Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M02695g29729311601e-161
Kwal_26.865336429311131e-153
Scas_700.4229729310861e-150
Sklu_2406.429729310841e-150
KLLA0D06941g29729310691e-148
YPL131W (RPL5)29726110621e-146
ACR104C29728610571e-146
YLR454W262845681.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M02695g
         (293 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M02695g 308170..309063 highly similar to sp|P26321 Saccharo...   451   e-161
Kwal_26.8653                                                          433   e-153
Scas_700.42                                                           422   e-150
Sklu_2406.4 YPL131W, Contig c2406 3367-4260                           422   e-150
KLLA0D06941g complement(598560..599453) highly similar to sp|P26...   416   e-148
YPL131W (RPL5) [5314] chr16 (303120..304013) Ribosomal protein L...   413   e-146
ACR104C [1151] [Homologous to ScYPL131W (RPL5) - SH] (541333..54...   411   e-146
YLR454W (YLR454W) [3828] chr12 (1043995..1051881) Protein of unk...    31   1.5  

>CAGL0M02695g 308170..309063 highly similar to sp|P26321
           Saccharomyces cerevisiae YPL131w RPL1, start by
           similarity
          Length = 297

 Score =  451 bits (1160), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 227/293 (77%), Positives = 227/293 (77%)

Query: 1   MVFIQNLKTSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 60
           MVFIQNLKTSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI
Sbjct: 1   MVFIQNLKTSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 60

Query: 61  ICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRALQKLGLDXXXX 120
           ICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRALQKLGLD    
Sbjct: 61  ICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRALQKLGLDETYK 120

Query: 121 XXXXXXXXXXXXXXXXDGPRPFKVYLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF 180
                           DGPRPFKVYLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF
Sbjct: 121 GVEEVEGEYELTEAVEDGPRPFKVYLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF 180

Query: 181 PGWDFXXXXXXXXXXRSYIFGGHVSQYMEELADDDEERFSELFKGYLXXXXXXXXXXXXX 240
           PGWDF          RSYIFGGHVSQYMEELADDDEERFSELFKGYL             
Sbjct: 181 PGWDFEAEELDAELLRSYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSIEDIY 240

Query: 241 XXXHEAIRADPSFKPTEKKFTXXXXXXXXXXXXXXXXXXXXRDARVAAKIAAL 293
              HEAIRADPSFKPTEKKFT                    RDARVAAKIAAL
Sbjct: 241 ASAHEAIRADPSFKPTEKKFTKEQYAAESKKYKAKKLTKEERDARVAAKIAAL 293

>Kwal_26.8653
          Length = 364

 Score =  433 bits (1113), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 214/293 (73%), Positives = 223/293 (76%)

Query: 1   MVFIQNLKTSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 60
           MVF++ +K+SAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI
Sbjct: 70  MVFLKEVKSSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 129

Query: 61  ICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRALQKLGLDXXXX 120
           ICQIVSSTITGD+VLAAAYSHELPRYGITHGLTNW+AAYATGLLIARRALQKLGLD    
Sbjct: 130 ICQIVSSTITGDVVLAAAYSHELPRYGITHGLTNWSAAYATGLLIARRALQKLGLDETYQ 189

Query: 121 XXXXXXXXXXXXXXXXDGPRPFKVYLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF 180
                           DGPRPFKV+LDIGLQRTTTGARVFGALKGASDGGLYVPHSE+RF
Sbjct: 190 GVEEVEGEYQLTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYVPHSESRF 249

Query: 181 PGWDFXXXXXXXXXXRSYIFGGHVSQYMEELADDDEERFSELFKGYLXXXXXXXXXXXXX 240
           PGWDF          R+YIFGGHVSQYMEELADDDEERF ELFKGYL             
Sbjct: 250 PGWDFEAEELDADTLRTYIFGGHVSQYMEELADDDEERFKELFKGYLADDIDADAVEDIY 309

Query: 241 XXXHEAIRADPSFKPTEKKFTXXXXXXXXXXXXXXXXXXXXRDARVAAKIAAL 293
              HE IRADPSFKPTEKKFT                    R ARVAAKIAAL
Sbjct: 310 MEAHEKIRADPSFKPTEKKFTKEQYAAESKKYRQTKLSREERKARVAAKIAAL 362

>Scas_700.42
          Length = 297

 Score =  422 bits (1086), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 213/293 (72%), Positives = 218/293 (74%)

Query: 1   MVFIQNLKTSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 60
           M F  N K SAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI
Sbjct: 1   MTFNINQKNSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 60

Query: 61  ICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRALQKLGLDXXXX 120
           ICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNW+AAYATGLLIARRALQKLGLD    
Sbjct: 61  ICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWSAAYATGLLIARRALQKLGLDETYK 120

Query: 121 XXXXXXXXXXXXXXXXDGPRPFKVYLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF 180
                           DGPRPFKV+LDIGLQRTTTGARVFGALKGASDGGLY+PHSENRF
Sbjct: 121 GVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYIPHSENRF 180

Query: 181 PGWDFXXXXXXXXXXRSYIFGGHVSQYMEELADDDEERFSELFKGYLXXXXXXXXXXXXX 240
           PGWDF          R+YIFGGHVSQYMEELADDDEERFSELFKGYL             
Sbjct: 181 PGWDFEAEELDPDLLRTYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIY 240

Query: 241 XXXHEAIRADPSFKPTEKKFTXXXXXXXXXXXXXXXXXXXXRDARVAAKIAAL 293
              H AIRADP+FK TEKKFT                    R ARV AKIAAL
Sbjct: 241 TEAHAAIRADPAFKATEKKFTKEQYAAESKKFRQIKLTREERKARVEAKIAAL 293

>Sklu_2406.4 YPL131W, Contig c2406 3367-4260
          Length = 297

 Score =  422 bits (1084), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 213/293 (72%), Positives = 217/293 (74%)

Query: 1   MVFIQNLKTSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 60
           M F  N+KTSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI
Sbjct: 1   MGFQLNVKTSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 60

Query: 61  ICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRALQKLGLDXXXX 120
           ICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARR LQKLGLD    
Sbjct: 61  ICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRTLQKLGLDETYK 120

Query: 121 XXXXXXXXXXXXXXXXDGPRPFKVYLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF 180
                           DGPRPFKV+LDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF
Sbjct: 121 GVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF 180

Query: 181 PGWDFXXXXXXXXXXRSYIFGGHVSQYMEELADDDEERFSELFKGYLXXXXXXXXXXXXX 240
           PGWDF          R+YIF GHVSQYMEELADDDEERF ELFKGYL             
Sbjct: 181 PGWDFEAEELDPDMLRTYIFAGHVSQYMEELADDDEERFRELFKGYLADDIDADAIEDIY 240

Query: 241 XXXHEAIRADPSFKPTEKKFTXXXXXXXXXXXXXXXXXXXXRDARVAAKIAAL 293
              HEAIR DP+FK TEKKFT                    R ARVAAKI AL
Sbjct: 241 LEAHEAIREDPAFKATEKKFTKEQYAAESKKYKQYKLTKEERKARVAAKITAL 293

>KLLA0D06941g complement(598560..599453) highly similar to sp|P26321
           Saccharomyces cerevisiae YPL131w RPL1 60S large subunit
           ribosomal protein L5.e singleton, start by similarity
          Length = 297

 Score =  416 bits (1069), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 206/293 (70%), Positives = 219/293 (74%)

Query: 1   MVFIQNLKTSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 60
           M FI+++KTSAYHSR+QTPFRRRREGKTDYY RKRLVAQHKAKYN+PKYRLVVRFTNKDI
Sbjct: 1   MAFIKDIKTSAYHSRYQTPFRRRREGKTDYYARKRLVAQHKAKYNTPKYRLVVRFTNKDI 60

Query: 61  ICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRALQKLGLDXXXX 120
           I QIVSSTITGDIVLAAAYSHELPRYGITHGLTNW+AAYATGLL+ARR LQKLGLD    
Sbjct: 61  ITQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWSAAYATGLLLARRTLQKLGLDETYP 120

Query: 121 XXXXXXXXXXXXXXXXDGPRPFKVYLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF 180
                           DGPRPFKVYLD+GLQRTTTGAR+FGALKGASDGGLYVPHSENRF
Sbjct: 121 GVEEVEGEYELTEAVEDGPRPFKVYLDVGLQRTTTGARIFGALKGASDGGLYVPHSENRF 180

Query: 181 PGWDFXXXXXXXXXXRSYIFGGHVSQYMEELADDDEERFSELFKGYLXXXXXXXXXXXXX 240
           PGWDF          R+YIFGGHVSQYMEELADDDEER+ ELFKGYL             
Sbjct: 181 PGWDFEAEELDADLLRTYIFGGHVSQYMEELADDDEERYRELFKGYLADDIDADAVEDIY 240

Query: 241 XXXHEAIRADPSFKPTEKKFTXXXXXXXXXXXXXXXXXXXXRDARVAAKIAAL 293
              H AIR DP+FKPTEKKFT                    R ARVAAKI+AL
Sbjct: 241 ADAHAAIREDPAFKPTEKKFTKEQYAAESKKYRQVKLTREERKARVAAKISAL 293

>YPL131W (RPL5) [5314] chr16 (303120..304013) Ribosomal protein L5
           (yeast L1; YL3; rat L5), the sole 5S rRNA-associated
           ribosomal protein, involved in the binding of
           peptidyl-tRNA to the ribosome [894 bp, 297 aa]
          Length = 297

 Score =  413 bits (1062), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 201/261 (77%), Positives = 209/261 (80%)

Query: 1   MVFIQNLKTSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 60
           M F ++ K+SAY SRFQTPFRRRREGKTDYYQRKRLV QHKAKYN+PKYRLVVRFTNKDI
Sbjct: 1   MAFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVVRFTNKDI 60

Query: 61  ICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRALQKLGLDXXXX 120
           ICQI+SSTITGD+VLAAAYSHELPRYGITHGLTNWAAAYATGLLIARR LQKLGLD    
Sbjct: 61  ICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRTLQKLGLDETYK 120

Query: 121 XXXXXXXXXXXXXXXXDGPRPFKVYLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF 180
                           DGPRPFKV+LDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF
Sbjct: 121 GVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF 180

Query: 181 PGWDFXXXXXXXXXXRSYIFGGHVSQYMEELADDDEERFSELFKGYLXXXXXXXXXXXXX 240
           PGWDF          RSYIFGGHVSQYMEELADDDEERFSELFKGYL             
Sbjct: 181 PGWDFETEEIDPELLRSYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIY 240

Query: 241 XXXHEAIRADPSFKPTEKKFT 261
              HEAIRADP+FKPTEKKFT
Sbjct: 241 TSAHEAIRADPAFKPTEKKFT 261

>ACR104C [1151] [Homologous to ScYPL131W (RPL5) - SH]
           (541333..542226) [894 bp, 297 aa]
          Length = 297

 Score =  411 bits (1057), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 203/286 (70%), Positives = 212/286 (74%)

Query: 1   MVFIQNLKTSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 60
           M FI+++K SAYHSRFQTPFRRRREGKTDYY RKRLV QHKAKYN+PKYRLVVRFTNKDI
Sbjct: 1   MAFIKSIKNSAYHSRFQTPFRRRREGKTDYYARKRLVTQHKAKYNTPKYRLVVRFTNKDI 60

Query: 61  ICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRALQKLGLDXXXX 120
           ICQ+VSSTITGDIVLAAAYSHELPRYGITHGLTNW+AAYATGLLIARR LQKLGLD    
Sbjct: 61  ICQVVSSTITGDIVLAAAYSHELPRYGITHGLTNWSAAYATGLLIARRTLQKLGLDETYK 120

Query: 121 XXXXXXXXXXXXXXXXDGPRPFKVYLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF 180
                           DGPRPFKVYLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF
Sbjct: 121 GVEEPEGEYELTEAVEDGPRPFKVYLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF 180

Query: 181 PGWDFXXXXXXXXXXRSYIFGGHVSQYMEELADDDEERFSELFKGYLXXXXXXXXXXXXX 240
           PGWDF          R+YIFGGHVS YMEELADDDEER+SELFKGY+             
Sbjct: 181 PGWDFESEELDADLLRTYIFGGHVSAYMEELADDDEERYSELFKGYIADGIEADAIEDIY 240

Query: 241 XXXHEAIRADPSFKPTEKKFTXXXXXXXXXXXXXXXXXXXXRDARV 286
              H AIRADPSFKPTEKKFT                    R ARV
Sbjct: 241 TEAHAAIRADPSFKPTEKKFTKEQYAAESKKFRQVKLTKEERKARV 286

>YLR454W (YLR454W) [3828] chr12 (1043995..1051881) Protein of unknown
            function, has low similarity to uncharacterized C.
            albicans Orf6.6103p [7887 bp, 2628 aa]
          Length = 2628

 Score = 30.8 bits (68), Expect = 1.5,   Method: Composition-based stats.
 Identities = 13/45 (28%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query: 29   DYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDIICQIVS-STITGD 72
            D +QRK ++ +++A  N  +  + ++F   D++CQ V   T++G+
Sbjct: 1728 DLHQRKEVLTEYQAGLNVRRRVMKLKFLAGDVVCQDVDIRTVSGE 1772

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.138    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,161,422
Number of extensions: 244826
Number of successful extensions: 454
Number of sequences better than 10.0: 9
Number of HSP's gapped: 433
Number of HSP's successfully gapped: 9
Length of query: 293
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 192
Effective length of database: 13,099,691
Effective search space: 2515140672
Effective search space used: 2515140672
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)