+ EG   EK KFT+EE G P+ 
Sbjct: 1031 IQKLRMDLSVNVRFGNTSKKANKLARAPIEIPLEKVCGSTEGENAEKTKFTIEEVGAPTS 1090

Query: 1078 VENVDGEIPWRLIYEPIDFDSILD--EENGEKKEASVDENKKQQLLKEAKEIIENRINDA 1135
             E  +G+I  RL YEPID  SIL   EE    K+ S D  KK++ L  A ++I+ RI  A
Sbjct: 1091 SE--EGDITMRLTYEPIDLSSILSDGEEKEVTKDTSNDSAKKEEALDTAVKLIKERIAKA 1148

Query: 1136 PNATYSGYVWTSDPSKFFKVVGMGGSNVKKIRESTNCIVYVPKKSDKINNVIFIKG 1191
            P+ATY+GYVW +D  +F  +VG GGSN+KKIRE+ + I+ VP+KSDK+N+V++I+G
Sbjct: 1149 PSATYAGYVWGADTRRFNMIVGPGGSNIKKIREAADVIINVPRKSDKVNDVVYIRG 1204

>Scas_711.36
          Length = 1219

 Score = 1222 bits (3162), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 614/1140 (53%), Positives = 823/1140 (72%), Gaps = 13/1140 (1%)

Query: 63   NSFKPATKVEWGPNMKPXXXXXXXXXXXXXXXXXXXXG--RMRSNNIQETFTLDLQSQLS 120
            NS    +KV WGPNM+P                    G  RMRS NIQE+FTLDLQSQLS
Sbjct: 64   NSIFANSKVTWGPNMQPSPPISCSPSLSSSLSPSPVSGAKRMRSKNIQESFTLDLQSQLS 123

Query: 121  VTKLELSRILQTVKQANNVSVESTLSRNSRTFLISGPAPKVKEAKRELIKMLTRPITENI 180
            +TK ELSRI+Q+VKQA NVSVESTLS+NSRTFLISG A KV++AKR+L+K LTRPI + +
Sbjct: 124  ITKPELSRIVQSVKQAYNVSVESTLSKNSRTFLISGVATKVQDAKRDLVKQLTRPIDDVM 183

Query: 181  EVPSRCKAVIIGSGGKNIREISDRYDVKIHISKEPKPDSYNEXXXXXXXXXXXFGDFESV 240
             VP+RC+A IIGSGGK IR IS++YDV I++++E  PDSY+E            GDFESV
Sbjct: 184  TVPARCRAAIIGSGGKTIRGISEQYDVTINLARENNPDSYDEDLNDFTANVNFHGDFESV 243

Query: 241  KQAKAKILSIVNEDLKNITARLSVEDSTLGSFVNVKEVS-SDDVKVQYYQDTGSFTITGS 299
              AK +I  IV E+ K ++ R+ V+D  +  F+++  ++  + VK  +Y+DT    I+G 
Sbjct: 244  NMAKRRIEEIVKEETKTLSLRVPVKDEKIIPFIDLSAITVPEGVKCNFYRDTAEVNISGP 303

Query: 300  LDDIKNAKTKIKDYLQKLSNELAEENVKIPSKFQFLIDADEVKDRFGVIVKFPKSSSDET 359
             DD+K  KT ++DYL +LS+ L EE +KIP+KFQFLID   +K  F VIV FP   +DE 
Sbjct: 304  RDDVKATKTGVQDYLNQLSSTLTEEKIKIPTKFQFLIDTKALKKEFNVIVTFPSDPTDEL 363

Query: 360  VQFAGLKDKVAEAISFARTSSKQYIVDSLDISKAHNKNLDHAKRLVIYFQKYNVLDKVAE 419
            V F G KDKV EAI+FAR +SK + VDSLDISK+H+KNL HAK L +YF KY  L  + E
Sbjct: 364  VSFVGQKDKVTEAIAFARANSKTFTVDSLDISKSHSKNLAHAKNLALYFTKYPALKDIKE 423

Query: 420  EFPDVKYVLPSIEDLQNAKEVFIYLSAKNDKTSXXXXXXXXXXXXVNDITPAETLVIDDL 479
             +P+VK VLP+   L++A  V I +SAK++  +            VN ITP +TL I DL
Sbjct: 424  AYPEVKIVLPAPSLLKDAASVVINISAKSESANEIKFARKELINFVNTITPLDTLTITDL 483

Query: 480  DYELFHRNIKHILLGHESEAKFIQIGDYFKGDDSVVLFATSTDEDFKPSTDEIKESLEKV 539
            DYELFH++IK  LL  E +  FIQ+GDYF G+DS+VLF +S +EDFKPS +EI   LEKV
Sbjct: 484  DYELFHKSIKSTLLATEDKVPFIQLGDYFPGNDSIVLFYSSPEEDFKPSAEEINAELEKV 543

Query: 540  NANLNDLRKKQNSLEVATYDLESEKQDEFFGKDSVALKLILEDISGDDGHIQIKLHSPEK 599
            NA+L  LR K N +    Y L+++ QD+     S  L LILED+S ++G++QIKLH+PE 
Sbjct: 544  NASLEPLRAKLNKMTNKVYTLDAKIQDDLLSPSSATLHLILEDVSKEEGNLQIKLHTPEA 603

Query: 600  NKMTLRGDERAVKKANKDIKSIVENPSTTAKITVEVPVASVSRLIGNKGANLQKLRNKYN 659
            NK+T+RGD++AVK ANK + SIVENP+  +KITVEV   S++RL+G KG+NL ++R K++
Sbjct: 604  NKVTIRGDDKAVKTANKALTSIVENPTKKSKITVEVASNSIARLVGTKGSNLNEIREKFD 663

Query: 660  CSIDIPQQGESDQDKTVEITIKGLQFIIEHAKKDIANEAKRLADIVTKELVAQAKYHRNL 719
            C ID+P   E  +DKT EI + G ++ +E AKK IA EAK+ ADIVTKELV   KYH +L
Sbjct: 664  CQIDVPNHDEI-KDKTAEIVLTGQEYNLEQAKKFIAAEAKKWADIVTKELVVPQKYHGSL 722

Query: 720  SGPQGMYRTRLQEKYNVFINFLKENNTITIKGPSRGVNKAYDELKALLDFEMENGHKTIV 779
             G  G+YR RLQ+KY+VFINF ++++ +TI+GPSRGV +A+ EL ALLDFE ENG+K IV
Sbjct: 723  IGANGVYRNRLQDKYSVFINFPRDSDIVTIRGPSRGVKQAFTELSALLDFERENGYKKIV 782

Query: 780  NVPVEHMSRIIGKNGDTINGLSDEFGVELDFLQKSDDPKAVETGVVELEITGNRNAIKEA 839
             VP EH+ RIIGK G  IN +  +FGVE+DFLQKS DPK  ETG VELEITG R AI EA
Sbjct: 783  VVPAEHVPRIIGKAGANINDIRADFGVEMDFLQKSTDPKVQETGEVELEITGTRAAINEA 842

Query: 840  STKIAAIVSEAADHVTEKLDIDRKYHKTIVGAGGHTLREIISNAGGDEVRGRAVDIPNAD 899
            + K+  I+ EAAD  +E L + RKYH+ IVG+GGH LR+IIS AGGD++R + +DIPNA+
Sbjct: 843  ANKVQEIIDEAADFDSETLSVARKYHRIIVGSGGHNLRDIISKAGGDDIRNKNIDIPNAN 902

Query: 900  SESSIITIQGPKKFVSNVVKAINKIVEESQNSITKKIEVPGERLGALIGPGGIVRKQLES 959
            SES +IT+QGPKKFV++V+K INKIVE+ +NS+TK +E+P ER GAL+GPGG++R+QLE+
Sbjct: 903  SESDVITVQGPKKFVASVLKQINKIVEDGENSVTKTLEIPEERHGALVGPGGMIRRQLET 962

Query: 960  EFNIQLYVPKRDEEETRVSLTGLPENIEKAEKKIFTEIIRDNFDLEIMVPANVQNYVSDR 1019
            EFN+ L VP ++E    V +TGLPEN+EKAEKKI TEI+RD+FD E+ VPA++  +VS+R
Sbjct: 963  EFNVILEVPHKNETGP-VRITGLPENVEKAEKKILTEIVRDSFDRELSVPASLHEFVSER 1021

Query: 1020 GNLPQRLRLEKFVNVRYGNATKKANNLNRTPVDIPYEKVAGA----EGEKVKFTVEETGP 1075
            G   Q+LR+E+FVNV++GNA+++A  LNR+ V IP EKV  A    + E+ +  +EE G 
Sbjct: 1022 GAFTQKLRIEEFVNVKHGNASRRATRLNRSNVVIPVEKVRPATEDEKKEQFRAVIEEVGE 1081

Query: 1076 SVVENVDGEIPWRLIYEPIDFDSILDEENGEKKEAS----VDENKKQQLLKEAKEIIENR 1131
               +  DG+IPWRL YEPIDF  +L E++ E KEA+    +DE KK++ L +  ++IE+R
Sbjct: 1082 PRNDKEDGDIPWRLTYEPIDFSEVLSEDSDETKEATPKVEIDEAKKEETLNKVVKMIEDR 1141

Query: 1132 INDAPNATYSGYVWTSDPSKFFKVVGMGGSNVKKIRESTNCIVYVPKKSDKINNVIFIKG 1191
            +  A ++T++GY+W +DP KF KVVG GGSN+KKIR++ + I+ VP++SDK+N+VI+++G
Sbjct: 1142 VAKAASSTFAGYIWCADPRKFNKVVGPGGSNIKKIRDAADVIINVPRRSDKVNDVIYVRG 1201

>Kwal_14.2397
          Length = 1206

 Score = 1064 bits (2752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/1134 (48%), Positives = 774/1134 (68%), Gaps = 20/1134 (1%)

Query: 68   ATKVEWGPNMKPXXXXXXXXX--------XXXXXXXXXXXGRMRSNNIQETFTLDLQSQL 119
            A+KV WGPNMK                                RS  IQE F+LDLQSQ+
Sbjct: 65   ASKVSWGPNMKTQTASSASGASSTSNSAVQSRSTTPALSAKPARSKTIQEAFSLDLQSQI 124

Query: 120  SVTKLELSRILQTVKQANNVSVESTLSRNSRTFLISGPAPKVKEAKRELIKMLTRPITEN 179
            S++K + SRI+Q +K  ++VSVESTLS++SRTFLI G    VK A+RE++K LT+P+T  
Sbjct: 125  SMSKPDFSRIIQGIKTTHSVSVESTLSKSSRTFLIFGKPQDVKAARREIVKKLTKPVTVT 184

Query: 180  IEVPSRCKAVIIGSGGKNIREISDRYDVKIHISKEPKPDSYNEXXXXXXXXXXXFGDFES 239
            IEVPS+ ++ IIG+GGK IREIS+  +V+I I KE K D+Y+E            GD ES
Sbjct: 185  IEVPSKTRSAIIGAGGKKIREISEPLEVRIDIGKEIKEDTYDEDLDDSMVDVSIHGDLES 244

Query: 240  VKQAKAKILSIVNEDLKNITARLSVEDSTLGSFVNVKEVSSDDVKVQYYQDTGSFTITGS 299
            V+ A+ KI +IV ED KN + +++VED  L  F+N++ +    V  ++   +G   ++G 
Sbjct: 245  VRIAQQKISAIVKEDTKNASIQVNVEDKNLVPFINLEGLKLP-VDAKFNTASGQIQLSGL 303

Query: 300  LDDIKNAKTKIKDYLQKLSNELAEENVKIPSKFQFLIDADEVKDRFGVIVKFPKSSSDET 359
             D+++ AK  I  YL++LS+++    VKIP KFQFLID  E+K++F V V  P +  +E 
Sbjct: 304  RDEVQAAKANILQYLRELSSQIKTLKVKIPVKFQFLIDESEIKEKFNVTVHLPTAGGEE- 362

Query: 360  VQFAGLKDKVAEAISFARTSSKQYIVDSLDISKAHNKNLDHAKRLVIYFQKYNVLDKVAE 419
            V F G    + EA+SFAR +SK+YIV+SL+ISKAH KN+ HAK + IYF+ YNVL+ + +
Sbjct: 363  VSFVGPAVHLDEAVSFARENSKKYIVESLEISKAHGKNVAHAKNIAIYFEIYNVLEPIKK 422

Query: 420  EFPDVKYVLPSIEDLQNAKEVFIYLSAKNDKTSXXXXXXXXXXXXVNDITPAETLVIDDL 479
             FP+V++ +PS ++LQ+A  V I +S  ++               VN++  ++ LV++DL
Sbjct: 423  AFPNVRFAIPSPQELQDADAVAIRISTTSENADDLKTVRKDIINLVNELPTSQVLVVEDL 482

Query: 480  DYELFHRNIKHILLGHESEAKFIQIGDYFKGDDSVVLFATSTDEDFKPSTDEIKESLEKV 539
            DYEL+ ++IKH+LL  +  A F+Q+GD+F G+D ++LFA  +DEDF+PS DE+K++L  V
Sbjct: 483  DYELYSKDIKHLLLQQQQNADFVQLGDFFPGNDKILLFARLSDEDFRPSDDELKQTLADV 542

Query: 540  NANLNDLRKKQNSLEVATYDLESEKQDEFFGKDSVALKLILEDISGDDGHIQIKLHSPEK 599
            N+ L  LR KQ++L +  +++ SEKQD FF   +   +LI +DI+ + GH Q KLH+P  
Sbjct: 543  NSALEPLRAKQSNLSLKIFEIPSEKQDAFFKPSTFTRELIEQDIATEGGHAQFKLHAPTA 602

Query: 600  NKMTLRGDERAVKKANKDIKSIVENPSTTAKITVEVPVASVSRLIGNKGANLQKLRNKYN 659
            +++T+RGD +AVK A   I+SIV N     +    V   SV RLIG+KGANL  +R KY 
Sbjct: 603  DQLTIRGDTKAVKVATAAIESIVANSGEKFETKFAVSSNSVPRLIGSKGANLNAIREKYQ 662

Query: 660  CSIDIPQQGESDQDKTVEITIKGLQFIIEHAKKDIANEAKRLADIVTKELVAQAKYHRNL 719
            C+ID+ Q+   +Q    E+T+ GL++ +EHAK  + +E+K+ AD++TKEL    KY   L
Sbjct: 663  CNIDVAQESSGNQ---TEVTVTGLKYSVEHAKAYLLSESKKWADVITKELNVLPKYRGRL 719

Query: 720  SGPQGMYRTRLQEKYNVFINFLKE--NNTITIKGPSRGVNKAYDELKALLDFEMENGHKT 777
             G QG YR RLQ KY+V I+F  E  N  +TI+GPSRGV KAYDELKALLDFE+ENGH +
Sbjct: 720  IGSQGTYRNRLQTKYSVHIHFPMEGENEGVTIRGPSRGVAKAYDELKALLDFEIENGHTS 779

Query: 778  IVNVPVEHMSRIIGKNGDTINGLSDEFGVELDFLQKSDDPKAVETGVVELEITGNRNAIK 837
            I+ VP EH+ RIIGKNGD IN +  + GVELDFLQK+ DPKAVETG VELEITG+R AIK
Sbjct: 780  IITVPTEHVPRIIGKNGDNINDIRADCGVELDFLQKTTDPKAVETGKVELEITGSRQAIK 839

Query: 838  EASTKIAAIVSEAADHVTEKLDIDRKYHKTIVGAGGHTLREIISNAGGDEVRGRAVDIPN 897
            EA+ K+ AIV EA+D  TE  +++ KY + IVGAGG  L+ +IS AGGDE+R ++VDIP+
Sbjct: 840  EATQKVEAIVKEASDVETESFEVNPKYIRDIVGAGGRVLKSLISKAGGDEIRNKSVDIPD 899

Query: 898  ADSESSIITIQGPKKFVSNVVKAINKIVEESQNSITKKIEVPGERLGALIGPGGIVRKQL 957
            A+S+   ITIQGP  FV  +VK I  I++E ++S+ K+++VP +R+GALIGPGG+VR+QL
Sbjct: 900  ANSQDKKITIQGPHAFVQTMVKEIKLIIKEREDSVEKELDVPADRVGALIGPGGMVRRQL 959

Query: 958  ESEFNIQLYVPKRDEEETRVSLTGLPENIEKAEKKIFTEIIRDNFDLEIMVPANVQNYVS 1017
            ESEFNI+L +P   ++ ++V + GLP+NI   EKKIFT++IRD+ D E+ VPA++  +VS
Sbjct: 960  ESEFNIKLSLPDIGDKSSKVKILGLPDNIAACEKKIFTQLIRDSCDAEVQVPASLHEFVS 1019

Query: 1018 DRGNLPQRLRLEKFVNVRYGNATKKANNLNRTPVDIPYEKVAGAEGEKVKFTVEETGPSV 1077
            ++G L QRLR + FVNVR+GN+  KAN L R+ ++IP EK  G   E +KFT EE  P  
Sbjct: 1020 EKGALIQRLRSDYFVNVRFGNSNGKANKLARSNLNIPVEKATGTAEESIKFTTEEI-PLA 1078

Query: 1078 VENVDGEIPWRLIYEPIDFDSILDEENGEKKEASVDENKKQQLLKEAKEIIENRINDAPN 1137
            +E   G IPWRL YEP+D   IL EE    ++A+  E KK+++L+  +++I++RI  A  
Sbjct: 1079 IEESQGFIPWRLSYEPVDLSDILTEE----EKANEKEPKKEEVLETVEKLIKDRIELATK 1134

Query: 1138 ATYSGYVWTSDPSKFFKVVGMGGSNVKKIRESTNCIVYVPKKSDKINNVIFIKG 1191
            A+  GY+W+S  S+F KVVG  GSN+KKIRE+T  ++ VPKK+DK++++I+I+G
Sbjct: 1135 ASTVGYLWSSKSSEFRKVVGSMGSNIKKIREATGTLINVPKKNDKVSDIIYIRG 1188

>AAL177W [10] [Homologous to ScYJL080C (SCP160) - SH]
            complement(27774..31370) [3597 bp, 1198 aa]
          Length = 1198

 Score = 1033 bits (2671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/1127 (48%), Positives = 767/1127 (68%), Gaps = 22/1127 (1%)

Query: 70   KVEWGPNMKPXXXXXXXXXXXXXXXXXXXXGRMRSNNIQETFTLDLQSQLSVTKLELSRI 129
            KV+WGPNMK                       MRS  +QE F+LDLQ+Q++++K E S+ 
Sbjct: 71   KVQWGPNMK-KPESQSASPSPSPGPVGSGAKPMRSKTMQEAFSLDLQTQVTISKAEFSKF 129

Query: 130  LQTVKQANNVSVESTLSRNSRTFLISGPAPKVKEAKRELIKMLTRPITENIEVPSRCKAV 189
            + +VKQ+++VS+ESTLS+ SRTFLI+G    V  AKREL+K LTRP+T  I+VPS+  + 
Sbjct: 130  VVSVKQSHSVSIESTLSKLSRTFLITGSPTNVYNAKRELVKKLTRPVTVVIQVPSKTVSS 189

Query: 190  IIGSGGKNIREISDRYD-VKIHISKEPKPDSYNEXXXXXXXXXXXFGDFESVKQAKAKIL 248
            IIG GG+ IREI++    +KI I+K  + D+Y+             GD  SV  AK KIL
Sbjct: 190  IIGPGGRMIREITNAAGGIKIDIAKTAEADAYDADLDDQLINISLHGDVASVNFAKDKIL 249

Query: 249  SIVNEDLKNITARLSVEDSTLGSFVNVKEVS-SDDVKVQYYQDTGS--FTITGSLDDIKN 305
            SIV E+ KN T  ++VE+  L  F+++ +V  S+DV V+ + + GS    + G  D+ K 
Sbjct: 250  SIVKEETKNATISVAVENKQLIPFISLADVEISEDVTVKAFPN-GSEKIVLMGPRDEAKE 308

Query: 306  AKTKIKDYLQKLSNELAEENVKIPSKFQFLIDADEVKDRFGVIVKFPKSSSDETVQFAGL 365
            AK  +++YL  L+++++E+ + IP KFQ LIDA++V++++ V V FP +  D+TV F GL
Sbjct: 309  AKVNVQNYLNTLASKVSEKKISIPRKFQPLIDAEDVREKYKVSVIFPTALGDDTVSFYGL 368

Query: 366  KDKVAEAISFARTSSKQYIVDSLDISKAHNKNLDHAKRLVIYFQKYNVLDKVAEEFPDVK 425
               + +AI++AR SSKQYIV+SL++SKAH KN+ HAK L+ YF KY++L  + E F +VK
Sbjct: 369  SANLDDAIAYARQSSKQYIVESLEVSKAHGKNVAHAKNLMFYFAKYDILKDIKESFKEVK 428

Query: 426  YVLPSIEDLQNAKEVFIYLSAKNDKTSXXXXXXXXXXXXVNDITPAETLVIDDLDYELFH 485
             VLP+ E+L     V I + +K D               VN +TP+  L +DDLDYELFH
Sbjct: 429  LVLPTPEELPGLDNVSINIISKADIAEQTKTVRKQIINIVNRLTPSHVLAVDDLDYELFH 488

Query: 486  RNIKHILLGHESEAKFIQIGDYFKGDDSVVLFATSTDEDFKPSTDEIKESLEKVNANLND 545
            ++IK  L   ++E  F+Q+GD+++GD++V+LFA   +EDF+PS +E+KE LEKV A L++
Sbjct: 489  KDIKQAL--SKAEIPFVQLGDHYEGDNTVLLFAKVDEEDFQPSPEEVKEHLEKVAAVLDE 546

Query: 546  LRKKQNSLEVATYDLESEKQDEFFGKDSVALKLILEDISGDDGHIQIKLHSPEKNKMTLR 605
            +R KQ+ L     + ++E Q   F  DSV   L+LE+I+   GH QIKLH+P ++++T+R
Sbjct: 547  VRTKQSKLFTKIVNFDAEFQVLHFSDDSVTWNLVLENITSAGGHAQIKLHTPSEDEITIR 606

Query: 606  GDERAVKKANKDIKSIVENPSTTAKITVEVPVASVSRLIGNKGANLQKLRNKYNCSIDIP 665
            GDE+AVK A K  +SI ENPS  +K+TV VP  +VSRLIG KG NL ++R K++  ID+P
Sbjct: 607  GDEKAVKAAVKAFESIAENPSKKSKLTVSVPANTVSRLIGPKGTNLAQIRQKFDVQIDVP 666

Query: 666  QQGESDQDKTVEITIKGLQFIIEHAKKDIANEAKRLADIVTKELVAQAKYHRNLSGPQGM 725
             +     D   EIT+ GL++ ++HAK  IA+EAK+ ADI TKEL+   KYH +L G QG 
Sbjct: 667  SES---NDTNTEITLTGLEYNLQHAKTHIASEAKKWADITTKELIVPTKYHGSLIGSQGT 723

Query: 726  YRTRLQEKYNVFINFLKENNTITIKGPSRGVNKAYDELKALLDFEMENGHKTIVNVPVEH 785
            YR RL+ KY+V I F KE   +TIKGPSRGVNKA+ ELKALLDFE+ENGHK+++NVPVEH
Sbjct: 724  YRIRLENKYSVRIQFPKEGEVVTIKGPSRGVNKAHAELKALLDFEIENGHKSVINVPVEH 783

Query: 786  MSRIIGKNGDTINGLSDEFGVELDFLQKSDDPKAVETGVVELEITGNRNAIKEASTKIAA 845
            + R+IGKNGD ING+  E GVEL  LQ +   K      V+LEITG+R AIKEAS  + A
Sbjct: 784  VPRVIGKNGDVINGIRAELGVELKLLQNTKTAKEQNLDTVQLEITGSRQAIKEASKAVDA 843

Query: 846  IVSEAADHVTEKLDIDRKYHKTIVGAGGHTLREIISNAGGDEVRGRAVDIPNADSESSII 905
            I++EA+D  T++L+ID KYHK IVG GG TL++ IS AGGD++R + VD+PNA+S + +I
Sbjct: 844  IIAEASDFTTKQLEIDAKYHKLIVGPGGSTLKDFISKAGGDDIRNKTVDVPNAESTNKVI 903

Query: 906  TIQGPKKFVSNVVKAINKIVEESQNSITKKIEVPGERLGALIGPGGIVRKQLESEFNIQL 965
            TI GPK FV  + KA+N+IV++ + S+ K++ +P +R GALIGPGG VR+QLES+FN+++
Sbjct: 904  TISGPKTFVEKMSKALNQIVQDIKASVAKELNIPADRQGALIGPGGSVRRQLESQFNVRI 963

Query: 966  YVPKRDEEETRVSLTGLPENIEKAEKKIFTEIIRDNFDLEIMVPANVQNYVSDRGNLPQR 1025
             VP +  +E +V++ G PE +EK EK+IF+ IIRD++D EIMVPA    +VS+RG L  +
Sbjct: 964  EVPDKG-KEGKVTIHGRPEAVEKCEKEIFSTIIRDSYDQEIMVPAVYHAFVSERGQLINK 1022

Query: 1026 LRLEKFVNVRYGNATKKANNLNRTPVDIPYEKVAGAEGEKVKFTVEE-TGPSVVENVDGE 1084
            LR+  F+NV++GN++KKAN L+R+   IP E+V G+EGE  K T+EE + P    N    
Sbjct: 1023 LRMTYFINVKHGNSSKKANKLSRSEQPIPIERVRGSEGEGTKLTIEEVSAPEASAN--DN 1080

Query: 1085 IPWRLIYEPIDFDSILDEENGEKKEASVDENKKQQLLKEAKEIIENRINDAPNATYSGYV 1144
            IPWRL YE +D   IL EE    K A      K+Q L+ A + I+ RI  AP A   GY+
Sbjct: 1081 IPWRLTYEHVDLSDILGEEG---KHAMT----KEQALEAAADQIKERIELAPKANCIGYL 1133

Query: 1145 WTSDPSKFFKVVGMGGSNVKKIRESTNCIVYVPKKSDKINNVIFIKG 1191
            W  +  KF KVVG GGSN+K+IRE+TN ++ VPKKSDK++++I+++G
Sbjct: 1134 WCENVKKFNKVVGPGGSNIKQIRETTNTLINVPKKSDKVSDIIYVRG 1180

>KLLA0D02398g complement(202446..206063) similar to sp|P06105
            Saccharomyces cerevisiae YJL080c SCP160 required for
            maintenance of exact ploidy singleton, start by
            similarity
          Length = 1205

 Score =  972 bits (2514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/1097 (47%), Positives = 721/1097 (65%), Gaps = 22/1097 (2%)

Query: 102  MRSNNIQETFTLDLQSQLSVTKLELSRILQTVKQANNVSVESTLSRNSRTFLISGPAPKV 161
            +RS NIQE F+LDL +Q  +TK E S I+Q+VKQ  +VSVESTLS+ SRTFLISG + K+
Sbjct: 107  LRSRNIQEVFSLDLDAQYQITKTEFSSIVQSVKQKYDVSVESTLSKTSRTFLISGSSDKI 166

Query: 162  KEAKRELIKMLTRPITENIEVPSRCKAVIIGSGGKNIREISDRYDVKIHISKEPKPDSYN 221
              AKREL+K LT+P+    EVPS+ ++ IIGSGGK IR ISD   VKI + KE    +Y+
Sbjct: 167  GLAKRELVKKLTKPVNVTFEVPSKTRSAIIGSGGKTIRAISDAAGVKIVVPKEVDEGTYD 226

Query: 222  EXXXXXXXXXXXFGDFESVKQAKAKILSIVNEDLKNITARLSVEDSTLGSFVNVKEVS-S 280
                         GD ESV  AK+KIL +V E+ KN    L VEDS L  F++++ V   
Sbjct: 227  SDLEDYSVTISLHGDAESVLVAKSKILDVVKEETKNAKIVLPVEDSKLVPFIDLESVEIP 286

Query: 281  DDVKVQYY--QDTGSFTITGSLDDIKNAKTKIKDYLQKLSNELAEENVKIPSKFQFLIDA 338
             DVK Q +   D     + G  D++K AK K+ +YL +L  ++  +  K+P KF  L+  
Sbjct: 287  ADVKAQLFTNNDPAEIALNGPRDNVKLAKVKVINYLNELGLKIVVKKEKVPFKFHPLVKP 346

Query: 339  DEVKDRFGVIVKFPKSSSDETVQFAGLKDKVAEAISFARTSSKQYIVDSLDISKAHNKNL 398
             E+ ++F V V+ P  S D+   F G  D V EAI +A+ SSK + V+SL+ISKAH KN+
Sbjct: 347  SELNEKFHVEVQAPSISGDDQFVFIGSSDNVNEAIVYAKNSSKFHTVESLEISKAHGKNV 406

Query: 399  DHAKRLVIYFQKYNVLDKVAEEFPDVKYVLPSIEDLQNAKEVFIYLSAKNDKTSXXXXXX 458
             HAK L++YFQKYNVLD++ E+FP V+ VLP +E +   + V I L + ND         
Sbjct: 407  KHAKNLILYFQKYNVLDQITEDFPQVQVVLPKVESIPALESVSITLISNNDAADAIKTVR 466

Query: 459  XXXXXXVNDITPAETLVIDDLDYELFHRNIKHILLGHESEAKFIQIGDYFKGDDSVVLFA 518
                  VN+++P +TL I DLDY LFH++IK IL+  ES+  FIQ+GD F G+D ++L  
Sbjct: 467  KQIVALVNELSPEQTLTISDLDYHLFHKDIKQILVSTESDVPFIQLGDCFPGNDDILLIT 526

Query: 519  TSTDEDFKPSTDEIKESLEKVNANLNDLRKKQNSLEVATYDLESEKQDEFFGKDSVALKL 578
               ++DFKPS DE+K  LE VN  L  +RKKQ+ L      L  ++QDE  G+  V L L
Sbjct: 527  KINEDDFKPSDDELKVKLESVNQQLEPIRKKQSLLASNVVSLAKKEQDELLGESKVTLNL 586

Query: 579  ILEDISGDDGHIQIKLHSPEKNKMTLRGDERAVKKANKDIKSIVENPSTTAKITVEVPVA 638
            I E +S    H  IKL +P  N++T+RGD+   K A+  +KSIVEN ST +KIT +VP  
Sbjct: 587  INEAVSHAGAHALIKLSTPSVNQITIRGDDHGCKIASAAVKSIVENSSTESKITFQVPTN 646

Query: 639  SVSRLIGNKGANLQKLRNKYNCSIDIPQQGESDQDKTVEITIKGLQFIIEHAKKDIANEA 698
             VSRLIG KGANLQ++R K++    IPQ     +D+  ++T+ GLQ+ ++ AK  I  EA
Sbjct: 647  VVSRLIGPKGANLQQIREKFDVQTFIPQDS---KDENTDVTLTGLQYNLDQAKTYILAEA 703

Query: 699  KRLADIVTKELVAQAKYHRNLSGPQGMYRTRLQEKYNVFINFLKENNTITIKGPSRGVNK 758
            K+ +DI+TKEL+   KYHR LSGPQG YR RL+ KY+VFI F K++  +TI+GPSRGV  
Sbjct: 704  KKWSDIITKELIVPMKYHRTLSGPQGTYRIRLENKYSVFIRFPKDSELVTIRGPSRGVKA 763

Query: 759  AYDELKALLDFEMENGHKTIVNVPVEHMSRIIGKNGDTINGLSDEFGVELDFLQKSDDPK 818
            AYDELKALLDFE+ENGHK ++ VPV++++R+IGK+G+TIN +  E+GVEL+FL K+D  K
Sbjct: 764  AYDELKALLDFEIENGHKELLKVPVDYVTRVIGKSGETINDIKAEYGVELNFLDKTDSEK 823

Query: 819  AVETGVVELEITGNRNAIKEASTKIAAIVSEAADHVTEKL-DIDRKYHKTIVGAGGHTLR 877
            A E G VELEITG+R++IKEA+ K+ +I+ +A++  T  L DID KY+  I+G  G  L+
Sbjct: 824  AKEAGEVELEITGSRSSIKEAANKVKSIIDQASNFETVTLEDIDSKYYSDIIGRSGSQLK 883

Query: 878  EIISNAGGDEVRGRAVDIPNADSESSIITIQGPKKFVSNVVKAINKIVEESQNSITKKIE 937
            EIIS AGGDE+R + V+IP+A SE  +ITI GP  FV  VVK I  +V   +NSIT+++ 
Sbjct: 884  EIISKAGGDEIRNKRVNIPDASSEDKVITIFGPSDFVKKVVKQIKGVVSGLENSITEELN 943

Query: 938  VPGERLGALIGPGGIVRKQLESEFNIQLYVPKRDEEETRVSLTGLPENIEKAEKKIFTEI 997
            +P E+ GALIGP G VR++LE+EF ++++VP ++  + +V+++G P NIE  +KKI  EI
Sbjct: 944  IPQEKFGALIGPAGSVRRELETEFKVRIHVPNKNSSDEKVTVSGSPANIESCKKKIEKEI 1003

Query: 998  IRDNFDLEIMVPANVQNYVSDRGNLPQRLRLEKFVNVRYGNATKKANNLNRTPVDIPYEK 1057
            IRD+FDLEI VPA   +YVS+ G + Q LR E  ++V +GN T+ A +L+R    +P E 
Sbjct: 1004 IRDSFDLEIAVPAKYHSYVSNSGLIFQTLRNEFSIDVSHGNLTRTAQSLSRANYKVP-EN 1062

Query: 1058 VAGAEGEKVKFTVEETGPSVVEN---VDGEIPWRLIYEPIDFDSILDEENGEKKEASVDE 1114
            VAG E E     ++    SV E    VD  IPWRL Y PID   +L E+  +      DE
Sbjct: 1063 VAGGENESSNVLIQ----SVTETEAKVD-TIPWRLTYSPIDLSDVLGEDYKK------DE 1111

Query: 1115 NKKQQLLKEAKEIIENRINDAPNATYSGYVWTSDPSKFFKVVGMGGSNVKKIRESTNCIV 1174
              K Q+L++A ++IE+RI +A      G+VW+ D  KF  +VG  G N+++IR +T  ++
Sbjct: 1112 ESKDQVLEKASKLIEDRIAEAKLVNTEGFVWSKDAKKFNSIVGPNGRNIREIRNATKTVI 1171

Query: 1175 YVPKKSDKINNVIFIKG 1191
            +VP+KSDK+NNVI++ G
Sbjct: 1172 HVPRKSDKVNNVIYVLG 1188

>YBL032W (HEK2) [162] chr2 (160149..161294) Protein with four KH
           RNA-binding domains that is required for ASH1 mRNA
           localization to the bud tip, has similarity to mouse
           hnRNP X protein [1146 bp, 381 aa]
          Length = 381

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 84/198 (42%), Gaps = 41/198 (20%)

Query: 627 TTAKITVE----VPVASVSRLIGNKGANLQKLRNKYNCSIDIPQQGESDQDKTVEITIKG 682
           TTA+ T+     + +   +++IG KG+ + ++R      I I ++     D+        
Sbjct: 38  TTAQPTINHRLLLSLKEAAKIIGTKGSTISRIRAANAVKIGISEKVPGCSDR-------- 89

Query: 683 LQFIIEHAKKDIANEAKRLADIVTKELVAQAKYHRNLSGPQGMYRTRLQEKYNVFINFLK 742
               I     ++ N A  + DIV            N   P+       + + + + +FL 
Sbjct: 90  ----ILSCAGNVINVANAIGDIVDV---------LNKRNPENEDAAEGEAEEHYYFHFLN 136

Query: 743 ENNTITIKGPSRGVNKAYDELKALLDFEMENGHKTIVNVPVEHMSRIIGKNGDTINGLSD 802
                 +  PS+      DE++ L   E + G+  ++ V   H+S IIGK G TI  L +
Sbjct: 137 H----ILPAPSK------DEIRDLQQLE-DIGYVRLI-VANSHISSIIGKAGATIKSLIN 184

Query: 803 EFGVEL----DFLQKSDD 816
           + GV++    DFL  SD+
Sbjct: 185 KHGVKIVASKDFLPASDE 202

>AER186C [2688] [Homologous to ScYBL032W (HEK2) - SH]
           (982057..983007) [951 bp, 316 aa]
          Length = 316

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 44/220 (20%), Positives = 90/220 (40%), Gaps = 63/220 (28%)

Query: 787 SRIIGKNGDTINGLSDEFGVELDFLQKSDDPKAVETGVVELEITGNRNAIKEASTKIAAI 846
           +RI+G+ G+TI+ +    GV++    K    K+    +  LE+TG+ +A+  +   +  +
Sbjct: 45  ARILGRGGNTIDNIRKANGVKIGISTKE---KSCSDRL--LEVTGSIDAVANSLADVVKV 99

Query: 847 VS-----------EAADHVTEKLD--------------------------IDRKYHKTIV 869
           ++           E   H+ + L+                          +      +I+
Sbjct: 100 LTADDTNEEDAEPEPEQHIFKHLNFILPPPSPDEAEDPMKVKQIGNLRLIVTNSQVSSII 159

Query: 870 GAGGHTLREIISNAGGDEVRGRAVDIPNADSESSIITIQGPKKFVSNVVKAINKIV---- 925
           G  G  ++++I       V  +   +P  DS+  I+ IQG    ++N +K I++ +    
Sbjct: 160 GTAGSKIKKLIDTHSSKLVVSKTF-LP--DSQDRILEIQGFPNSIANCIKDISQTLIKDD 216

Query: 926 ----------EESQNS----ITKKIEVPGERLGALIGPGG 951
                       S++S    +T  + +P E +GAL+G GG
Sbjct: 217 VLDTKEKRYYPHSKHSKDIHVTATVAIPAEYVGALLGHGG 256

>CAGL0G04037g 383068..385404 similar to tr|Q07834 Saccharomyces
           cerevisiae YLL032c, hypothetical start
          Length = 778

 Score = 35.0 bits (79), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 65/160 (40%), Gaps = 34/160 (21%)

Query: 715 YHRNLSGPQGMYRTRLQEKYNVFI-------------NFLKENNTITIKGP---SRGVNK 758
           YHR   G  G        K+NVFI             +F++ +N I I+ P    +G++ 
Sbjct: 462 YHRPAIGSGGSIIQTTMRKHNVFIQFSNTFLLPQSGLSFVRFDNVI-IRCPFKNRKGIDL 520

Query: 759 AYDELKALLDFEMENGHKTIVNVPVEHMSRIIGKNGDTINGLSDEFGVELDFLQKSDDPK 818
           A ++LK L+    E    T + +       ++ ++ +TI  L  +  V LDF      P+
Sbjct: 521 AIEDLKVLIQEYSEQQPSTNIRLSPAQYKHVLFEHINTIGHLEKQNNVFLDF------PQ 574

Query: 819 AVETGVVELEITGNRNAIKEASTKIAAIVSEAADHVTEKL 858
            +    V + I GN  +             + AD VT +L
Sbjct: 575 NIPKTTVNISIRGNDTS-----------SIQCADEVTNRL 603

>Kwal_27.12486
          Length = 299

 Score = 33.5 bits (75), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 62/265 (23%), Positives = 108/265 (40%), Gaps = 62/265 (23%)

Query: 633 VEVPVASVSRLIGNKGANLQKLRNKYNCSIDIP--QQGESDQ---------------DKT 675
           V V +   +R+IG +G  +QK+R   N  I I   ++G SD+                  
Sbjct: 14  VLVSLKEAARIIGAQGMTIQKIRESSNVKIGISPHERGCSDRILSCSGSAQAVANAIGDV 73

Query: 676 VEI-----------TIKGLQFIIEHAKK-DIAN--EAKRLADIVTKELVAQAKYHRNLSG 721
           VE+           + K L FI+    + +I +   AKR+ ++    L+       ++ G
Sbjct: 74  VEVLNQDESEPETHSYKPLNFILPRPSEVEIQDPESAKRIGNL---RLIVSNSQVSSIIG 130

Query: 722 PQGMYRTRLQEKYNVFI----NFL--KENNTITIKGPSRGVNKAYDELKALLDFEMENGH 775
            QG     L EK+ V +    NFL   ++  + I+G    +     E+  LL  E +  H
Sbjct: 131 TQGSRIKALIEKHGVKVVASKNFLPDSQDRVVEIQGFPGSIASCIIEISELLATETKPSH 190

Query: 776 KTI----------------VNVPVEHMSRIIGKNGDTINGLSDEFGVELDFLQKSDDPKA 819
           +                  V +PVE +  ++G+ G+ ++ L      ++     SD+P  
Sbjct: 191 EKQYYPHTKSQEEGSVTKEVAIPVEFVGALLGRGGNRVSSLRKYTKTKVIV---SDEPNE 247

Query: 820 VETGVVELEITG-NRNAIKEASTKI 843
               V    ITG N+N++K A T +
Sbjct: 248 ENNRV--FTITGNNQNSVKLAETML 270

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 51/112 (45%), Gaps = 20/112 (17%)

Query: 857 KLDIDRKYHKTIVGAGGHTLREIISNAGGDEVRGRAVDIPNADSESSIITIQG-PKKFVS 915
           +L +      +I+G  G  ++ +I   G   V  +   +P  DS+  ++ IQG P    S
Sbjct: 117 RLIVSNSQVSSIIGTQGSRIKALIEKHGVKVVASKNF-LP--DSQDRVVEIQGFPGSIAS 173

Query: 916 NVVKAINKIVEES----------------QNSITKKIEVPGERLGALIGPGG 951
            +++    +  E+                + S+TK++ +P E +GAL+G GG
Sbjct: 174 CIIEISELLATETKPSHEKQYYPHTKSQEEGSVTKEVAIPVEFVGALLGRGG 225

>YLL032C (YLL032C) [3388] chr12 complement(74269..76746) Protein
           containing a KH domain, which may bind RNA [2478 bp, 825
           aa]
          Length = 825

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 2/60 (3%)

Query: 153 LISGPAPKVKEAKRELIKMLTRPITENIEVPSRCKAVIIGSGGKNIREISDRYDVKIHIS 212
           L+S   P  KE+ + +I     P  E+  +P  C   IIG+GG  I+    +++V I  S
Sbjct: 462 LVSDSFPDFKESFKNVINEF--PAEESFFIPEVCHRPIIGTGGSLIQATMRKHNVFIQFS 519

>Scas_667.6
          Length = 378

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 23/38 (60%)

Query: 182 VPSRCKAVIIGSGGKNIREISDRYDVKIHISKEPKPDS 219
           VP+R  + IIG GG  I+ + + Y VKI  SK   PDS
Sbjct: 163 VPNRHLSSIIGKGGVRIKALIETYGVKIVASKHFLPDS 200

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 84/204 (41%), Gaps = 49/204 (24%)

Query: 626 STTAKITVEVPVASVSRLIGNKGANLQKLRNKYNCSIDIPQQGESDQDKTVEITIKGLQF 685
           S T  + V + +   +++IG KG+ + K+R  +   I I ++     D+ +         
Sbjct: 15  SPTIVLRVLLSLKEAAKIIGLKGSTISKIRETHGVKIGISEKVTGCSDRILS-------- 66

Query: 686 IIEHAKKDIANEAKRLADIVTKELVAQAKY--HRNLSGPQGMYRTRLQEKYNV-FINFLK 742
                   I N A  L+D V  +++ +  Y    NL  P         EKYN  F+N L 
Sbjct: 67  ----CAGPIINVANALSDCV--DILNEKDYDAEGNLLPPLKF------EKYNFHFLNHL- 113

Query: 743 ENNTITIKGPSRG---------------VNKAYDELKALLDFEM---ENGHKTIVNVPVE 784
                 +  PSR                  K  D  +A L+ ++   + G+  ++ VP  
Sbjct: 114 ------LPPPSRNEVLEEENGEEENDDGETKKQDANEANLEDQVPVDKIGNLRLI-VPNR 166

Query: 785 HMSRIIGKNGDTINGLSDEFGVEL 808
           H+S IIGK G  I  L + +GV++
Sbjct: 167 HLSSIIGKGGVRIKALIETYGVKI 190

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 39/76 (51%), Gaps = 4/76 (5%)

Query: 935  KIEVPGERLGALIGPGGIVRKQLESEFNIQLYVPKR---DEEETRVSLTGLPENIEKAEK 991
            ++ VP   L ++IG GG+  K L   + +++   K    D  E  + + G P +I K   
Sbjct: 160  RLIVPNRHLSSIIGKGGVRIKALIETYGVKIVASKHFLPDSSERVLEIQGFPASISKVLI 219

Query: 992  KIFTEIIRDNFDLEIM 1007
            +I +EI+ ++ D+  +
Sbjct: 220  EI-SEILLNDVDINFI 234

>KLLA0E00847g complement(87991..90132) some similarities with
           sgd|S0003955 Saccharomyces cerevisiae YLL032c,
           hypothetical start
          Length = 713

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 30/142 (21%), Positives = 56/142 (39%), Gaps = 8/142 (5%)

Query: 599 KNKMTLRGDERAVKKANKDIKSIVENPSTTAKITVEVPVASVSRLIGNKGANLQKLRNKY 658
           KN     G   ++++   DI +         + T+E+       + G K   L K+ ++ 
Sbjct: 349 KNFFNFVGCHASIQQTYLDILAEDFQCVQNVRFTLELDTIYKDFISGKKNGKLMKIMDRK 408

Query: 659 NCSIDIPQQGESDQDKTVEITIKGLQFIIEHAKKDIANEAKRLADIVTKELVAQAKYHRN 718
            C+I +    E+D    + + ++G  +  +  +   +   + L     K       YHR 
Sbjct: 409 KCAISL----ENDSSGHMLVILQGEDW--QQIQDSFSLLLQELP--CEKSFFIPEAYHRP 460

Query: 719 LSGPQGMYRTRLQEKYNVFINF 740
           + G  G     +  KYNVFI F
Sbjct: 461 VIGTGGSVIQTIMRKYNVFIQF 482

>Scas_515.6
          Length = 342

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 47/98 (47%), Gaps = 13/98 (13%)

Query: 615 NKDIKSIVENPSTTAKI------TVEVPVASVSRLIGNKGANLQKLRNKYNCSIDIPQQG 668
           N +I+SI   PS +  +       V  P    S++IG +G  +  LR   +CSI +  + 
Sbjct: 248 NLEIQSI--EPSKSGNLLSNITKVVTYPDKYSSKVIGREGTYINMLRESTSCSIRL--KS 303

Query: 669 ESDQDKTVEITIKGLQFIIEHAKKDIANE---AKRLAD 703
             D++    I+I+G    ++ A   IA+    +KRL D
Sbjct: 304 PDDKEDLAIISIRGPPLCVDAALLLIAHRIELSKRLLD 341

>YGR167W (CLC1) [2119] chr7 (832459..833160) Clathrin light chain,
           involved in the internalization step of endocytosis [702
           bp, 233 aa]
          Length = 233

 Score = 30.4 bits (67), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 28/46 (60%), Gaps = 2/46 (4%)

Query: 547 RKKQNSLEVATYDLES--EKQDEFFGKDSVALKLILEDISGDDGHI 590
           +KK+  LE A  + E+  +K+DEFFG+D+      L+ I+ DD  I
Sbjct: 163 KKKEQQLEDAAKEAEAFLKKRDEFFGQDNTTWDRALQLINQDDADI 208

>CAGL0F00693g 79324..80691 highly similar to sp|P54885 Saccharomyces
           cerevisiae YOR323c PRO2 gamma-glutamyl phosphate
           reductase, start by similarity
          Length = 455

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 24/43 (55%)

Query: 886 DEVRGRAVDIPNADSESSIITIQGPKKFVSNVVKAINKIVEES 928
           D+++ + VD  + D +   +++    KF+ N V AIN I E S
Sbjct: 310 DDIKAKIVDAKDGDFDKEFLSLDCAVKFIPNTVDAINHINEHS 352

>Kwal_55.20652
          Length = 694

 Score = 30.8 bits (68), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 32/69 (46%), Gaps = 15/69 (21%)

Query: 715 YHRNLSGPQGMYRTRLQEKYNVFINF------------LKENNTITIKGPS---RGVNKA 759
           YHR + G  G     +  ++NVFI F            L  +N + I+ PS   + +++A
Sbjct: 454 YHRPVIGTGGSVIQTIMRRFNVFIQFSNTFQLPQNDFGLTRHNNVVIRCPSKNRKSISQA 513

Query: 760 YDELKALLD 768
             EL  L++
Sbjct: 514 KKELMRLVN 522

>Scas_718.23
          Length = 364

 Score = 30.4 bits (67), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 76/184 (41%), Gaps = 31/184 (16%)

Query: 849  EAADHV-TEKLDIDRKYHKTIVGAGGHTLREIISNAGGDEVRGRAVDIPNADSESSIITI 907
            E  DHV + +L +      TI+G    T ++I  +   ++VR  A      DS   I+ I
Sbjct: 150  ETLDHVRSVRLILSNVKISTIIGKQAATFKKICHD---NDVRMVATRNFLPDSRERILEI 206

Query: 908  QGPKKFVSNVVKAINKIVEESQNSITKKIE-------------------------VPGER 942
            Q   + +   V  I +I+ ++ N+  +  E                         VP   
Sbjct: 207  QSDPEHIKKAVLDILEIITDNSNTALELNERIYTPHVGRAPNASHSNQQYQAVVMVPEYL 266

Query: 943  LGALIGPGGIVRKQLESEFNIQLYVPKRDEEETRVSLTGLPENIEKAEKKIFTEIIRDNF 1002
            +GA++G GG     L       + + K +E+ET+   T L  N+EK  K   T ++R N 
Sbjct: 267  VGAMMGHGGSRIANLRKFTKTSVKIEKNEEDETKRKFTIL-GNVEKNVKSAETMMMR-NL 324

Query: 1003 DLEI 1006
            D EI
Sbjct: 325  DAEI 328

>Kwal_14.1151
          Length = 594

 Score = 30.4 bits (67), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 779 VNVPVEHMSRIIGKNGDT--INGLSDEFGVELDFLQKSDDPKAVETGVVELEITGNR 833
           V+VP +H   ++GKN  +   + L  EFG+ELD     +  K  E   +++EI  NR
Sbjct: 4   VSVPKKHFFELLGKNYSSQEFDELCFEFGIELDEDTTEEALKNNEEPELKIEIGANR 60

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.131    0.356 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 37,478,305
Number of extensions: 1719549
Number of successful extensions: 6442
Number of sequences better than 10.0: 102
Number of HSP's gapped: 6447
Number of HSP's successfully gapped: 122
Length of query: 1191
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1078
Effective length of database: 12,684,275
Effective search space: 13673648450
Effective search space used: 13673648450
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)