Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M02651g46245523640.0
YPL133C (RDS2)44647613690.0
KLLA0D07029g53434211591e-155
ACR107W38421910591e-142
Scas_700.4040721610431e-139
Kwal_26.866235521610021e-134
Kwal_14.16364561802879e-28
KLLA0F10417g5075022588e-24
YBR239C5291792562e-23
AFL031W5171812501e-22
Scas_597.25401812421e-21
Sklu_2207.45322082295e-20
CAGL0K06985g5962202261e-19
KLLA0F13904g5792122243e-19
YJL103C6182372012e-16
CAGL0L03674g6292291879e-15
AFR081C4822001823e-14
Scas_711.185091591815e-14
YOR162C (YRR1)810561201e-06
KLLA0F22990g1253391076e-05
Sklu_2191.2718471067e-05
Scas_657.3856501051e-04
Scas_542.8902381051e-04
CAGL0K05841g1372311032e-04
CAGL0L04400g987441013e-04
CAGL0B03421g1355391013e-04
AFR117C115248996e-04
KLLA0D00484g100442996e-04
Sklu_2384.683135987e-04
YLR256W (HAP1)150239989e-04
KLLA0A02585g37029960.001
Kwal_23.642573551950.001
Scas_709.5175938950.001
Scas_573.4147839960.001
AGL233C87252950.002
Kwal_23.351457933940.002
KLLA0F10835g75640940.002
ACL195C10938850.004
CAGL0M05907g891115920.004
YOR172W (YRM1)78634910.004
YDR421W (ARO80)950101910.005
KLLA0F09559g65843910.005
YLR266C (PDR8)70174910.005
Scas_663.1294442900.008
CAGL0L04576g86538890.008
Sklu_2064.292250890.010
KLLA0F22880g116478870.015
Scas_674.12*90975870.016
ACR028C60137860.018
KLLA0E18194g86535860.022
CAGL0L03377g120946850.025
CAGL0J07150g102243840.032
YBR297W (MAL33)46871840.033
KLLA0A06039g65773830.038
Sklu_1993.282335840.038
YNR063W60745830.044
CAGL0F09229g83541830.047
Sklu_2411.1168763820.051
KLLA0F19602g60343820.051
KLLA0D09977g63437820.064
Kwal_47.1808974534810.067
KLLA0A03421g88043810.074
CAGL0G09757g142335810.075
ADR405C80741810.075
Scas_659.1075734810.082
Scas_556.6102242810.085
KLLA0D10153g65551800.11
YLR278C134133790.13
Scas_717.3390445790.13
Sklu_2434.1098357790.15
Scas_590.2117227790.16
Kwal_14.91582239780.17
YOR363C (PIP2)99644780.18
YKL015W (PUT3)97930780.20
Scas_526.3110928780.20
KLLA0D05038g67334770.21
ACL096W83534770.23
Scas_662.890628770.23
KLLA0D10593g92542770.24
YIL130W96428770.25
KLLA0A01804g94544770.26
AGL361C69647760.26
Kwal_23.475481228770.26
ADR199C94438760.30
KLLA0D11286g67833760.30
CAGL0M12298g99443760.34
KLLA0B04840g77147750.38
KLLA0F02387g72742750.41
KLLA0C14212g104071750.41
ADR403C97041750.46
YPR196W47027740.51
YAL051W (OAF1)106246740.56
Scas_702.7111329740.59
AFL200W59625730.64
KLLA0A03443g97544730.64
CAGL0D02904g88749730.65
KLLA0D10197g85640730.65
AGR280C110635730.71
KLLA0F04609g91628730.74
Kwal_34.1575162841730.74
YOR380W (RDR1)54659720.75
CAGL0L09691g82422730.78
Kwal_47.1756562875720.80
CAGL0G08844g84728720.84
AER183C87941720.85
ADR404C87540720.95
Kwal_26.680594441720.96
YKL222C70555711.0
YGR288W (MAL13)47333711.1
YOL089C (HAL9)103090721.1
Kwal_14.2619116724711.1
YER184C79431711.2
KLLA0C04620g126932711.2
AGR061C61254711.3
AER370W80128711.3
KLLA0F14322g71748701.4
KLLA0C19228g59126701.4
Scas_688.1776946701.5
Scas_234.133740701.5
Scas_669.863732701.7
KLLA0F02750g114836701.7
Scas_550.5*83250692.2
ADR365W70145692.2
Kwal_26.709583848692.3
KLLA0F18084g86027682.8
CAGL0H01507g79453682.8
KLLA0C03201g65038682.9
Scas_721.9486935683.2
Scas_449.163641673.2
CAGL0F07865g84426673.4
Kwal_47.1750692429673.7
CAGL0A00451g110734673.8
Scas_630.1470149664.2
Sklu_2335.694031664.3
YMR019W (STB4)94934664.5
Scas_702.7d97890664.8
KLLA0A04169g77535664.9
Kwal_23.652959824665.0
Sklu_2376.692244665.2
YBL005W (PDR3)97628665.4
CAGL0F07755g61132656.2
Kwal_47.19034103358656.3
Scas_637.799833656.6
KLLA0D00396g36144647.2
CAGL0D03850g83439647.3
YMR168C (CEP3)60823648.1
YGL013C (PDR1)106829648.6
Kwal_26.701465426648.8
YKR064W86332649.0
Kwal_23.312278835649.1
CAGL0F07909g104944649.2
Scas_638.14104329649.6
CAGL0C01199g92273649.6
KLLA0C08723g95894649.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M02651g
         (455 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M02651g complement(304583..305971) similar to sp|P19541 Sac...   915   0.0  
YPL133C (RDS2) [5312] chr16 complement(299887..301227) Protein w...   531   0.0  
KLLA0D07029g 602763..604367 some similarities with sp|P19541 Sac...   451   e-155
ACR107W [1154] [Homologous to ScYPL133C - SH] complement(544402....   412   e-142
Scas_700.40                                                           406   e-139
Kwal_26.8662                                                          390   e-134
Kwal_14.1636                                                          115   9e-28
KLLA0F10417g 961004..962527 similar to sp|P38140 Saccharomyces c...   103   8e-24
YBR239C (YBR239C) [418] chr2 complement(698311..699900) Protein ...   103   2e-23
AFL031W [3162] [Homologous to ScYBR239C - SH] complement(376161....   100   1e-22
Scas_597.2                                                             98   1e-21
Sklu_2207.4 YJL103C, Contig c2207 6715-8313 reverse complement         93   5e-20
CAGL0K06985g 681115..682905 similar to sp|P38140 Saccharomyces c...    92   1e-19
KLLA0F13904g complement(1287758..1289497) some similarities with...    91   3e-19
YJL103C (YJL103C) [2812] chr10 complement(228942..230798) Protei...    82   2e-16
CAGL0L03674g 420574..422463 some similarities with sp|P42950 Sac...    77   9e-15
AFR081C [3273] [Homologous to ScYJL103C - SH] (574366..575814) [...    75   3e-14
Scas_711.18                                                            74   5e-14
YOR162C (YRR1) [4961] chr15 complement(639560..641992) Transcrip...    51   1e-06
KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces...    46   6e-05
Sklu_2191.2 YKL222C, Contig c2191 6517-8673 reverse complement         45   7e-05
Scas_657.3                                                             45   1e-04
Scas_542.8                                                             45   1e-04
CAGL0K05841g 572315..576433 similar to sp|P12351 Saccharomyces c...    44   2e-04
CAGL0L04400g complement(511762..514725) similar to tr|Q12340 Sac...    44   3e-04
CAGL0B03421g complement(336071..340138) similar to sp|P12351 Sac...    44   3e-04
AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH] (646832..65...    43   6e-04
KLLA0D00484g 44879..47893 no similarity, hypothetical start            43   6e-04
Sklu_2384.6 YKL015W, Contig c2384 10929-13424                          42   7e-04
YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription facto...    42   9e-04
KLLA0A02585g complement(226562..227674) some similarities with c...    42   0.001
Kwal_23.6425                                                           41   0.001
Scas_709.51                                                            41   0.001
Scas_573.4                                                             42   0.001
AGL233C [4079] [Homologous to ScYKL222C - NSH; ScYOR172W - NSH] ...    41   0.002
Kwal_23.3514                                                           41   0.002
KLLA0F10835g 997512..999782 no similarity, hypothetical start          41   0.002
ACL195C [854] [Homologous to NOHBY] (19204..19533) [330 bp, 109 aa]    37   0.004
CAGL0M05907g 622029..624704 similar to sp|P36023 Saccharomyces c...    40   0.004
YOR172W (YRM1) [4969] chr15 (654210..656570) Protein with simila...    40   0.004
YDR421W (ARO80) [1245] chr4 (1312028..1314880) Positive transcri...    40   0.005
KLLA0F09559g complement(876719..878695) some similarities with s...    40   0.005
YLR266C (PDR8) [3660] chr12 complement(675621..677726) Zn[2]-Cys...    40   0.005
Scas_663.12                                                            39   0.008
CAGL0L04576g 526960..529557 similar to tr|Q12340 Saccharomyces c...    39   0.008
Sklu_2064.2 , Contig c2064 873-3641                                    39   0.010
KLLA0F22880g 2123577..2127071 some similarities with ca|CA3639|I...    38   0.015
Scas_674.12*                                                           38   0.016
ACR028C [1076] [Homologous to NOHBY] (408701..410506) [1806 bp, ...    38   0.018
KLLA0E18194g 1613115..1615712 similar to sp|P25502 Saccharomyces...    38   0.022
CAGL0L03377g complement(382932..386561) some similarities with s...    37   0.025
CAGL0J07150g complement(686734..689802) similar to sp|P39720 Sac...    37   0.032
YBR297W (MAL33) [474] chr2 (800479..801885) Maltose fermentation...    37   0.033
KLLA0A06039g 557368..559341 weakly similar to sp|P36023 Saccharo...    37   0.038
Sklu_1993.2 YIL130W, Contig c1993 2139-4610 reverse complement         37   0.038
YNR063W (YNR063W) [4646] chr14 (746940..748763) Protein with sim...    37   0.044
CAGL0F09229g complement(908186..910693) weakly similar to sp|P39...    37   0.047
Sklu_2411.11 YMR019W, Contig c2411 20506-22569 reverse complement      36   0.051
KLLA0F19602g complement(1814949..1816760) similar to sp|P43634 S...    36   0.051
KLLA0D09977g complement(841852..843756) weakly similar to sp|P40...    36   0.064
Kwal_47.18089                                                          36   0.067
KLLA0A03421g 308414..311056 weakly similar to sp|P39720 Saccharo...    36   0.074
CAGL0G09757g 930351..934622 some similarities with sp|Q05854 Sac...    36   0.075
ADR405C [2145] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    36   0.075
Scas_659.10                                                            36   0.082
Scas_556.6                                                             36   0.085
KLLA0D10153g 858016..859983 weakly similar to sp|P35995 Saccharo...    35   0.11 
YLR278C (YLR278C) [3671] chr12 complement(700001..704026) Protei...    35   0.13 
Scas_717.33                                                            35   0.13 
Sklu_2434.10 YAL051W, Contig c2434 22765-25716                         35   0.15 
Scas_590.2                                                             35   0.16 
Kwal_14.915                                                            35   0.17 
YOR363C (PIP2) [5140] chr15 complement(1020218..1023208) Transcr...    35   0.18 
YKL015W (PUT3) [3241] chr11 (408187..411126) Transcription facto...    35   0.20 
Scas_526.3                                                             35   0.20 
KLLA0D05038g 433653..435674 weakly similar to sp|P40971 Saccharo...    34   0.21 
ACL096W [953] [Homologous to ScYKL015W (PUT3) - SH] complement(1...    34   0.23 
Scas_662.8                                                             34   0.23 
KLLA0D10593g complement(900326..903103) similar to sp|P08638 Sac...    34   0.24 
YIL130W (YIL130W) [2546] chr9 (102782..105676) Protein that cont...    34   0.25 
KLLA0A01804g complement(159689..162526) similar to sgd|S0002829 ...    34   0.26 
AGL361C [3951] [Homologous to NOHBY] (24101..26191) [2091 bp, 69...    34   0.26 
Kwal_23.4754                                                           34   0.26 
ADR199C [1940] [Homologous to ScYDR421W (ARO80) - SH] (1048530.....    34   0.30 
KLLA0D11286g complement(964642..966678) no similarity, hypotheti...    34   0.30 
CAGL0M12298g complement(1225753..1228737) similar to sp|P39720 S...    34   0.34 
KLLA0B04840g 439864..442179 weakly similar to ca|CA4996|IPF2029 ...    33   0.38 
KLLA0F02387g complement(213669..215852) similar to sp|P47988 Sac...    33   0.41 
KLLA0C14212g complement(1229219..1232341) some similarities with...    33   0.41 
ADR403C [2143] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    33   0.46 
YPR196W (YPR196W) [5609] chr16 (931370..932782) Positive regulat...    33   0.51 
YAL051W (OAF1) [17] chr1 (48565..51753) Transcription factor req...    33   0.56 
Scas_702.7                                                             33   0.59 
AFL200W [2995] [Homologous to ScYMR168C (CEP3) - SH] complement(...    33   0.64 
KLLA0A03443g 311628..314555 weakly similar to sp|P39720 Saccharo...    33   0.64 
CAGL0D02904g complement(302952..305615) similar to sp|P07272 Sac...    33   0.65 
KLLA0D10197g complement(861726..864296) similar to sp|P05085 Sac...    33   0.65 
AGR280C [4591] [Homologous to ScYLR278C - SH] (1266918..1270238)...    33   0.71 
KLLA0F04609g complement(451579..454329) similar to sp|P40467 Sac...    33   0.74 
Kwal_34.15751                                                          33   0.74 
YOR380W (RDR1) [5153] chr15 (1051286..1052926) Protein with simi...    32   0.75 
CAGL0L09691g complement(1039799..1042273) some similarities with...    33   0.78 
Kwal_47.17565                                                          32   0.80 
CAGL0G08844g complement(846590..849133) similar to sp|P40467 Sac...    32   0.84 
AER183C [2685] [Homologous to ScYOL089C (HAL9) - NSH] (975879..9...    32   0.85 
ADR404C [2144] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    32   0.95 
Kwal_26.6805                                                           32   0.96 
YKL222C (YKL222C) [3053] chr11 complement(3504..5621) Protein wi...    32   1.0  
YGR288W (MAL13) [2233] chr7 (1070298..1071719) Maltose pathway r...    32   1.1  
YOL089C (HAL9) [4731] chr15 complement(150397..153489) Protein i...    32   1.1  
Kwal_14.2619                                                           32   1.1  
YER184C (YER184C) [1612] chr5 complement(556291..558675) Protein...    32   1.2  
KLLA0C04620g complement(422705..426514) weakly similar to sp|Q05...    32   1.2  
AGR061C [4371] [Homologous to ScYLR098C (CHA4) - SH] (831058..83...    32   1.3  
AER370W [2871] [Homologous to ScYIL130W (GIN1) - SH] complement(...    32   1.3  
KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1 Kluyver...    32   1.4  
KLLA0C19228g 1713787..1715562 similar to sp|P53749 Saccharomyces...    32   1.4  
Scas_688.17                                                            32   1.5  
Scas_234.1                                                             32   1.5  
Scas_669.8                                                             32   1.7  
KLLA0F02750g complement(250368..253814) some similarities with s...    32   1.7  
Scas_550.5*                                                            31   2.2  
ADR365W [2106] [Homologous to ScYOR337W (TEA1) - SH] complement(...    31   2.2  
Kwal_26.7095                                                           31   2.3  
KLLA0F18084g complement(1652031..1654613) no similarity, hypothe...    31   2.8  
CAGL0H01507g complement(147689..150073) similar to sp|Q06639 Sac...    31   2.8  
KLLA0C03201g complement(286973..288925) similar to sp|P39529 Sac...    31   2.9  
Scas_721.94                                                            31   3.2  
Scas_449.1                                                             30   3.2  
CAGL0F07865g complement(768270..770804) similar to tr|Q12151 Sac...    30   3.4  
Kwal_47.17506                                                          30   3.7  
CAGL0A00451g 47557..50880 similar to sp|P12383 Saccharomyces cer...    30   3.8  
Scas_630.14                                                            30   4.2  
Sklu_2335.6 YBL005W, Contig c2335 10191-13013                          30   4.3  
YMR019W (STB4) [3983] chr13 (312155..315004) Sin3p-binding prote...    30   4.5  
Scas_702.7d                                                            30   4.8  
KLLA0A04169g complement(376273..378600) similar to sgd|S0004218 ...    30   4.9  
Kwal_23.6529                                                           30   5.0  
Sklu_2376.6 , Contig c2376 12573-15341 reverse complement              30   5.2  
YBL005W (PDR3) [189] chr2 (217435..220365) Zinc-finger transcrip...    30   5.4  
CAGL0F07755g complement(755947..757782) similar to sp|P40969 Sac...    30   6.2  
Kwal_47.19034                                                          30   6.3  
Scas_637.7                                                             30   6.6  
KLLA0D00396g complement(36277..37362) some similarities with ca|...    29   7.2  
CAGL0D03850g 384689..387193 weakly similar to sp|Q06639 Saccharo...    29   7.3  
YMR168C (CEP3) [4123] chr13 complement(597331..599157) Component...    29   8.1  
YGL013C (PDR1) [1960] chr7 complement(469095..472301) Zinc-finge...    29   8.6  
Kwal_26.7014                                                           29   8.8  
YKR064W (YKR064W) [3315] chr11 (562189..564780) Protein with sim...    29   9.0  
Kwal_23.3122                                                           29   9.1  
CAGL0F07909g 776659..779808 some similarities with tr|Q12180 Sac...    29   9.2  
Scas_638.14                                                            29   9.6  
CAGL0C01199g complement(121944..124712) similar to tr|Q12151 Sac...    29   9.6  
KLLA0C08723g 762625..765501 gi|7578634|gb|AAF64114.1|AF216585_1 ...    29   9.7  

>CAGL0M02651g complement(304583..305971) similar to sp|P19541
           Saccharomyces cerevisiae YPL133c, hypothetical start
          Length = 462

 Score =  915 bits (2364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/455 (96%), Positives = 441/455 (96%)

Query: 1   MEEPAAKKQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLCVADENVSNIQSQYQYK 60
           MEEPAAKKQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLCVADENVSNIQSQYQYK
Sbjct: 1   MEEPAAKKQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLCVADENVSNIQSQYQYK 60

Query: 61  NSMSPIGSTEIPNAEINIGDETRAIQGSNSSVYGTETPIXXXXXXXXXXXXXXFVSENVG 120
           NSMSPIGSTEIPNAEINIGDETRAIQGSNSSVYGTETPI              FVSENVG
Sbjct: 61  NSMSPIGSTEIPNAEINIGDETRAIQGSNSSVYGTETPISSSNNNLLLPPQPNFVSENVG 120

Query: 121 SEFSSLNEFLMMLENPIPGESENTSQSNKEQERTAHSNMEDSIENTQEQTDNNEGIIGSV 180
           SEFSSLNEFLMMLENPIPGESENTSQSNKEQERTAHSNMEDSIENTQEQTDNNEGIIGSV
Sbjct: 121 SEFSSLNEFLMMLENPIPGESENTSQSNKEQERTAHSNMEDSIENTQEQTDNNEGIIGSV 180

Query: 181 SVNQEISQDINEASSKANGTKTVNDGQGQEQDQEHNRQKLNKQESSNSKAQSDKYDDTPT 240
           SVNQEISQDINEASSKANGTKTVNDGQGQEQDQEHNRQKLNKQESSNSKAQSDKYDDTPT
Sbjct: 181 SVNQEISQDINEASSKANGTKTVNDGQGQEQDQEHNRQKLNKQESSNSKAQSDKYDDTPT 240

Query: 241 SKEQFFLTAADPSTEMNPVDRLKLVINAKLEAGLLKPYDYAKGYARLQEYMDKYMNDTNK 300
           SKEQFFLTAADPSTEMNPVDRLKLVINAKLEAGLLKPYDYAKGYARLQEYMDKYMNDTNK
Sbjct: 241 SKEQFFLTAADPSTEMNPVDRLKLVINAKLEAGLLKPYDYAKGYARLQEYMDKYMNDTNK 300

Query: 301 QRILKPLMSIRPAFRTIAKSLKDVDLVLVEESFERMLLSYDRVFTSMSMPACLWRRTGEI 360
           QRILKPLMSIRPAFRTIAKSLKDVDLVLVEESFERMLLSYDRVFTSMSMPACLWRRTGEI
Sbjct: 301 QRILKPLMSIRPAFRTIAKSLKDVDLVLVEESFERMLLSYDRVFTSMSMPACLWRRTGEI 360

Query: 361 YRANKEFASLVDCTVDDLRDGKLAIYELMTEESAVNFWEKYGSIAFDKGQKAVLTSCSLR 420
           YRANKEFASLVDCTVDDLRDGKLAIYELMTEESAVNFWEKYGSIAFDKGQKAVLTSCSLR
Sbjct: 361 YRANKEFASLVDCTVDDLRDGKLAIYELMTEESAVNFWEKYGSIAFDKGQKAVLTSCSLR 420

Query: 421 TKDGLKKRPCCFSFTIRRDRYNIPICIVGNFIPLS 455
           TKDGLKKRPCCFSFTIRRDRYNIPICIVGNFIPLS
Sbjct: 421 TKDGLKKRPCCFSFTIRRDRYNIPICIVGNFIPLS 455

>YPL133C (RDS2) [5312] chr16 complement(299887..301227) Protein with
           similarity to transcription factors, has Zn[2]-Cys[6]
           fungal-type binuclear cluster domain in the N-terminal
           region, involved in resistance to the antifungal drug
           ketoconazole [1341 bp, 446 aa]
          Length = 446

 Score =  531 bits (1369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/476 (60%), Positives = 328/476 (68%), Gaps = 60/476 (12%)

Query: 5   AAKKQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLCVADE---------------N 49
             K+  K +K+C+FC+RSHV CD QRPCSRC+KR+I HLC  D+               N
Sbjct: 6   GVKRASKAFKTCLFCKRSHVVCDKQRPCSRCVKRDIAHLCREDDIAVPNEMPSQHESSPN 65

Query: 50  VSNIQSQYQYKNSMSPIGSTEIPNAEINIGDETRAIQGSNSSVYGTE------TPIXXXX 103
            +NIQ +Y  K        T IP+      D        + S YG E      + +    
Sbjct: 66  DNNIQGKYANK------AHTGIPS------DYQNEPVNKSGSTYGEELSPKLDSSLVNDT 113

Query: 104 XXXXXXXXXXFVSENVGSEFSSLNEFLMMLENPIPGESENTSQSNKEQERTAHSNMEDSI 163
                     FVSENVGSEFSSLNEFL MLENP+       +Q++      ++ ++E+  
Sbjct: 114 TSLLLPQQPVFVSENVGSEFSSLNEFLSMLENPL------LTQTSLSSSSASNVHLENGS 167

Query: 164 ENTQE----QTDNNEGIIGSVSVNQEISQDINEASSKANGTKTVNDGQGQEQDQEHNRQK 219
           + TQ     Q DN    IG V+  +  S  I   SS      +++ G  Q+Q++E +R  
Sbjct: 168 QTTQSPLEYQNDNRRDEIG-VARQENRSPTIMSGSSN-----SISKGDKQDQEKEESRIL 221

Query: 220 LNKQESSNSKAQSDKYDDTPTSKEQFFLTAADPSTEMNPVDRLKLVINAKLEAGLLKPYD 279
            N  E+S            PT KEQFFLTAADPSTEM P  RLKLVINAKLEAGLLKPY+
Sbjct: 222 ANANENS-----------APTPKEQFFLTAADPSTEMTPEHRLKLVINAKLEAGLLKPYN 270

Query: 280 YAKGYARLQEYMDKYMNDTNKQRILKPLMSIRPAFRTIAKSLKDVDLVLVEESFERMLLS 339
           YAKGYARLQ+YMDKYMN ++KQRILKPL +IRPAFRTIA+SLKDVDLVLVEESFERMLLS
Sbjct: 271 YAKGYARLQDYMDKYMNQSSKQRILKPLSTIRPAFRTIARSLKDVDLVLVEESFERMLLS 330

Query: 340 YDRVFTSMSMPACLWRRTGEIYRANKEFASLVDCTVDDLRDGKLAIYELMTEESAVNFWE 399
           YDRVFTSMSMPACL RRTGEIYRANKEFASLVDCTVDDLRDGKLAIYELMTEESAVNFWE
Sbjct: 331 YDRVFTSMSMPACLCRRTGEIYRANKEFASLVDCTVDDLRDGKLAIYELMTEESAVNFWE 390

Query: 400 KYGSIAFDKGQKAVLTSCSLRTKDGLKKRPCCFSFTIRRDRYNIPICIVGNFIPLS 455
           KYGSIAFDKGQKAVLTSCSLRTKDG++KRPCCFSFTIRRDRYNIPICIVGNFIPLS
Sbjct: 391 KYGSIAFDKGQKAVLTSCSLRTKDGIRKRPCCFSFTIRRDRYNIPICIVGNFIPLS 446

>KLLA0D07029g 602763..604367 some similarities with sp|P19541
           Saccharomyces cerevisiae YPL133c, hypothetical start
          Length = 534

 Score =  451 bits (1159), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 225/342 (65%), Positives = 257/342 (75%), Gaps = 17/342 (4%)

Query: 114 FVSENVGSEFSSLNEFLMMLENPIPGESENTSQSNKEQERTAHSNMEDSIENTQEQTDNN 173
           F+SE++GSEFSSLNEFL MLE+P+  E     Q +   + TA        ++  + TD  
Sbjct: 210 FLSEHIGSEFSSLNEFLTMLEDPMLIEPGTPIQHHMNAQITA-------ADHPAQATDQP 262

Query: 174 EGIIGSVSVNQEISQDINEASSKANGTKTVNDGQGQEQDQEHNRQKLNKQESSNSKAQSD 233
           E       V  E++   N           +N+ Q     Q  +    N Q +        
Sbjct: 263 EYHSQQPLVAHEVTTQPN----------NMNNSQHPMHTQMQSPVHSNVQNAGGMSPPLL 312

Query: 234 KYDDTPTSKEQFFLTAADPSTEMNPVDRLKLVINAKLEAGLLKPYDYAKGYARLQEYMDK 293
             D  PT KE FFLTAADPSTE+NP DRLKLVINAKLEAGLL+PY+YAKGY+RLQ++MDK
Sbjct: 313 PDDQQPTPKENFFLTAADPSTEINPEDRLKLVINAKLEAGLLQPYNYAKGYSRLQKFMDK 372

Query: 294 YMNDTNKQRILKPLMSIRPAFRTIAKSLKDVDLVLVEESFERMLLSYDRVFTSMSMPACL 353
           YMN ++KQRILKPL  IRPAFR IA+SLKDVDLVLVEESFERMLLSYDRVFTSMSMPACL
Sbjct: 373 YMNQSSKQRILKPLSIIRPAFRAIARSLKDVDLVLVEESFERMLLSYDRVFTSMSMPACL 432

Query: 354 WRRTGEIYRANKEFASLVDCTVDDLRDGKLAIYELMTEESAVNFWEKYGSIAFDKGQKAV 413
           WRRTGEIYR NKEFASLVDC VD+LRDGKLAIYELM+EESAVNFWEKYGSIAFDKGQKAV
Sbjct: 433 WRRTGEIYRGNKEFASLVDCKVDELRDGKLAIYELMSEESAVNFWEKYGSIAFDKGQKAV 492

Query: 414 LTSCSLRTKDGLKKRPCCFSFTIRRDRYNIPICIVGNFIPLS 455
           LTSC+LRT+DG ++RPCCFSFTIRRDRYNIPICIVGNFIP+S
Sbjct: 493 LTSCNLRTRDGRQRRPCCFSFTIRRDRYNIPICIVGNFIPIS 534

 Score = 65.1 bits (157), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 23/30 (76%), Positives = 27/30 (90%)

Query: 15 SCIFCRRSHVNCDHQRPCSRCIKREIGHLC 44
          +C+FCRRSH+ CD QRPCSRC+KR IGHLC
Sbjct: 16 ACVFCRRSHMVCDEQRPCSRCVKRSIGHLC 45

>ACR107W [1154] [Homologous to ScYPL133C - SH]
           complement(544402..545556) [1155 bp, 384 aa]
          Length = 384

 Score =  412 bits (1059), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 190/219 (86%), Positives = 207/219 (94%)

Query: 237 DTPTSKEQFFLTAADPSTEMNPVDRLKLVINAKLEAGLLKPYDYAKGYARLQEYMDKYMN 296
           + PT+KE FFLTAADPSTE+ P DRLKLVINAKLEAGLL+PY+Y++GYARLQ YMDKYMN
Sbjct: 166 EQPTAKENFFLTAADPSTEVEPEDRLKLVINAKLEAGLLQPYNYSQGYARLQNYMDKYMN 225

Query: 297 DTNKQRILKPLMSIRPAFRTIAKSLKDVDLVLVEESFERMLLSYDRVFTSMSMPACLWRR 356
            +++QRILKPL +IRPAFR IA+SLKDVDLVLVEE FERMLLSYDRVFTSMSMPACLWRR
Sbjct: 226 QSSRQRILKPLSTIRPAFRAIARSLKDVDLVLVEEGFERMLLSYDRVFTSMSMPACLWRR 285

Query: 357 TGEIYRANKEFASLVDCTVDDLRDGKLAIYELMTEESAVNFWEKYGSIAFDKGQKAVLTS 416
           TGEIYR NKEFASLVDCTVDDLRDG LAIYELMTEESAVNFWEKYGSIAFDKGQKAVLTS
Sbjct: 286 TGEIYRGNKEFASLVDCTVDDLRDGNLAIYELMTEESAVNFWEKYGSIAFDKGQKAVLTS 345

Query: 417 CSLRTKDGLKKRPCCFSFTIRRDRYNIPICIVGNFIPLS 455
           C+LR+KDG K+RPCCFSFTIRRDRYNIPICI+GNFIP+S
Sbjct: 346 CNLRSKDGRKRRPCCFSFTIRRDRYNIPICIIGNFIPIS 384

 Score = 91.7 bits (226), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 78/149 (52%), Gaps = 21/149 (14%)

Query: 5   AAKKQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLCVADENVSNIQSQYQYKNSMS 64
           + KK+KK+ K+C+ CRRSH+ CD +RPCSRCIKR+IGH C  DE    +Q   +   S S
Sbjct: 12  STKKRKKVVKACVLCRRSHMICDDRRPCSRCIKRDIGHFC-CDE---KLQPGAERLQSQS 67

Query: 65  PIGSTEI---PNAEINIGDETRAIQGSNSSVYGTETPIXXXXXXXXXXXXXXFVSENVGS 121
           P+ +      P  E  +        G N        P               FVSE++GS
Sbjct: 68  PLRTETFDVQPVPEHLVAGLGVGAAGGNRYANVINHP--------------KFVSEHIGS 113

Query: 122 EFSSLNEFLMMLENPIPGESENTSQSNKE 150
           EFSSLNEFL +LE+P+  E+  +   N +
Sbjct: 114 EFSSLNEFLTLLEDPLLMEATPSPGCNGQ 142

>Scas_700.40
          Length = 407

 Score =  406 bits (1043), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 187/216 (86%), Positives = 206/216 (95%)

Query: 239 PTSKEQFFLTAADPSTEMNPVDRLKLVINAKLEAGLLKPYDYAKGYARLQEYMDKYMNDT 298
           PT KEQFFLTAADPSTEM P DRLKLVINAKLEAGLLKPY+YAKGYARLQ+YMD+ M  +
Sbjct: 191 PTLKEQFFLTAADPSTEMTPEDRLKLVINAKLEAGLLKPYNYAKGYARLQKYMDENMEQS 250

Query: 299 NKQRILKPLMSIRPAFRTIAKSLKDVDLVLVEESFERMLLSYDRVFTSMSMPACLWRRTG 358
           +KQRILKPL +IRPAFRTIA+SLKDVDL+LVEE+FER+LLSYDRVFTSMSMPACLWRRTG
Sbjct: 251 SKQRILKPLSTIRPAFRTIARSLKDVDLILVEENFERLLLSYDRVFTSMSMPACLWRRTG 310

Query: 359 EIYRANKEFASLVDCTVDDLRDGKLAIYELMTEESAVNFWEKYGSIAFDKGQKAVLTSCS 418
           EIYRANKEFA+LVDCTVD+LRDGKLAIYELM+EESAVNFWEKYGSIAFDKGQK VLTSC+
Sbjct: 311 EIYRANKEFATLVDCTVDELRDGKLAIYELMSEESAVNFWEKYGSIAFDKGQKTVLTSCN 370

Query: 419 LRTKDGLKKRPCCFSFTIRRDRYNIPICIVGNFIPL 454
           L+T+DG +K+ CCFSFTIRRDRYNIPICIVGNFIP+
Sbjct: 371 LQTRDGSRKKNCCFSFTIRRDRYNIPICIVGNFIPI 406

 Score = 93.6 bits (231), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 77/144 (53%), Gaps = 27/144 (18%)

Query: 5   AAKKQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLCVADE------NVSNIQSQYQ 58
              K++K  KSC+FCRRSHVNCD +RPCSRC+KR I +LC +        N+S  Q   +
Sbjct: 11  GGNKKRKKTKSCLFCRRSHVNCDGKRPCSRCLKRGISNLCTSGATAEMGLNMSPPQDSIR 70

Query: 59  YKNSMSPIGST-EIPNAEIN-----IGDETRAIQGSNSSVYGTETPIXXXXXXXXXXXXX 112
                S +  T  IPN+ IN     +   T     +N ++Y  + P              
Sbjct: 71  TGAPGSSMYETPPIPNS-INTYNKMVSSATGTTPATNPNLYLPQQP-------------- 115

Query: 113 XFVSENVGSEFSSLNEFLMMLENP 136
            F+SEN GSEF+SLNEFL MLE+P
Sbjct: 116 SFISENAGSEFNSLNEFLNMLEDP 139

>Kwal_26.8662
          Length = 355

 Score =  390 bits (1002), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 195/216 (90%)

Query: 237 DTPTSKEQFFLTAADPSTEMNPVDRLKLVINAKLEAGLLKPYDYAKGYARLQEYMDKYMN 296
           D PT KE FFLTAADPS EM P DRLK VINAKLEAGLL+PY+YA+GYARLQ YMD +M+
Sbjct: 135 DQPTLKENFFLTAADPSAEMTPEDRLKSVINAKLEAGLLQPYNYARGYARLQTYMDDHMD 194

Query: 297 DTNKQRILKPLMSIRPAFRTIAKSLKDVDLVLVEESFERMLLSYDRVFTSMSMPACLWRR 356
             +KQRIL+PL  IRP FR IA++L+DVDL+LVEESFERMLLSYDRVFTSMSMPACLWRR
Sbjct: 195 LASKQRILRPLSIIRPEFRAIARTLRDVDLILVEESFERMLLSYDRVFTSMSMPACLWRR 254

Query: 357 TGEIYRANKEFASLVDCTVDDLRDGKLAIYELMTEESAVNFWEKYGSIAFDKGQKAVLTS 416
           TGEIYR NKEFASLVDC VDDLRDGKLAIYELMTEES VNFWEKYGSIAFDK QKAVLTS
Sbjct: 255 TGEIYRGNKEFASLVDCKVDDLRDGKLAIYELMTEESVVNFWEKYGSIAFDKDQKAVLTS 314

Query: 417 CSLRTKDGLKKRPCCFSFTIRRDRYNIPICIVGNFI 452
           C LR++DG KKRPCCFSFTIRRDRYNIPICIVGNFI
Sbjct: 315 CHLRSRDGSKKRPCCFSFTIRRDRYNIPICIVGNFI 350

 Score = 96.3 bits (238), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 75/141 (53%), Gaps = 27/141 (19%)

Query: 1   MEEPAAKKQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLCVADENVSNIQSQYQYK 60
           M +   KK+KK+ K+CI+CRRSH+ C+ QRPCSRC+KR+IGHLC  DE +          
Sbjct: 1   MGDQIQKKRKKVSKACIYCRRSHMICNEQRPCSRCVKRDIGHLC-RDEEL---------- 49

Query: 61  NSMSPIGSTEIPNAEINIGDETRAIQGSNSSVYGT----ETPIXXXXXXXXXXXXXXFVS 116
                          +++  +   +Q     VY +    + P+              FVS
Sbjct: 50  ------------RLALDVEPDAEQLQTDLGQVYKSGSVPQQPLKSGAYGGLLSQQPTFVS 97

Query: 117 ENVGSEFSSLNEFLMMLENPI 137
           E+VGSEFSSLNEFL MLE+P+
Sbjct: 98  EHVGSEFSSLNEFLNMLEDPL 118

>Kwal_14.1636
          Length = 456

 Score =  115 bits (287), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 98/180 (54%), Gaps = 1/180 (0%)

Query: 276 KPYDYAKGYARLQEYMDKYMNDTNKQRILKPLMSIRPAFRTIAKSLKDVDLVLVEESFER 335
           +P+ +  G+  L +Y+    N  +   + + L   RP F  IA +L + D++ +E+ ++R
Sbjct: 273 RPFSHTSGFHSLLQYLRARFNREDVVEMCRSLAEFRPTFIAIAVTLTEEDMIFMEQCYQR 332

Query: 336 MLLSYDRVFTSMSMPACLWRRTGEIYRANKEFASLVDCTVDDLRDGKLAIYELMTEESAV 395
            LL YD+  + +  P C+WRR G+I   + EF+ L   T  DL      I ELM +ES  
Sbjct: 333 TLLEYDQFISQLGTPTCVWRRNGQISYVSDEFSLLTGWTRADLLFKMTFIVELMDDESVR 392

Query: 396 NFWEKYGSIAF-DKGQKAVLTSCSLRTKDGLKKRPCCFSFTIRRDRYNIPICIVGNFIPL 454
            +++ +  +A+ D      + +C L T    ++  CC  +T++RD + +P+ I+GNF+P+
Sbjct: 393 EYFKTFNRVAYRDFKGSERMKTCRLLTPVKGRQIECCCIWTLKRDVFGLPLMIIGNFMPI 452

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 26/40 (65%)

Query: 6  AKKQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLCV 45
            +++K   +CI C +SHV C  +RPC+RC+K+ +   CV
Sbjct: 2  GSRRQKTSVACINCSKSHVTCQAERPCTRCVKKGLEASCV 41

>KLLA0F10417g 961004..962527 similar to sp|P38140 Saccharomyces
           cerevisiae YBR239c, start by similarity
          Length = 507

 Score =  103 bits (258), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 103/502 (20%), Positives = 206/502 (41%), Gaps = 57/502 (11%)

Query: 5   AAKKQKKLYKSCIFCRRSHVNCDHQRP---CSR------CI---KREIGHLCVADENVSN 52
           + K+ KK+  +C+ C +SHV CD  RP   C R      CI   ++++ +L    E+   
Sbjct: 2   SVKRNKKVSVACVHCAKSHVTCDDNRPCTRCIRKGLEESCIDAPRKKVKYLRDVPED--Q 59

Query: 53  IQSQYQYKNSMSPIGSTEI-------PNAEINI-GDETRAIQGSNSSVYGTETPIXXXXX 104
           + S  +    + P+ + ++       PN  ++  G   R    +N+     ET       
Sbjct: 60  LPSVLRSTKQVPPVNAVKLKMEPGILPNIPLDYDGGTIRQSAPANNGKNNPET--QQTLS 117

Query: 105 XXXXXXXXXFVSENVGSEFSSLNEFL------------MMLENPIPGESENTSQSNKEQE 152
                    F+S     E+S L++ +             +  NP        +Q +   +
Sbjct: 118 NGQITHRPKFLSSAADLEYSILSDIIHGDSLFNKIPVNFLYSNPTEKTPSPINQGSLNGQ 177

Query: 153 RTAHSNMEDSIENTQEQTDNNEGIIGSV--SVNQEISQ-DIN--------EASSKANGT- 200
           +  H +++   +   +   N   I  ++   V+ EI Q + N        +     +GT 
Sbjct: 178 QDLHFSLQLRSKPMNQIRGNTRAIYSNLLGPVSHEILQSEFNLYTNHFPLQPQESLDGTL 237

Query: 201 --KTVNDGQGQEQDQEHNRQKLNKQESSNSKAQSDKYDDTPTSKEQFFLTAADPSTEMNP 258
             K +  G       + ++  +N+   + +    + YD        + L    P     P
Sbjct: 238 DFKRMTIGTLSPHLTKFDK-TINQYYLNFANTFPEIYDSRKIPNLSYALEVEPPEYREIP 296

Query: 259 VDR-----LKLVINAKLEAGLLKPYDYAKGYARLQEYMDKYMNDTNKQRILKPLMSIRPA 313
            D      L+    +++ + +   +    G+  L  Y+ +  +      + + L  +RP 
Sbjct: 297 HDTEIPHTLRFTTPSEIYSLVQTAFPSTTGFHALLRYLKRRFDKNQLVEMCRCLAELRPI 356

Query: 314 FRTIAKSLKDVDLVLVEESFERMLLSYDRVFTSMSMPACLWRRTGEIYRANKEFASLVDC 373
           F      L D D++ +E+S +R LL Y++  + +  P C+WRR G+I   N EF+ L   
Sbjct: 357 FIASTIDLTDEDMIFMEKSHQRTLLEYEKFISQVGTPTCVWRRNGQISYVNDEFSLLTGW 416

Query: 374 TVDDLRDGKLAIYELMTEESAVNFWEKYGSIAFDKGQKA-VLTSCSLRTKDGLKKRPCCF 432
              +L +    I ELM  ++ + +++ +  +A+   + A  +  C+L T        CC 
Sbjct: 417 NRLELLNKMTFIVELMDGDTVMEYFQTFTRVAYQGFRGAETMRICNLLTPIKGSVIKCCC 476

Query: 433 SFTIRRDRYNIPICIVGNFIPL 454
            +T++RD + +P+ I+GNF+P+
Sbjct: 477 LWTLKRDAFGLPMMIIGNFMPI 498

>YBR239C (YBR239C) [418] chr2 complement(698311..699900) Protein
           with similarity to transcription factors, has
           Zn[2]-Cys[6] fungal-type binuclear cluster domain in the
           N-terminal region [1590 bp, 529 aa]
          Length = 529

 Score =  103 bits (256), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 93/179 (51%), Gaps = 1/179 (0%)

Query: 277 PYDYAKGYARLQEYMDKYMNDTNKQRILKPLMSIRPAFRTIAKSLKDVDLVLVEESFERM 336
           P+ +  G+  L  Y+    N  +  ++ + +   RP F   + +L + D++ +E+ ++R 
Sbjct: 349 PFSHTPGFHHLLVYLKHRFNQQDLVKMCRSIAEFRPIFIACSVTLTEEDMIFMEQCYQRT 408

Query: 337 LLSYDRVFTSMSMPACLWRRTGEIYRANKEFASLVDCTVDDLRDGKLAIYELMTEESAVN 396
           LL Y +    +  P C+WRR G+I   N+EF  L   T ++L +    I E+M +ES  +
Sbjct: 409 LLEYVKFIAQIGTPTCIWRRNGQISYVNEEFEILCGWTREELLNKMTFIVEIMDDESVRD 468

Query: 397 FWEKYGSIAF-DKGQKAVLTSCSLRTKDGLKKRPCCFSFTIRRDRYNIPICIVGNFIPL 454
           +++    +A+ D      +  C L +    K   CC  +T++RD   +P+ I+GNF+P+
Sbjct: 469 YFKTLSKVAYRDFRGSEKMKVCRLLSPIKGKIIHCCCMWTLKRDVSGLPLMILGNFMPI 527

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (67%)

Query: 15 SCIFCRRSHVNCDHQRPCSRCIKREIGHLCV 45
          +C+ C R HV+C+ +RPC RCI + +   CV
Sbjct: 39 ACVNCSRLHVSCEAKRPCLRCISKGLTATCV 69

>AFL031W [3162] [Homologous to ScYBR239C - SH]
           complement(376161..377714) [1554 bp, 517 aa]
          Length = 517

 Score =  100 bits (250), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 95/181 (52%), Gaps = 3/181 (1%)

Query: 276 KPYDYAKGYARLQEYMDKYMNDTNKQRILKPLMSIRPAFRTIAKSLKDVDLVLVEESFER 335
           +P+ +  G+  L +Y+    +  +   + + +   RP F   A  L + D++ +E+S++R
Sbjct: 311 EPFCHTSGFHSLLKYLHSRFHRHDLVEMCRSIAEFRPIFIASAVDLTEEDMIFMEQSYQR 370

Query: 336 MLLSYDRVFTSMSMPACLWRRTGEIYRANKEFASLVDCTVDDLRDGKLAIYELMTEESAV 395
            LL YDR  T +  P C+WRR G+I   N EF  L   T ++L      I EL+ + S  
Sbjct: 371 TLLEYDRFITQIGTPTCVWRRNGQISYLNDEFCLLTGWTREELLSKMTFIVELLDDNSVR 430

Query: 396 NFWEKYGSIAFD--KGQKAVLTSCSLRTKDGLKKRPCCFSFTIRRDRYNIPICIVGNFIP 453
            +++ +  +A+   KG + + T   L   +G +   C   +T +RD + +P+ IVG+F+P
Sbjct: 431 EYFKTFSKVAYKDFKGFEQMETCVLLSPIEG-RTIECSCMWTWKRDVFGMPMMIVGHFLP 489

Query: 454 L 454
           +
Sbjct: 490 V 490

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 28/40 (70%)

Query: 6  AKKQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLCV 45
          A K+KK   +C+ C RSHV C+ QRPC+RC+K+ +   CV
Sbjct: 9  AAKRKKTNVACVNCSRSHVTCESQRPCTRCVKKGLEMSCV 48

>Scas_597.2
          Length = 540

 Score = 97.8 bits (242), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 97/181 (53%), Gaps = 3/181 (1%)

Query: 276 KPYDYAKGYARLQEYMDKYMNDTNKQRILKPLMSIRPAFRTIAKSLKDVDLVLVEESFER 335
           +P+ +  G+  L  Y+    N  +   + + +   RP F   + +L + D++ +E+ ++R
Sbjct: 359 EPFCHTMGFRHLLLYLRNRFNQKDIVSMCRSMTEFRPIFIACSMTLTEEDMIFMEQCYQR 418

Query: 336 MLLSYDRVFTSMSMPACLWRRTGEIYRANKEFASLVDCTVDDLRDGKLAIYELMTEESAV 395
            LL Y +    +  P C+WRR G+I   N+EF  L   T ++L +    I E++ ++S  
Sbjct: 419 TLLEYSKFIGQIGTPTCVWRRNGQISYINEEFEILTGWTREELLNKMTFIVEILDDDSVR 478

Query: 396 NFWEKYGSIAFD--KGQKAVLTSCSLRTKDGLKKRPCCFSFTIRRDRYNIPICIVGNFIP 453
           ++++ + S+A+   KG + + T C L T    +   C   +T++RD   +P+ I+GNF+P
Sbjct: 479 DYFKTFSSVAYKDFKGCEQMKT-CRLLTPLEGQVVNCGCMWTLKRDISGLPLMILGNFMP 537

Query: 454 L 454
           +
Sbjct: 538 I 538

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 32/52 (61%), Gaps = 7/52 (13%)

Query: 1  MEEPAAK-------KQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLCV 45
          M  P+AK       K++K+  +C  C +SH +CD  RPCSRCIK+E+   CV
Sbjct: 21 MVGPSAKEKKSQTGKRRKINVACSNCAKSHSSCDSCRPCSRCIKKELQDSCV 72

>Sklu_2207.4 YJL103C, Contig c2207 6715-8313 reverse complement
          Length = 532

 Score = 92.8 bits (229), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 103/208 (49%), Gaps = 29/208 (13%)

Query: 274 LLKPYDYAKGYARLQEYM-DKYM-----------NDTNKQRILKPLMSIR----PAFRTI 317
           L+KP++Y   Y  L  Y+ D+++           N    Q +     SI     P F T+
Sbjct: 321 LIKPHNYRAAYRDLLMYLRDRFLDSRGSQKNTSKNRDGPQHLQHIAHSIATHYAPIFVTL 380

Query: 318 AKSLKDVDLVLVEESFERMLLSYDRVFTSMS-MPACLWRRTGEIYRANKEFASLVDCTVD 376
             +L + DL L E   +R LL Y+ +   ++  P C+WRR+GEI   + EF SL      
Sbjct: 381 TTNLIENDLKLQELILQRTLLEYENMAKLVNCTPMCIWRRSGEICYVSNEFVSLTGFPRK 440

Query: 377 DLRDGKLAIYELMTEESAVNFWE----------KYGSIAFDKGQKAVLTSCSLRTKDGLK 426
           D+   +  I E + +ES V++++          K G+     GQ AV + C+L  K+G  
Sbjct: 441 DMLSKRRFILEFLDDESVVDYFDIFHEYLAFGSKEGAGGTSDGQ-AVFSECNLLLKNGTY 499

Query: 427 KRPCCFSFTIRRDRYNIPICIVGNFIPL 454
            +  C  +T++RD YNIP+ ++G F+P+
Sbjct: 500 LKCACI-WTVKRDGYNIPLLVMGQFLPI 526

 Score = 51.6 bits (122), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 24/36 (66%)

Query: 9  QKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLC 44
          +K + K+C+FC   H+ CD  RPC  C++R IGH C
Sbjct: 13 RKPIQKACVFCHEKHLQCDVGRPCQNCLRRNIGHEC 48

>CAGL0K06985g 681115..682905 similar to sp|P38140 Saccharomyces
           cerevisiae YBR239c, hypothetical start
          Length = 596

 Score = 91.7 bits (226), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 56/220 (25%), Positives = 105/220 (47%), Gaps = 15/220 (6%)

Query: 249 AADPSTEMNPVDRLKLVINAKLEAGLL------------KPYDYAKGYARLQEYMDKYMN 296
           A   S E  P D  +L  N + +  L             +P+ +  G+  L +Y+ K  +
Sbjct: 377 AVSVSVECPPPDGSRLYNNVEWDHSLKYGTPVEIYKLINEPFSHTPGFRHLLQYLRKRFS 436

Query: 297 DTNKQRILKPLMSIRPAFRTIAKSLKDVDLVLVEESFERMLLSYDRVFTSMSMPACLWRR 356
             +   + + +   RP F   + +L + D++ +E+ ++R LL Y +    +  P  +WRR
Sbjct: 437 QKDLVSMCQNMAYFRPIFIACSITLTEEDMIFMEQCYQRTLLQYVKFIQEIGTPTVVWRR 496

Query: 357 TGEIYRANKEFASLVDCTVDDLRDGKLAIYELMTEESAVNFWEKYGSIAFD--KGQKAVL 414
            G+I   N EF  L     ++L D    I E++ +ES   +++ +  IA++  KG +  +
Sbjct: 497 NGQISYVNDEFEILSGWKREELLDKMSFIVEIIDDESVREYFKTFARIAYNNIKGSEQ-M 555

Query: 415 TSCSLRTKDGLKKRPCCFSFTIRRDRYNIPICIVGNFIPL 454
             C L T    +   C   +T++RD   +P+ I+GNF+P+
Sbjct: 556 DVCRLLTPIRNQVIECKCIWTLKRDMSGLPLMILGNFLPV 595

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 28/39 (71%)

Query: 7  KKQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLCV 45
          KK+K    +C+ C R+H +C+ +RPCSRCIK+ I + CV
Sbjct: 59 KKRKNTNVACVNCSRNHSSCEQKRPCSRCIKKGIANTCV 97

>KLLA0F13904g complement(1287758..1289497) some similarities with
           sp|P42950 Saccharomyces cerevisiae YJL103c, hypothetical
           start
          Length = 579

 Score = 90.9 bits (224), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 60/212 (28%), Positives = 105/212 (49%), Gaps = 31/212 (14%)

Query: 273 GLLKPYDYAKGYARLQEYMDKYMNDTNK-----------QRILKPLMSIR----PAFRTI 317
            L++P++Y   Y  L  ++     +++K           +++     SI+    P F T+
Sbjct: 365 ALIQPHNYKSAYLELLRFLRWRFINSDKPSSGKSQRDGPEQLQNIAHSIKTHYAPIFVTL 424

Query: 318 AKSLKDVDLVLVEESFERMLLSYDRVFTSMS-MPACLWRRTGEIYRANKEFASLVDCTVD 376
             SL   DL L E   +R LL Y+ +   ++  P C+WRR+GEI  A+ EF SL      
Sbjct: 425 TNSLIAQDLKLQEIILQRALLEYESMAKLVNCTPMCIWRRSGEICFASNEFISLTGFNKK 484

Query: 377 DLRDGKLAIYELMTEESAVNFWEKYGS-IAFDKGQ-------------KAVLTSCSLRTK 422
           ++ + +  I E M  ES V++++ +   +AF   Q             +A+ + C+L  K
Sbjct: 485 EILNKRKFIMEFMDNESIVDYYDIFHEYLAFGSTQSGPFNSSTGTSDGQAIFSECNLLLK 544

Query: 423 DGLKKRPCCFSFTIRRDRYNIPICIVGNFIPL 454
           +G   R  C  +T++RD +NIP+ I+G F+P+
Sbjct: 545 NGCYLRCACI-WTVKRDAFNIPMLIMGQFLPI 575

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%)

Query: 9  QKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLC 44
          +K +  +C+FC   H+ CD  RPC  C KR IG  C
Sbjct: 13 RKPIPTACVFCHEKHLQCDLGRPCQNCSKRGIGDTC 48

>YJL103C (YJL103C) [2812] chr10 complement(228942..230798) Protein
           with similarity to transcription factors, contains a
           Zn[2]-Cys[6] fungal-type binuclear cluster domain in the
           N-terminal region [1857 bp, 618 aa]
          Length = 618

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 102/237 (43%), Gaps = 58/237 (24%)

Query: 274 LLKPYDYAKGYARLQEYMDKYM---------------NDTNKQRILKPLMSI-------- 310
           L+KP++Y   Y +L   + K                 + T K  +   L  I        
Sbjct: 380 LIKPHNYKLAYTKLLTTLRKKFLEGAEIDKSASVKDEHSTQKHNLRYDLEVIIRSILERY 439

Query: 311 RPAFRTIAKSLKDVDLVLVEESFERMLLSYDRVFTSMS-MPACLWRRTGEIYRANKEFAS 369
            P F ++  ++ + DL+L E + +R LL  + +   +S  P C+WRR+GEI   + EF S
Sbjct: 440 APIFISLTSNMIEEDLLLQEVTLQRALLDLENMAKLVSCTPMCIWRRSGEICFVSNEFYS 499

Query: 370 LVDCTVDDLRDGKLAIYELMTEESAVNFWEKYGSI------------------------- 404
           L     + L D    I+E +  +S  N+++ +  +                         
Sbjct: 500 LTGFNKNLLLDRTSFIFEYLDHKSVSNYFQIFNELLAFGYNDINKRKKLLMLNACSSTSS 559

Query: 405 ------AFDKGQKAVLTSCSLRTKDGLK-KRPCCFSFTIRRDRYNIPICIVGNFIPL 454
                 +F    KA+ T C+L   +GL  K  CC  +T++RD +NIPI ++G F+P+
Sbjct: 560 KITEGFSFTTDGKAIFTKCNLLLSNGLYLKCACC--WTVKRDSFNIPILVMGQFLPI 614

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 24/43 (55%), Gaps = 2/43 (4%)

Query: 4  PAAKKQ--KKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLC 44
          P+  KQ  K +  +C FC   H+ CD  RPC  C+KR IG  C
Sbjct: 6  PSELKQTRKSIQTACEFCHTKHIQCDVGRPCQNCLKRNIGKFC 48

>CAGL0L03674g 420574..422463 some similarities with sp|P42950
           Saccharomyces cerevisiae YJL103c, hypothetical start
          Length = 629

 Score = 76.6 bits (187), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 59/229 (25%), Positives = 104/229 (45%), Gaps = 50/229 (21%)

Query: 274 LLKPYDYAKGYARLQEYMDK-YMNDTNKQR------ILKPLM-SIRPAFRTIAKSLKDVD 325
           L+KP++Y   Y +L E ++K +++D + +R      I+K ++    P F  +  ++ + D
Sbjct: 399 LIKPHNYRHTYKKLLEQLEKIFLSDNSPKRRGQLQSIVKCILEDYVPTFIALTSNMIESD 458

Query: 326 LVLVEESFERMLLSYDRVFTSMSM-PACLWRRTGEIYRANKEFASLVDCTVDDLRDGKLA 384
           L L E + +R LL  + +   ++  P C+WRR+GEI   + EF  L      ++   +  
Sbjct: 459 LYLQELTLQRTLLELESMAKLVNCSPICIWRRSGEISYVSDEFLQLTGFKRKEILASRRF 518

Query: 385 IYELMTEESAVNFWEKYGS-IAFDKGQKAVLTSCSLRTKDGL--------KKRP------ 429
           I+E +   S VN++  +   +AF  G K  +TS     K GL        K  P      
Sbjct: 519 IFEFLDPTSIVNYFTNFHEYLAF--GSKNQMTSNISLIKQGLLVNGAVVRKSNPIVSSSP 576

Query: 430 ------------------------CCFSFTIRRDRYNIPICIVGNFIPL 454
                                   C   +T++RD +NIP+ I+G F+P+
Sbjct: 577 MCGTNTDGIFDECHLLLSNGYYLKCATCWTVKRDSFNIPLLIMGQFLPV 625

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%)

Query: 12 LYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLC 44
          + K+C FC   H++CD  RPC  C+KR  G LC
Sbjct: 1  MVKACEFCHEKHLHCDPGRPCINCVKRNRGQLC 33

>AFR081C [3273] [Homologous to ScYJL103C - SH] (574366..575814)
           [1449 bp, 482 aa]
          Length = 482

 Score = 74.7 bits (182), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 51/200 (25%), Positives = 97/200 (48%), Gaps = 23/200 (11%)

Query: 277 PYDYAKGY--------ARLQEYMDKYMNDTNKQRILKPLMSIR----PAFRTIAKSLKDV 324
           P++Y + Y        AR     D+   +   +++     SI+    P F T+  +L + 
Sbjct: 278 PHNYRQAYLELLNILRARFLSAQDEIAREEGPKQLHSIAQSIKTYYAPIFVTLTSNLIES 337

Query: 325 DLVLVEESFERMLLSYDRVFTSMS-MPACLWRRTGEIYRANKEFASLVDCTVDDLRDGKL 383
           DL + E   +R LL Y+ +   ++ +P C+WRR+GEI   + EF SL   +  +L   + 
Sbjct: 338 DLKMHELILQRTLLEYENMSKMVNCIPMCIWRRSGEICYVSNEFISLTGFSRRELLMRRR 397

Query: 384 AIYELMTEESAVNFWEKYGS-IAFDKGQ--------KAVLTSCSLRTKDGLKKRPCCFSF 434
            I E       V++++ +   +AF   +        +AV + C+L   +    +  C  +
Sbjct: 398 FIMEFFDNHGIVDYFKLFNEYLAFSSKEGFSSTSDGQAVFSECNLLMANNSFLKCACI-W 456

Query: 435 TIRRDRYNIPICIVGNFIPL 454
           T++RD +NIP+ ++G F+P+
Sbjct: 457 TVKRDSFNIPMLVMGQFLPI 476

 Score = 45.1 bits (105), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%)

Query: 9  QKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLC 44
          +K + ++C+FC   H+ CD  RPC  C KR IG  C
Sbjct: 13 RKPISRACVFCHEKHLQCDVGRPCQNCEKRNIGESC 48

>Scas_711.18
          Length = 509

 Score = 74.3 bits (181), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 77/159 (48%), Gaps = 16/159 (10%)

Query: 312 PAFRTIAKSLKDVDLVLVEESFERMLLSYDRVFT-SMSMPACLWRRTGEIYRANKEFASL 370
           P    +   +   D    E + +RMLL  + + T S   P  +WRRTGEI  AN EF SL
Sbjct: 350 PVILALETGMIPDDFQFQELTLQRMLLDLEDMATFSNCTPLVIWRRTGEICFANNEFLSL 409

Query: 371 VDCTVDDLRDGKLAIYELMTEESAVNFWEKYGS-IAFD-----------KGQKAVLTSCS 418
              T  +L   +  I+E    +S  N+++K+ S +AF             G++    +  
Sbjct: 410 TGYTDVELTSRQRFIFEFWDRQSVFNYFKKFHSMLAFGPIEKEGQTETYPGRRWSFNNSV 469

Query: 419 LRTKDGLK---KRPCCFSFTIRRDRYNIPICIVGNFIPL 454
            R+K  LK      C   +TIRRD +NIP+ +VG F+P+
Sbjct: 470 DRSKILLKNGFHLNCATCWTIRRDTFNIPLLVVGYFLPI 508

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 24/41 (58%), Gaps = 2/41 (4%)

Query: 4  PAAKKQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLC 44
          P A+K   +  +C FC   H+ CD  RPC  CIKR IG+ C
Sbjct: 24 PPARKSIPI--ACEFCHIKHLQCDVGRPCKNCIKRNIGNTC 62

>YOR162C (YRR1) [4961] chr15 complement(639560..641992)
          Transcription factor involved in drug-induced
          transcriptional regulation, including activation of
          multidrug transporter gene SNQ2, has a Zn[2]-Cys[6]
          fungal-type binuclear cluster domain [2433 bp, 810 aa]
          Length = 810

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 5  AAKKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLCVADENVSNIQSQYQY 59
          + KK+ KL KSC FCRR  + CD Q+P CS CI R +     A+E   NI+ +  Y
Sbjct: 43 SGKKRNKLIKSCGFCRRRKLRCDQQKPMCSTCISRNLTTCQYAEEFNKNIEKKATY 98

>KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces
          cerevisiae YLR256w HAP1 transcription factor singleton,
          hypothetical start
          Length = 1253

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 1/39 (2%)

Query: 7  KKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLC 44
          +K+ ++  SC  CR+  V CD  RP C +C+K  +GHLC
Sbjct: 16 RKRNRVPLSCTICRKRKVKCDKGRPQCQQCVKTGVGHLC 54

>Sklu_2191.2 YKL222C, Contig c2191 6517-8673 reverse complement
          Length = 718

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 31/47 (65%), Gaps = 2/47 (4%)

Query: 7  KKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLCVADENVSN 52
          +K++K+ KSC+FCR+  + CDH++P CS C  R +   CV  E  ++
Sbjct: 10 RKRRKVIKSCLFCRKRKLKCDHKKPKCSTCAARNLPE-CVYVEKFTH 55

>Scas_657.3
          Length = 856

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 15 SCIFCRRSHVNCDHQRP-CSRCIKREIGHLCVADENVSNIQSQYQYKNSM 63
          SC FCR+  + CD +RP CS CI R++     AD+N+S   S+Y   +S+
Sbjct: 44 SCAFCRQRKLKCDQKRPICSTCIGRKLTTCVYADDNLSPNDSRYTGPHSV 93

>Scas_542.8
          Length = 902

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 26/38 (68%), Gaps = 1/38 (2%)

Query: 3  EPAAKKQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREI 40
          EP++K++ K   +CI CR+ H+ C    PC+RCIK ++
Sbjct: 17 EPSSKRRPKSL-ACILCRKRHIKCSGGNPCARCIKHDL 53

>CAGL0K05841g 572315..576433 similar to sp|P12351 Saccharomyces
           cerevisiae YLR256w HAP1 transcription factor,
           hypothetical start
          Length = 1372

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%), Gaps = 1/31 (3%)

Query: 15  SCIFCRRSHVNCDHQRP-CSRCIKREIGHLC 44
           SC  CRR  V CD  RP C++C+K  + HLC
Sbjct: 70  SCTICRRRKVKCDKSRPNCTQCVKTGVAHLC 100

>CAGL0L04400g complement(511762..514725) similar to tr|Q12340
          Saccharomyces cerevisiae YOR172w, hypothetical start
          Length = 987

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 28/44 (63%), Gaps = 2/44 (4%)

Query: 7  KKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLCVADEN 49
          KK+ K  KSC FCR+  + CD Q+P CS C +R +  +CV  EN
Sbjct: 28 KKRFKPLKSCAFCRKRKLKCDKQKPRCSSCARRNLP-VCVYIEN 70

>CAGL0B03421g complement(336071..340138) similar to sp|P12351
          Saccharomyces cerevisiae YLR256w HAP1 transcription
          factor, hypothetical start
          Length = 1355

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 7  KKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLC 44
          KK+ ++  SC  CR+  V CD  RP C++C K  + HLC
Sbjct: 14 KKRNRIPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLC 52

>AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH]
          (646832..650290) [3459 bp, 1152 aa]
          Length = 1152

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 4/48 (8%)

Query: 1  MEEPAA---KKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLC 44
          M  P A   +K+ ++  SC  CR+  V CD  RP C++C K  + HLC
Sbjct: 1  MSSPTASSKRKRNRVPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLC 48

>KLLA0D00484g 44879..47893 no similarity, hypothetical start
          Length = 1004

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 28/42 (66%), Gaps = 3/42 (7%)

Query: 2  EEPAAKKQKKLY--KSCIFCRRSHVNCDHQRP-CSRCIKREI 40
          E+ + KK+K  Y  K C+ C+++H  CD ++P CSRC KR I
Sbjct: 55 EKLSTKKRKSTYSRKGCLQCKKAHTKCDERKPKCSRCEKRSI 96

>Sklu_2384.6 YKL015W, Contig c2384 10929-13424
          Length = 831

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 21/35 (60%)

Query: 7  KKQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIG 41
          K+QK+   +C+ CRR HV C    PCS+CI   I 
Sbjct: 39 KRQKRSSMACVRCRRRHVKCPGGNPCSKCIAANIA 73

>YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription factor
          with heme-dependent DNA-binding activity, responsible
          for heme-dependent activation of many genes [4509 bp,
          1502 aa]
          Length = 1502

 Score = 42.4 bits (98), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 7  KKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLC 44
          +K+ ++  SC  CR+  V CD  RP C +C K  + HLC
Sbjct: 55 RKRNRIPLSCTICRKRKVKCDKLRPHCQQCTKTGVAHLC 93

>KLLA0A02585g complement(226562..227674) some similarities with
          ca|CA5890|CaFCR1 Candida albicans Zinc cluster
          transcription factor, hypothetical start
          Length = 370

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 22/29 (75%)

Query: 9  QKKLYKSCIFCRRSHVNCDHQRPCSRCIK 37
          ++++ K+C  CR+S   CD +RPCSRC+K
Sbjct: 15 KRRVSKACDACRKSKTKCDGERPCSRCLK 43

>Kwal_23.6425
          Length = 735

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 3  EPAAKKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLCVADENVSN 52
          E  ++K++K  K C+FCR+  + CD  RP C  C  R +   CV  E  SN
Sbjct: 23 ELGSRKRRKSIKQCLFCRKRKLKCDKNRPVCGTCASRGLTE-CVYVERFSN 72

>Scas_709.51
          Length = 759

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%), Gaps = 1/38 (2%)

Query: 4  PAAKKQK-KLYKSCIFCRRSHVNCDHQRPCSRCIKREI 40
          P  KKQ+ ++ ++C  C+R  V CD  +PC  CIK+EI
Sbjct: 21 PERKKQRIRVQRACNICKRRKVKCDGNKPCLNCIKKEI 58

>Scas_573.4
          Length = 1478

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 7  KKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLC 44
          +K+ ++  SC  CR+  V CD  RP C +C K  + HLC
Sbjct: 34 RKRNRVPLSCTICRKRKVKCDKIRPHCQQCTKTGVAHLC 72

>AGL233C [4079] [Homologous to ScYKL222C - NSH; ScYOR172W - NSH]
          (260414..263032) [2619 bp, 872 aa]
          Length = 872

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 6  AKKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLCVADENVSNIQSQ 56
           K ++K+ KSC+FCR+  V C+  RP CS CI + +       E   ++ S+
Sbjct: 9  VKTRRKVSKSCVFCRKRRVKCNKARPKCSTCIGKGLPECVYLSEFTHDVNSR 60

>Kwal_23.3514
          Length = 579

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 19/33 (57%)

Query: 16 CIFCRRSHVNCDHQRPCSRCIKREIGHLCVADE 48
          C+ C +  V CD   PCS C+KR    LC+A E
Sbjct: 12 CVVCTKRKVKCDRNIPCSNCVKRGQQELCIASE 44

>KLLA0F10835g 997512..999782 no similarity, hypothetical start
          Length = 756

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 26/40 (65%), Gaps = 3/40 (7%)

Query: 5  AAKKQKKLY--KSCIFCRRSHVNCDHQRP-CSRCIKREIG 41
          + KK+K  Y  K C+ C+RSH+ CD  +P C +C+KR I 
Sbjct: 11 SGKKRKTRYSRKGCLQCKRSHLKCDEGQPKCGKCVKRNIS 50

>ACL195C [854] [Homologous to NOHBY] (19204..19533) [330 bp, 109
          aa]
          Length = 109

 Score = 37.4 bits (85), Expect = 0.004,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 4/38 (10%)

Query: 8  KQKKLYKSCIFCRRSHVNCD----HQRPCSRCIKREIG 41
          K KK  +SC+ CR++ + CD      +PCS C+K+ +G
Sbjct: 23 KMKKPLRSCVRCRKNKIKCDSATRRPKPCSSCLKKGVG 60

>CAGL0M05907g 622029..624704 similar to sp|P36023 Saccharomyces
           cerevisiae YKR064w, hypothetical start
          Length = 891

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 53/115 (46%), Gaps = 19/115 (16%)

Query: 1   MEEP--AAKKQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLCVADENV-----SNI 53
           MEEP    K +++    C+ CR+    CD Q PCS+CI+      C    +V     +N+
Sbjct: 1   MEEPKKVTKSRRRPMLVCVNCRKRKSKCDRQLPCSKCIQHGDTDTCTYLNDVPIGKKNNV 60

Query: 54  QSQYQYKNSMSPIGSTEIPNAEINIGD-ETRAIQGS--------NSSVYGTETPI 99
            +     NS SP   + + N   N  D +T+ + G         N++++G  +PI
Sbjct: 61  PNTQVTPNSSSP---SIVINLHQNGNDYKTKNLNGQDNTLLKEINNNIWGRNSPI 112

>YOR172W (YRM1) [4969] chr15 (654210..656570) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [2361 bp, 786 aa]
          Length = 786

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 23/34 (67%), Gaps = 1/34 (2%)

Query: 6  AKKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKR 38
          A+K++K  KSC FCR+  + CD Q+P CS C  R
Sbjct: 21 AQKRRKPIKSCAFCRKRKLRCDQQKPMCSTCKTR 54

>YDR421W (ARO80) [1245] chr4 (1312028..1314880) Positive
           transcription regulator of ARO9 and ARO10, member of the
           Zn2Cys6 transcription factor family [2853 bp, 950 aa]
          Length = 950

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 47/101 (46%), Gaps = 22/101 (21%)

Query: 8   KQKKLYKSCIFCRRSHVNCD-------HQRPCSRCIKREIGHLCVADENVSNIQSQYQYK 60
           K+++ Y++CI CR   V CD       H  PC+RC KRE+   C+   N           
Sbjct: 17  KRRRTYQACISCRSRKVKCDLGPVDNPHDPPCARC-KRELKK-CIFSSNKGT-------S 67

Query: 61  NSMSP--IGSTEIPNAEINIGDETRAIQGSNSSVYGTETPI 99
           N + P  I +  +P    ++G   + IQ  ++S   ++ P+
Sbjct: 68  NDLPPNSINAISLP----SLGKSKQEIQNDSTSPILSDVPL 104

>KLLA0F09559g complement(876719..878695) some similarities with
           sgd|S0005698 Saccharomyces cerevisiae YOR172w,
           hypothetical start
          Length = 658

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 6   AKKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLCVAD 47
            +K++K+ KSC FCR+  + CD +RP C+ C  R +      D
Sbjct: 80  VRKRRKVIKSCTFCRKRKLKCDRKRPMCTGCKMRGLSECVYTD 122

>YLR266C (PDR8) [3660] chr12 complement(675621..677726)
          Zn[2]-Cys[6] zinc finger transcription factor, likely
          involved in pleiotropic drug response [2106 bp, 701 aa]
          Length = 701

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 18/74 (24%)

Query: 8  KQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLCVADENVSNIQSQYQYKNSMSPI 66
          K++K+ KSC FCR+  + C   RP C +C+ R++   CV  E       ++ Y     P+
Sbjct: 23 KRRKVIKSCAFCRKRKLKCSQARPMCQQCVIRKLPQ-CVYTE-------EFNY-----PL 69

Query: 67 GSTE----IPNAEI 76
           +TE    +PN  +
Sbjct: 70 SNTELFEQVPNVAL 83

>Scas_663.12
          Length = 944

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 26/42 (61%), Gaps = 3/42 (7%)

Query: 7  KKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLCVAD 47
          KK+ +L   C  CRRS V CD ++P CSRC K ++   CV D
Sbjct: 31 KKRYRLSFVCQGCRRSKVKCDQEKPVCSRCSKHDLE--CVYD 70

>CAGL0L04576g 526960..529557 similar to tr|Q12340 Saccharomyces
          cerevisiae YOR172w, hypothetical start
          Length = 865

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 2/38 (5%)

Query: 14 KSCIFCRRSHVNCDHQRP-CSRCIKREIGHLCVADENV 50
          ++C FCRR  + CD+ RP CS C+ R+    C+ ++ V
Sbjct: 38 RTCAFCRRRKLKCDNARPMCSTCVSRKFS-TCIYEDTV 74

>Sklu_2064.2 , Contig c2064 873-3641
          Length = 922

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 27/50 (54%), Gaps = 5/50 (10%)

Query: 1  MEEPAAKKQKK--LYKSCIFCRRSHVNCDHQRPCSRCIK-REIGHLCVAD 47
          ME    K QK+  L   C+ CRR  + CD QRPC  CI+  E G  CV D
Sbjct: 8  MEYSVGKVQKRNRLSFVCLECRRRKIKCDKQRPC--CIQCAEQGLTCVYD 55

>KLLA0F22880g 2123577..2127071 some similarities with
          ca|CA3639|IPF9251 Candida albicans unknown function,
          hypothetical start
          Length = 1164

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 38/78 (48%), Gaps = 16/78 (20%)

Query: 10 KKLYKSCIFCRRSHVNCDHQRP-CSRCI-------------KREIGHLCVADENVSN--I 53
          KK  KSC+ CRR  V CD  +P C  C+             KRE+  + +   +VSN  +
Sbjct: 3  KKNGKSCLVCRRRKVRCDRAKPVCLVCVKHGSNMECNYEVQKREVKFVSMKTPDVSNPRM 62

Query: 54 QSQYQYKNSMSPIGSTEI 71
          + Q  +K S+   GST +
Sbjct: 63 KKQKSFKYSIPFSGSTTV 80

>Scas_674.12*
          Length = 909

 Score = 38.1 bits (87), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 7/75 (9%)

Query: 16 CIFCRRSHVNCDHQRP-CSRCIKREIGHLCVADENVSNIQSQYQYKNSMSPIGSTEIPNA 74
          C+ CR   V CD  RP C RC  R+   LCV + +   +  Q+   ++ S   +T     
Sbjct: 15 CLVCRSKKVKCDKARPSCGRC--RKTNKLCVYEIDTDQLAGQFDEGSATSSNANTN---- 68

Query: 75 EINIGDETRAIQGSN 89
          E+ I   T A   SN
Sbjct: 69 EMAITPATSATSSSN 83

>ACR028C [1076] [Homologous to NOHBY] (408701..410506) [1806 bp,
          601 aa]
          Length = 601

 Score = 37.7 bits (86), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 24/37 (64%), Gaps = 3/37 (8%)

Query: 7  KKQKKLY--KSCIFCRRSHVNCDHQRP-CSRCIKREI 40
          KK+K  Y  K C+ C++SH  CD  +P C +C+KR +
Sbjct: 10 KKRKSPYSRKGCLQCKKSHTKCDETKPACLKCVKRNV 46

>KLLA0E18194g 1613115..1615712 similar to sp|P25502 Saccharomyces
          cerevisiae YKL015w PUT3 positive activator of the
          proline utilisation pathway, start by similarity
          Length = 865

 Score = 37.7 bits (86), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 20/35 (57%)

Query: 7  KKQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIG 41
          KK K+   +C  CRR H+ C    PCS+C+K  + 
Sbjct: 37 KKVKRSSLACTRCRRRHIKCPGGNPCSKCLKAGVA 71

>CAGL0L03377g complement(382932..386561) some similarities with
          sp|P46954 Saccharomyces cerevisiae YJL089w SIP4
          interacts with SNF1 protein kinase, hypothetical start
          Length = 1209

 Score = 37.4 bits (85), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 2/46 (4%)

Query: 6  AKKQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLCVADENVS 51
           + +K+  ++C  CR   + CD  +PCS C K  IG+ CV  + +S
Sbjct: 19 TRTKKRHSQACDRCRSKKIKCDGLQPCSNCAK--IGYNCVTSDKLS 62

>CAGL0J07150g complement(686734..689802) similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor or sp|P52960
          Saccharomyces cerevisiae YOR363c PIP2, hypothetical
          start
          Length = 1022

 Score = 37.0 bits (84), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 3/43 (6%)

Query: 6  AKKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLCVAD 47
          +KK+ +L   C  CR++   CD ++P CSRC+K   G  CV D
Sbjct: 13 SKKRNRLSFVCQGCRKAKTKCDKEKPACSRCLKH--GIRCVYD 53

>YBR297W (MAL33) [474] chr2 (800479..801885) Maltose fermentation
          regulatory protein, has a Zn[2]-Cys[6] fungal-type
          binuclear cluster domain [1407 bp, 468 aa]
          Length = 468

 Score = 37.0 bits (84), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 13/71 (18%)

Query: 15 SCIFCRRSHVNCDHQRPCSRCIKREIGHLCVADENVSNIQSQYQYKNSMSPIGSTE---I 71
          +C +CR   V CD ++PCSRCI          + N      Q   K    PIG+     I
Sbjct: 7  ACDYCRVRRVKCDGKKPCSRCI----------EHNFDCTYQQPLKKRGSKPIGTRSLKYI 56

Query: 72 PNAEINIGDET 82
          P A++ I +++
Sbjct: 57 PKAKMFIDNKS 67

>KLLA0A06039g 557368..559341 weakly similar to sp|P36023
          Saccharomyces cerevisiae YKR064w singleton, start by
          similarity
          Length = 657

 Score = 36.6 bits (83), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 36/73 (49%), Gaps = 11/73 (15%)

Query: 6  AKKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLCV----ADENVSNIQSQYQYK 60
           KK+ +    C+ CRR    CD  +P CS C+K  +G  CV     DEN S  + +Y+Y 
Sbjct: 11 VKKRHRPTLVCLNCRRRKTKCDRGKPSCSNCLK--LGETCVYSEDTDENASK-KVRYEY- 66

Query: 61 NSMSPIGSTEIPN 73
            M  +G  E  N
Sbjct: 67 --MDDLGLPEFIN 77

>Sklu_1993.2 YIL130W, Contig c1993 2139-4610 reverse complement
          Length = 823

 Score = 37.0 bits (84), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 23/35 (65%), Gaps = 1/35 (2%)

Query: 1  MEEPAAKKQKKLYKSCIFCRRSHVNCDHQRPCSRC 35
          M EP +K+ +++ ++C  CR+  V CD Q+PC  C
Sbjct: 1  MSEPQSKR-RRVTRACDECRKKKVKCDGQQPCIHC 34

>YNR063W (YNR063W) [4646] chr14 (746940..748763) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [1824 bp, 607 aa]
          Length = 607

 Score = 36.6 bits (83), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 12/45 (26%), Positives = 23/45 (51%)

Query: 1  MEEPAAKKQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLCV 45
          M+     +++ +  +C  CR+  + CD  +PC RCI+      C+
Sbjct: 1  MDRSKDARKRSISLACTVCRKRKLKCDGNKPCGRCIRLNTPKECI 45

>CAGL0F09229g complement(908186..910693) weakly similar to
          sp|P39961 Saccharomyces cerevisiae YER184c,
          hypothetical start
          Length = 835

 Score = 36.6 bits (83), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 5/41 (12%)

Query: 1  MEEPAAKKQK-----KLYKSCIFCRRSHVNCDHQRPCSRCI 36
          M  P AKK K     ++ ++C  CR+  V CD  +PCS C+
Sbjct: 1  MAPPLAKKAKLAGKDRVIRACDVCRKRKVKCDGDQPCSSCM 41

>Sklu_2411.11 YMR019W, Contig c2411 20506-22569 reverse complement
          Length = 687

 Score = 36.2 bits (82), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 15/63 (23%), Positives = 33/63 (52%), Gaps = 13/63 (20%)

Query: 5  AAKKQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLCVADENVSNIQSQYQYKNSMS 64
           +K++ ++ K+C  C++  + CD  +PC+ C K             +++Q  Y++ ++ S
Sbjct: 17 GSKQRLRVRKACEICKKRKIKCDGHQPCTSCTK-------------NSVQCVYKFTDTAS 63

Query: 65 PIG 67
          PI 
Sbjct: 64 PIS 66

>KLLA0F19602g complement(1814949..1816760) similar to sp|P43634
          Saccharomyces cerevisiae YLR098c CHA4 transcription
          factor, start by similarity
          Length = 603

 Score = 36.2 bits (82), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 25/43 (58%)

Query: 6  AKKQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLCVADE 48
           K+++K + +C  CR     CD +RPCS C+K  I  + V ++
Sbjct: 7  GKRKRKAHLACQNCRIKRRKCDMERPCSNCLKYGIECITVNND 49

>KLLA0D09977g complement(841852..843756) weakly similar to
          sp|P40969 Saccharomyces cerevisiae YMR168c CEP3
          kinetochore protein complex, 71 KD subunit singleton,
          start by similarity
          Length = 634

 Score = 36.2 bits (82), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 1/37 (2%)

Query: 16 CIFCRRSHVNCDHQRP-CSRCIKREIGHLCVADENVS 51
          C FC+   V CD   P C  CI+R +  LC  D+N S
Sbjct: 15 CTFCQARKVKCDRSLPACQNCIERNVTELCEYDDNGS 51

>Kwal_47.18089
          Length = 745

 Score = 35.8 bits (81), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%)

Query: 15 SCIFCRRSHVNCDHQRP-CSRCIKREIGHLCVAD 47
          SC FCR   + CDH+RP C  C  R++      D
Sbjct: 28 SCTFCRHRKLKCDHKRPMCGSCAARKLPECIYVD 61

>KLLA0A03421g 308414..311056 weakly similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor, start by similarity
          Length = 880

 Score = 35.8 bits (81), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 3/43 (6%)

Query: 6  AKKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLCVAD 47
          AKK+ KL   C  CR+S   CD ++P C+RC  + +   C+ D
Sbjct: 11 AKKRYKLSFVCQLCRKSKTKCDRKKPSCARC--QRLNKPCIYD 51

>CAGL0G09757g 930351..934622 some similarities with sp|Q05854
          Saccharomyces cerevisiae YLR278c, hypothetical start
          Length = 1423

 Score = 35.8 bits (81), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%)

Query: 7  KKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREI 40
          K +K   +SC+ CRR    CDH+ P C+ C+K  +
Sbjct: 32 KDKKGRSRSCLLCRRRKQRCDHKLPSCTACLKAAV 66

>ADR405C [2145] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1435705..1438128) [2424 bp, 807 aa]
          Length = 807

 Score = 35.8 bits (81), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 3/41 (7%)

Query: 8  KQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLCVAD 47
          ++ KL   C  CRRS   CD  +P C+RC+K   G +CV D
Sbjct: 31 RRNKLSFVCQSCRRSKTKCDKVKPSCTRCVKN--GSVCVYD 69

>Scas_659.10
          Length = 757

 Score = 35.8 bits (81), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (67%), Gaps = 1/34 (2%)

Query: 7  KKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKRE 39
          K+++K  KSC FCR   + CD  +P C++C+ R+
Sbjct: 12 KRRRKPIKSCAFCRGRKLKCDKNKPICNQCLMRK 45

>Scas_556.6
          Length = 1022

 Score = 35.8 bits (81), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 3/42 (7%)

Query: 7  KKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLCVAD 47
          KK+ ++   C  CR++   CD ++P C+RC+K+ +   CV D
Sbjct: 37 KKRNRISFVCQECRKAKTKCDKEKPACTRCVKQNLA--CVYD 76

>KLLA0D10153g 858016..859983 weakly similar to sp|P35995
          Saccharomyces cerevisiae YKL222c, hypothetical start
          Length = 655

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 6/51 (11%)

Query: 7  KKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLCVADENVSNIQSQ 56
          K + K  +SC+ C+R    CD + P CS C+K+  G+ C+ +    N+QSQ
Sbjct: 3  KSRNKPTRSCLMCQRRKKKCDRKAPSCSACLKK--GYECIYN---VNLQSQ 48

>YLR278C (YLR278C) [3671] chr12 complement(700001..704026) Protein
          with similarity to transcription factors, contains an
          N-terminal Zn[2]-Cys[6] fungal-type binuclear cluster
          domain [4026 bp, 1341 aa]
          Length = 1341

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 3/33 (9%)

Query: 14 KSCIFCRRSHVNCDHQRP-CSRCIKREIGHLCV 45
          +SC+ CRR    CDH+ P C+ C+K  I   CV
Sbjct: 39 RSCLLCRRRKQRCDHKLPSCTACLKAGIK--CV 69

>Scas_717.33
          Length = 904

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 9/45 (20%)

Query: 8  KQKKLYKSCIFCRRSHVNCD-------HQRPCSRCIKREIGHLCV 45
          K ++ +++CI CR   V CD       H+ PC RC +RE G  C+
Sbjct: 26 KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRC-RRE-GKTCI 68

>Sklu_2434.10 YAL051W, Contig c2434 22765-25716
          Length = 983

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 8/57 (14%)

Query: 6  AKKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLCVADENVSNIQSQYQYKN 61
          + K+ ++   C  CR+S   CD ++P C+RCIK  I       E V +I+ Q Q +N
Sbjct: 18 SSKRNRISFVCKACRKSKTKCDREKPSCTRCIKNGI-------ECVYDIEQQTQPRN 67

>Scas_590.2
          Length = 1172

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 1/27 (3%)

Query: 15 SCIFCRRSHVNCDHQRP-CSRCIKREI 40
          +C+ CRR    CDHQ P C+ C+K  +
Sbjct: 40 ACLLCRRRKQKCDHQLPSCTACLKAAV 66

>Kwal_14.915
          Length = 822

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 4/39 (10%)

Query: 1  MEEPAAKKQKKLYK----SCIFCRRSHVNCDHQRPCSRC 35
          MEE  +K  K+  K    +C+ CRR H  C    PC+ C
Sbjct: 30 MEEIGSKGVKRSIKRSGLACVRCRRRHAKCSGDNPCTTC 68

>YOR363C (PIP2) [5140] chr15 complement(1020218..1023208)
          Transcription factor required for induction of
          peroxisomal proteins in response to oleic acid [2991
          bp, 996 aa]
          Length = 996

 Score = 34.7 bits (78), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 3/44 (6%)

Query: 5  AAKKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLCVAD 47
            KK+ +L   C  CR++   CD ++P C RC K+ +   C+ D
Sbjct: 14 VGKKRNRLSFVCQACRKAKTKCDQEKPRCGRCTKQNL--FCIYD 55

>YKL015W (PUT3) [3241] chr11 (408187..411126) Transcription factor
          that activates the proline utilization pathway genes,
          contains a Zn[2]-Cys[6] fungal-type binuclear cluster
          domain in the N-terminal region [2940 bp, 979 aa]
          Length = 979

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 19/30 (63%)

Query: 7  KKQKKLYKSCIFCRRSHVNCDHQRPCSRCI 36
          K+Q++   +C+ CR+ H+ C    PC +C+
Sbjct: 25 KRQQRSSVACLSCRKRHIKCPGGNPCQKCV 54

>Scas_526.3
          Length = 1109

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 14 KSCIFCRRSHVNCDHQRP-CSRCIKREI 40
          +SC+ CRR    CDH+ P C+ C+K  +
Sbjct: 39 RSCLLCRRRKQRCDHKMPSCTACLKAAV 66

>KLLA0D05038g 433653..435674 weakly similar to sp|P40971
          Saccharomyces cerevisiae YDR034c LYS14 transcriptional
          activator of lysine pathway genes singleton, start by
          similarity
          Length = 673

 Score = 34.3 bits (77), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 3  EPAAKKQKKLYKSCIFCRRSHVNCDHQRP-CSRC 35
          EPA KK+K     C+ C+R  V CD  +P C +C
Sbjct: 15 EPAKKKRKYSKNGCLECKRKKVKCDETKPMCWQC 48

>ACL096W [953] [Homologous to ScYKL015W (PUT3) - SH]
          complement(169508..172015) [2508 bp, 835 aa]
          Length = 835

 Score = 34.3 bits (77), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 19/34 (55%)

Query: 2  EEPAAKKQKKLYKSCIFCRRSHVNCDHQRPCSRC 35
          EE   +  K+   +C+ CRR HV C    PC++C
Sbjct: 47 EERNKRPAKRAPLACLRCRRRHVRCPGGTPCAKC 80

>Scas_662.8
          Length = 906

 Score = 34.3 bits (77), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 19/28 (67%)

Query: 8  KQKKLYKSCIFCRRSHVNCDHQRPCSRC 35
          K++++ ++C  CR+  V CD Q+PC  C
Sbjct: 29 KRRRVTRACDECRKKKVKCDGQQPCIHC 56

>KLLA0D10593g complement(900326..903103) similar to sp|P08638
          Saccharomyces cerevisiae YLR451w LEU3 transcription
          factor, hypothetical start
          Length = 925

 Score = 34.3 bits (77), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 27/42 (64%), Gaps = 8/42 (19%)

Query: 8  KQKKLYKSCIFCRRSHVNCD-HQR---PCSRCIKREIGHLCV 45
          ++KKL  +C+ CR+    CD H+R   PCSRC+K+  G  CV
Sbjct: 43 QKKKL--ACVECRQQKSKCDAHERAPEPCSRCLKK--GVPCV 80

>YIL130W (YIL130W) [2546] chr9 (102782..105676) Protein that
          contains a Zn[2]-Cys[6] fungal-type binuclear cluster
          domain in the N-terminal region, putative transcription
          factor [2895 bp, 964 aa]
          Length = 964

 Score = 34.3 bits (77), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 19/28 (67%)

Query: 8  KQKKLYKSCIFCRRSHVNCDHQRPCSRC 35
          K++++ ++C  CR+  V CD Q+PC  C
Sbjct: 13 KRRRVTRACDECRKKKVKCDGQQPCIHC 40

>KLLA0A01804g complement(159689..162526) similar to sgd|S0002829
          Saccharomyces cerevisiae YDR421w positive transcription
          regulator of ARO9 and ARO10, start by similarity
          Length = 945

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 24/44 (54%), Gaps = 10/44 (22%)

Query: 5  AAKKQ--KKLYKSCIFCRRSHVNCD-------HQRPCSRCIKRE 39
          A KKQ  K+ YK+C+ C+   V CD       H  PC RC KRE
Sbjct: 11 APKKQTFKRGYKACLNCKMRKVKCDLGPFDNPHGPPCVRC-KRE 53

>AGL361C [3951] [Homologous to NOHBY] (24101..26191) [2091 bp, 696
          aa]
          Length = 696

 Score = 33.9 bits (76), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 5/47 (10%)

Query: 1  MEEPAAKKQKKLY--KSCIFCRRSHVNCDHQRP-CSRCIKREIGHLC 44
          +E   +KK K  Y  K C  C++SH+ CD  +P C+ C K+ I  LC
Sbjct: 44 LETLKSKKPKVQYSRKGCSQCKKSHIKCDKVQPLCTTCAKKNI--LC 88

>Kwal_23.4754
          Length = 812

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 19/28 (67%)

Query: 8  KQKKLYKSCIFCRRSHVNCDHQRPCSRC 35
          K++++ ++C  CR+  V CD Q+PC  C
Sbjct: 7  KRRRVTRACDECRKKKVKCDGQQPCIHC 34

>ADR199C [1940] [Homologous to ScYDR421W (ARO80) - SH]
          (1048530..1051364) [2835 bp, 944 aa]
          Length = 944

 Score = 33.9 bits (76), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 7/38 (18%)

Query: 5  AAKKQKKLYKSCIFCRRSHVNCD-------HQRPCSRC 35
          + +K +++YK+C+ CR   V CD        + PC RC
Sbjct: 21 SGRKWRRIYKACLNCRTRKVRCDLGPVDKPREPPCVRC 58

>KLLA0D11286g complement(964642..966678) no similarity,
          hypothetical start
          Length = 678

 Score = 33.9 bits (76), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 9  QKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREI 40
          +K+  KSCI C      CDH++P C+RC K+ +
Sbjct: 19 RKRTPKSCIRCYSIKRKCDHKKPSCTRCFKKSL 51

>CAGL0M12298g complement(1225753..1228737) similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor or sp|P52960
          Saccharomyces cerevisiae YOR363c PIP2, hypothetical
          start
          Length = 994

 Score = 33.9 bits (76), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 3/43 (6%)

Query: 6  AKKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLCVAD 47
           +K+ ++   C  CRRS   CD ++P C+RC K ++   CV D
Sbjct: 17 TRKRNRISFVCQACRRSKTRCDKEKPICTRCKKLKLE--CVYD 57

>KLLA0B04840g 439864..442179 weakly similar to ca|CA4996|IPF2029
          Candida albicans unknown function, hypothetical start
          Length = 771

 Score = 33.5 bits (75), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 4/47 (8%)

Query: 10 KKLYKSCIFCRRSHVNCDHQR--PCSRCIKREIGHLCVADENVSNIQ 54
          KK  K CI C+ S V C++    PC RC+K  +G  C    +V  +Q
Sbjct: 6  KKRTKPCISCKLSKVKCEYTEALPCKRCLK--LGIHCQFVRDVRRVQ 50

>KLLA0F02387g complement(213669..215852) similar to sp|P47988
          Saccharomyces cerevisiae YOR337w TEA1 TY1 enhancer
          activator, start by similarity
          Length = 727

 Score = 33.5 bits (75), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 7/42 (16%)

Query: 3  EPAAKKQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLC 44
          EP AK+      +C  CRR    CD + PC RC  +E+G  C
Sbjct: 33 EPPAKRL-----ACANCRRRRKKCDLEYPCGRC--QELGLGC 67

>KLLA0C14212g complement(1229219..1232341) some similarities with
           sp|P25611 Saccharomyces cerevisiae YCR106w, hypothetical
           start
          Length = 1040

 Score = 33.5 bits (75), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 32/71 (45%), Gaps = 2/71 (2%)

Query: 8   KQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLCVADENVSNIQSQYQYKNSMSPIG 67
           K+ ++   C  CRR    CD   PCS+C+   +   CV   +  N  ++      ++   
Sbjct: 67  KRNRVSYVCYACRRRKTRCDRGNPCSKCV--ALSTECVYSISEMNNGNKVSATQVLAETS 124

Query: 68  STEIPNAEINI 78
            T +PN+  +I
Sbjct: 125 GTALPNSTADI 135

>ADR403C [2143] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1429118..1432030) [2913 bp, 970 aa]
          Length = 970

 Score = 33.5 bits (75), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 3/41 (7%)

Query: 8  KQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLCVAD 47
          K+ ++   C  CR+S   CD ++P CSRC K  +   CV D
Sbjct: 24 KRNRISFVCQACRKSKTKCDREKPRCSRCAKNNVK--CVYD 62

>YPR196W (YPR196W) [5609] chr16 (931370..932782) Positive
          regulator of the maltose pathway MAL genes, contains a
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [1413 bp, 470 aa]
          Length = 470

 Score = 33.1 bits (74), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 16/27 (59%)

Query: 14 KSCIFCRRSHVNCDHQRPCSRCIKREI 40
          +SC  CR   V CD  RPC RC +R +
Sbjct: 6  QSCDCCRVRRVKCDRNRPCDRCRQRNL 32

>YAL051W (OAF1) [17] chr1 (48565..51753) Transcription factor
          required for induction of SPS19 and POX1 on
          oleate-containing medium, plays a role in peroxisome
          proliferation [3189 bp, 1062 aa]
          Length = 1062

 Score = 33.1 bits (74), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 3/46 (6%)

Query: 3  EPAAKKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLCVAD 47
          E   +K+ ++   C  C +S   CD ++P C RC+K   G  CV D
Sbjct: 53 ETHNRKRNRILFVCQACWKSKTKCDREKPECGRCVKH--GLKCVYD 96

>Scas_702.7
          Length = 1113

 Score = 33.1 bits (74), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 7  KKQKKLYKSCIFCRRSHVNCDHQRPCSRC 35
          + +KK+ K+C  CRR  + C    PCS C
Sbjct: 28 RPRKKVSKACANCRRRKIKCTGTYPCSNC 56

>AFL200W [2995] [Homologous to ScYMR168C (CEP3) - SH]
          complement(60109..61899) [1791 bp, 596 aa]
          Length = 596

 Score = 32.7 bits (73), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 14/25 (56%)

Query: 14 KSCIFCRRSHVNCDHQRPCSRCIKR 38
          K C  C +  V CD   PC+ C+KR
Sbjct: 10 KPCAVCIKRKVKCDRLVPCTNCVKR 34

>KLLA0A03443g 311628..314555 weakly similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor, start by similarity
          Length = 975

 Score = 32.7 bits (73), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 3/44 (6%)

Query: 5  AAKKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLCVAD 47
           A K++++   C  CR++   CD ++P C RC+K  +   CV D
Sbjct: 24 GACKRQRISFVCQACRKNKTKCDREKPRCGRCVKYHLK--CVYD 65

>CAGL0D02904g complement(302952..305615) similar to sp|P07272
          Saccharomyces cerevisiae YLR014c PPR1 transcription
          factor regulating pyrimidine pathway, hypothetical
          start
          Length = 887

 Score = 32.7 bits (73), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 3/49 (6%)

Query: 4  PAAKKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLCVADENVS 51
          P   K  K   +C  CRR  V CD   P C  C++  +   CV+ + V+
Sbjct: 13 PGGVKFTKFPNACKLCRRKKVKCDQGYPSCKGCLRNNVP--CVSVDPVT 59

>KLLA0D10197g complement(861726..864296) similar to sp|P05085
          Saccharomyces cerevisiae YML099c ARG81 transcription
          factor involved in arginine metabolism singleton, start
          by similarity
          Length = 856

 Score = 32.7 bits (73), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 3/40 (7%)

Query: 6  AKKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLC 44
          AK + K +  C  CR   V CD +RP C RC K   G +C
Sbjct: 4  AKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKG--GLIC 41

>AGR280C [4591] [Homologous to ScYLR278C - SH] (1266918..1270238)
          [3321 bp, 1106 aa]
          Length = 1106

 Score = 32.7 bits (73), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 1/35 (2%)

Query: 7  KKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREI 40
          K +K   +SC+ C+R    CDH+ P C+ C+K  +
Sbjct: 32 KDKKGRSRSCLLCQRRKQRCDHKIPSCTACLKAGV 66

>KLLA0F04609g complement(451579..454329) similar to sp|P40467
          Saccharomyces cerevisiae YIL130w, start by similarity
          Length = 916

 Score = 32.7 bits (73), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 19/28 (67%)

Query: 8  KQKKLYKSCIFCRRSHVNCDHQRPCSRC 35
          K++++ ++C  CR+  V CD ++PC  C
Sbjct: 6  KRRRVTRACDECRKKKVKCDGKQPCIHC 33

>Kwal_34.15751
          Length = 628

 Score = 32.7 bits (73), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 2/41 (4%)

Query: 1  MEEPAAKKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREI 40
          M+ P +KK + +   C  CR   + C+ Q+P CSRC+K ++
Sbjct: 1  MQTPKSKKNR-ISHVCDACRIRKLKCNKQKPSCSRCVKHDL 40

>YOR380W (RDR1) [5153] chr15 (1051286..1052926) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [1641 bp, 546 aa]
          Length = 546

 Score = 32.3 bits (72), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 3/59 (5%)

Query: 8  KQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLC-VADENVSNIQSQYQYKNSMSP 65
          K++++ K+C+ CR     C+ + PC  C+    G++C   D  V +   Q Q     SP
Sbjct: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVA--YGYVCHYIDGRVPSASPQVQQVGETSP 68

>CAGL0L09691g complement(1039799..1042273) some similarities with
          sp|P25502 Saccharomyces cerevisiae YKL015w PUT3
          positive activator of the proline utilisation pathway,
          hypothetical start
          Length = 824

 Score = 32.7 bits (73), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 8/22 (36%), Positives = 15/22 (68%)

Query: 15 SCIFCRRSHVNCDHQRPCSRCI 36
          +C+ CR+ H+ C    PC++C+
Sbjct: 27 ACLRCRQKHIKCPGGNPCAKCV 48

>Kwal_47.17565
          Length = 628

 Score = 32.3 bits (72), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 31/75 (41%), Gaps = 18/75 (24%)

Query: 8  KQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLCVADENVSNIQSQYQYKNSMSPIG 67
          K+ +  K+C +C    + C+ Q PC  C +  I   CV           Y +K S    G
Sbjct: 5  KRHRSIKTCKYCYEHKLKCNKQSPCDNCTRLGITSHCV-----------YGFKRS----G 49

Query: 68 STEIPNAEINIGDET 82
           + +P    N+G  T
Sbjct: 50 ESSVPT---NVGKRT 61

>CAGL0G08844g complement(846590..849133) similar to sp|P40467
          Saccharomyces cerevisiae YIL130w, hypothetical start
          Length = 847

 Score = 32.3 bits (72), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 18/28 (64%)

Query: 8  KQKKLYKSCIFCRRSHVNCDHQRPCSRC 35
          K++K+ ++C  CR+  V CD  +PC  C
Sbjct: 12 KRRKVTRACDDCRKKKVKCDGNQPCIHC 39

>AER183C [2685] [Homologous to ScYOL089C (HAL9) - NSH]
           (975879..978518) [2640 bp, 879 aa]
          Length = 879

 Score = 32.3 bits (72), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 21/41 (51%)

Query: 1   MEEPAAKKQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIG 41
           M E     +K++ K+C  CR   + C+ + PC  C K  +G
Sbjct: 66  MTETKTVMRKRVSKACDICRAKKIRCNGEEPCVNCEKFNLG 106

>ADR404C [2144] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1432323..1434950) [2628 bp, 875 aa]
          Length = 875

 Score = 32.3 bits (72), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 3/40 (7%)

Query: 9  QKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLCVAD 47
          ++KL   CI CR+    CD  +P CSRC   E+G  C  D
Sbjct: 17 KRKLSYVCIPCRKCKTKCDKLKPTCSRC--AELGLYCGYD 54

>Kwal_26.6805
          Length = 944

 Score = 32.3 bits (72), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 3/41 (7%)

Query: 8  KQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLCVAD 47
          ++ +L   C  CR+    CD  +P CSRC+K   G  CV D
Sbjct: 21 RRNRLSFVCQSCRKGKTKCDRAKPSCSRCLKH--GIRCVYD 59

>YKL222C (YKL222C) [3053] chr11 complement(3504..5621) Protein
          with similarity to transcription factors, has
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [2118 bp, 705 aa]
          Length = 705

 Score = 32.0 bits (71), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 2/55 (3%)

Query: 7  KKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLCVADENVSNIQSQYQYK 60
          + ++K  KSC FCR   + CD  RP C  C  R     C   EN S ++ Q + K
Sbjct: 15 QSRRKPAKSCHFCRVRKLKCDRVRPFCGSCSSRNRKQ-CEYKENTSAMEDQLRKK 68

>YGR288W (MAL13) [2233] chr7 (1070298..1071719) Maltose pathway
          regulatory protein, contains a Zn[2]-Cys[6] fungal-type
          binuclear cluster domain [1422 bp, 473 aa]
          Length = 473

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 19/33 (57%)

Query: 8  KQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREI 40
          KQ    ++C  CR   V CD +RPCS C++  +
Sbjct: 5  KQTCAKQACDCCRIRRVKCDGKRPCSSCLQNSL 37

>YOL089C (HAL9) [4731] chr15 complement(150397..153489) Protein
           involved in salt tolerance, has similarity to
           transcription factors, contains a Zn[2]-Cys[6]
           fungal-type binuclear cluster domain in the N-terminal
           region [3093 bp, 1030 aa]
          Length = 1030

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 38/90 (42%), Gaps = 31/90 (34%)

Query: 9   QKKLYKSCIFCRRSHVNCD----HQRPCSRCI-------------------KREIGHLCV 45
           +K++ K+C  CR+  + CD      + CS CI                   K EI H   
Sbjct: 129 KKRVSKACDHCRKRKIRCDEVDQQTKKCSNCIKFQLPCTFKHRDEILKKKRKLEIKHHAT 188

Query: 46  ADENVSNIQSQYQYKNSMS-PIGSTEIPNA 74
             E++       Q  NS+S P+ S+ +PN+
Sbjct: 189 PGESL-------QTSNSISNPVASSSVPNS 211

>Kwal_14.2619
          Length = 1167

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 15/24 (62%), Gaps = 1/24 (4%)

Query: 15 SCIFCRRSHVNCDHQRP-CSRCIK 37
          SC+ CRR  V CD  +P C  CIK
Sbjct: 11 SCLTCRRRKVKCDRSKPVCLACIK 34

>YER184C (YER184C) [1612] chr5 complement(556291..558675) Protein
          with similarity to transcription factors, has
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [2385 bp, 794 aa]
          Length = 794

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 20/31 (64%)

Query: 6  AKKQKKLYKSCIFCRRSHVNCDHQRPCSRCI 36
          AK++ ++ K+C  C R  + C+ ++PC  CI
Sbjct: 8  AKQKSRVTKACDRCHRKKIKCNSKKPCFGCI 38

>KLLA0C04620g complement(422705..426514) weakly similar to
          sp|Q05854 Saccharomyces cerevisiae YLR278c, start by
          similarity
          Length = 1269

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 1/32 (3%)

Query: 7  KKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIK 37
          K +K   ++C+ C+R    CDH+ P C+ C+K
Sbjct: 32 KDKKGRSRACLLCQRRKQKCDHKIPSCTACLK 63

>AGR061C [4371] [Homologous to ScYLR098C (CHA4) - SH]
          (831058..832896) [1839 bp, 612 aa]
          Length = 612

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 1/54 (1%)

Query: 10 KKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLCVADENVSNIQSQYQYKNSM 63
          KKL  +C  CR+    CD Q PC  C K  +  L V D+++   +   QY  S+
Sbjct: 8  KKLKLACQTCRKRRRKCDLQVPCVNCQKFGVECLPV-DQDLRKKRYSAQYVQSL 60

>AER370W [2871] [Homologous to ScYIL130W (GIN1) - SH]
          complement(1320487..1322892) [2406 bp, 801 aa]
          Length = 801

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 18/28 (64%)

Query: 8  KQKKLYKSCIFCRRSHVNCDHQRPCSRC 35
          K++++ ++C  CR+  V CD + PC  C
Sbjct: 10 KRRRVTRACDECRKKKVKCDSRHPCIHC 37

>KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1
          Kluyveromyces lactis Sip4 protein, start by similarity
          Length = 717

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query: 5  AAKKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLCVADENVS 51
          A+ K K+  ++C  CR   + CD  +P CS C  ++IG+ C   + ++
Sbjct: 52 ASTKVKRFSQACDRCRLKKIKCDGIKPSCSNC--KKIGYHCSTSDKLT 97

>KLLA0C19228g 1713787..1715562 similar to sp|P53749 Saccharomyces
          cerevisiae YNR063w singleton, hypothetical start
          Length = 591

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 16/26 (61%)

Query: 15 SCIFCRRSHVNCDHQRPCSRCIKREI 40
          +C+ C++    CD Q+PC RC K  +
Sbjct: 2  ACLECKKRKQKCDGQKPCRRCTKLNV 27

>Scas_688.17
          Length = 769

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 21/46 (45%), Gaps = 3/46 (6%)

Query: 4  PAAKKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLCVADE 48
          P  K +K    +CI CR+  + CD   P C  CIK +       DE
Sbjct: 7  PTRKPKKN--PACIQCRKRKIGCDRGHPKCGNCIKLKRAQCIYPDE 50

>Scas_234.1
          Length = 337

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 20/40 (50%)

Query: 6  AKKQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLCV 45
          +KK+ +    C  C++    CD  RPCS C +   G  C+
Sbjct: 23 SKKRNRPTVVCTNCKKRKSKCDRGRPCSTCARLGDGDRCI 62

>Scas_669.8
          Length = 637

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 10/32 (31%), Positives = 19/32 (59%)

Query: 15 SCIFCRRSHVNCDHQRPCSRCIKREIGHLCVA 46
          +C  C++  V CD   PC+ CI++ + + C+ 
Sbjct: 15 ACNVCKKRKVKCDKLIPCTSCIQKGLENECLT 46

>KLLA0F02750g complement(250368..253814) some similarities with
          sgd|S0005449 Saccharomyces cerevisiae YOL089c HAL9
          transcriptional activator of ENA1, hypothetical start
          Length = 1148

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 4/36 (11%)

Query: 9  QKKLYKSCIFCRRSHVNCDHQRP----CSRCIKREI 40
          +K++ K+C  CRR  + CD   P    CS CIK ++
Sbjct: 27 KKRVSKACDRCRRRKIKCDDLDPVSGKCSNCIKYKV 62

>Scas_550.5*
          Length = 832

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 29/50 (58%), Gaps = 4/50 (8%)

Query: 1  MEEPAAKKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLCVADEN 49
          M++ + + Q+  +  C  CR   + C+ +RP CSRC  + IG  CV +++
Sbjct: 1  MQKKSIRGQRPTH-VCAACRTQKLRCNRERPSCSRC--QRIGRTCVYEKH 47

>ADR365W [2106] [Homologous to ScYOR337W (TEA1) - SH]
          complement(1355410..1357515) [2106 bp, 701 aa]
          Length = 701

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 8/45 (17%)

Query: 2  EEPAAKK------QKKLYKSCIFCRRSHVNCDHQRPCSRCIKREI 40
          EEPA ++      +K+L  +C  CRR    CD   PCS C++ ++
Sbjct: 29 EEPAERESYTGVSKKRL--ACTNCRRRRKKCDLNYPCSSCLRLKL 71

>Kwal_26.7095
          Length = 838

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 5/48 (10%)

Query: 3  EPAAKKQKKLYKS--CIFCRRSHVNCDHQRP-CSRCIKREIGHLCVAD 47
          EP   K+ ++ +S  C  C++  + CD  RP C RC K E+   CV D
Sbjct: 15 EPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELE--CVYD 60

>KLLA0F18084g complement(1652031..1654613) no similarity,
          hypothetical start
          Length = 860

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (66%), Gaps = 1/27 (3%)

Query: 15 SCIFCRRSHVNCDHQRP-CSRCIKREI 40
          SC  CR++   CD  +P C+RCIK +I
Sbjct: 4  SCQNCRKTRRKCDRGKPTCARCIKYKI 30

>CAGL0H01507g complement(147689..150073) similar to sp|Q06639
          Saccharomyces cerevisiae YDR303c RSC3, start by
          similarity
          Length = 794

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 22/53 (41%), Gaps = 6/53 (11%)

Query: 15 SCIFCRRSHVNCDHQRP-CSRCIKREIGHLCVADENVSNIQSQYQYKNSMSPI 66
          +C  CRR  V CD  RP C  C +   G     D     +  QY   N  SP+
Sbjct: 13 ACAQCRRRKVGCDRVRPVCGNCARAGKGDCFYPD-----VPGQYIQNNGGSPL 60

>KLLA0C03201g complement(286973..288925) similar to sp|P39529
          Saccharomyces cerevisiae YJL206c, start by similarity
          Length = 650

 Score = 30.8 bits (68), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 3/38 (7%)

Query: 3  EPAAKKQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREI 40
          EP   K K    +C  C+   V CD Q PC+ CI   +
Sbjct: 26 EPVRHKVKH---ACSSCKERKVRCDGQSPCASCINARV 60

>Scas_721.94
          Length = 869

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 17/35 (48%), Gaps = 1/35 (2%)

Query: 7  KKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREI 40
          K   K  + C  C+R  V CD  +P C RC+   +
Sbjct: 46 KFHNKSKQGCTHCKRRRVKCDELKPACRRCLNWNV 80

>Scas_449.1
          Length = 636

 Score = 30.4 bits (67), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 4/41 (9%)

Query: 8  KQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLCVADE 48
          K+K+L  +C  CRR    CD   PC+ CI+  +G  C  +E
Sbjct: 31 KRKRL--ACSNCRRRRKKCDLNFPCANCIR--LGLNCNVNE 67

>CAGL0F07865g complement(768270..770804) similar to tr|Q12151
          Saccharomyces cerevisiae YDR213w UPC2, start by
          similarity
          Length = 844

 Score = 30.4 bits (67), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 16/26 (61%), Gaps = 1/26 (3%)

Query: 16 CIFCRRSHVNCDHQRP-CSRCIKREI 40
          C  C+R  V CD  +P C +C+K ++
Sbjct: 54 CDHCKRRRVKCDEGKPMCDKCVKMKL 79

>Kwal_47.17506
          Length = 924

 Score = 30.4 bits (67), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 17/29 (58%)

Query: 7  KKQKKLYKSCIFCRRSHVNCDHQRPCSRC 35
          KK+ K+ ++C  CRR  + C   +PC  C
Sbjct: 10 KKRSKVSRACNNCRRRKIKCTGAQPCLNC 38

>CAGL0A00451g 47557..50880 similar to sp|P12383 Saccharomyces
          cerevisiae YGL013c PDR1 transcription factor,
          hypothetical start
          Length = 1107

 Score = 30.4 bits (67), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 21/34 (61%), Gaps = 1/34 (2%)

Query: 2  EEPAAKKQKKLYKSCIFCRRSHVNCDHQRPCSRC 35
          ++P+ ++ K + K+C  CRR  + C+  +PC  C
Sbjct: 18 QKPSTRRTK-VGKACDSCRRRKIKCNGLKPCPSC 50

>Scas_630.14
          Length = 701

 Score = 30.0 bits (66), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 1/49 (2%)

Query: 5  AAKKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLCVADENVSN 52
            +K+ ++ KSC  CR     CD  +P CS C+   I      D  +S+
Sbjct: 15 GIRKRNRVPKSCTVCRLRKSKCDRIKPYCSSCVLHGIKECRYDDRTISD 63

>Sklu_2335.6 YBL005W, Contig c2335 10191-13013
          Length = 940

 Score = 30.0 bits (66), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 17/31 (54%)

Query: 5  AAKKQKKLYKSCIFCRRSHVNCDHQRPCSRC 35
            K   K+ ++C  CRR  + C  ++PCS C
Sbjct: 17 VTKSSSKVSRACDNCRRRKIKCTGKQPCSNC 47

>YMR019W (STB4) [3983] chr13 (312155..315004) Sin3p-binding protein,
           contains a Zn[2]-Cys[6] fungal-type binuclear cluster
           domain in the N-terminal region [2850 bp, 949 aa]
          Length = 949

 Score = 30.0 bits (66), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 18/34 (52%)

Query: 6   AKKQKKLYKSCIFCRRSHVNCDHQRPCSRCIKRE 39
            K + ++ K+C  C++  V CD   PC  C K +
Sbjct: 77  GKGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQ 110

>Scas_702.7d
          Length = 978

 Score = 30.0 bits (66), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 41/90 (45%), Gaps = 18/90 (20%)

Query: 1  MEEPAAKKQKKLY--KSCIFCRRSHVNCDHQRPCSRCIKREI-GHLCVADENVSNIQSQY 57
          M   +  K KKL   ++C  CRR  + C   +PC  C   EI G LCV           +
Sbjct: 1  MVHTSNGKIKKLRSSRACSNCRRRKIKCSGIQPCPNC---EIYGCLCV-----------F 46

Query: 58 QYKNSMSPIGSTEIPN-AEINIGDETRAIQ 86
          +  N M+P+  +  P+  E + G+   +++
Sbjct: 47 EPVNGMTPMNFSSKPSETEFHHGNSMHSVK 76

>KLLA0A04169g complement(376273..378600) similar to sgd|S0004218
          Saccharomyces cerevisiae YLR228c ECM22, start by
          similarity
          Length = 775

 Score = 30.0 bits (66), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 16/35 (45%), Gaps = 1/35 (2%)

Query: 7  KKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREI 40
          K  KK    C  C+R  V CD  RP C  C K  +
Sbjct: 48 KFHKKSKNGCDHCKRRRVKCDETRPHCLNCKKMSL 82

>Kwal_23.6529
          Length = 598

 Score = 30.0 bits (66), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 10/24 (41%), Positives = 17/24 (70%), Gaps = 1/24 (4%)

Query: 16 CIFCRRSHVNCDHQRP-CSRCIKR 38
          CI C++S + CD ++P C +C K+
Sbjct: 14 CINCKKSKIKCDEKKPMCGQCAKK 37

>Sklu_2376.6 , Contig c2376 12573-15341 reverse complement
          Length = 922

 Score = 30.0 bits (66), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 21/44 (47%), Gaps = 1/44 (2%)

Query: 2  EEPAAKKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLC 44
          E    KK+++    C  C++  + CD +RP CS C    +   C
Sbjct: 14 EHFPKKKRQRTTVVCTNCKKRKIKCDRKRPACSNCSVANVAEYC 57

>YBL005W (PDR3) [189] chr2 (217435..220365) Zinc-finger
          transcription factor, in conjunction with Pdr1p
          regulates the expression of a network of genes involved
          in multiple drug resistance [2931 bp, 976 aa]
          Length = 976

 Score = 30.0 bits (66), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 9/28 (32%), Positives = 17/28 (60%)

Query: 9  QKKLYKSCIFCRRSHVNCDHQRPCSRCI 36
          + K+  +C+ CR+  + C  + PC+ CI
Sbjct: 8  RSKVSTACVNCRKRKIKCTGKYPCTNCI 35

>CAGL0F07755g complement(755947..757782) similar to sp|P40969
          Saccharomyces cerevisiae YMR168c CEP3 kinetochore
          protein complex, start by similarity
          Length = 611

 Score = 29.6 bits (65), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 14/32 (43%)

Query: 14 KSCIFCRRSHVNCDHQRPCSRCIKREIGHLCV 45
          + C  C +  V CD   PC  C KR     CV
Sbjct: 12 RPCSVCSKRKVKCDRLVPCGHCRKRGTESECV 43

>Kwal_47.19034
          Length = 1033

 Score = 29.6 bits (65), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 7/58 (12%)

Query: 46  ADENVSNIQSQYQYKNSMSPIGSTEIPNAEINIGDETRAIQGSNSS----VYGTETPI 99
           AD N S+ Q Q+Q+K   S I  T+IPN   N+ D    +   N +    +YG   P 
Sbjct: 519 ADANGSDDQPQHQFKKYESYIRETQIPN---NVRDLRVHVDWKNQTIILPIYGRPVPF 573

>Scas_637.7
          Length = 998

 Score = 29.6 bits (65), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 4/33 (12%)

Query: 9   QKKLYKSCIFCRRSHVNCDHQRP----CSRCIK 37
           +K++ K+C  CR+  + CD   P    CS C+K
Sbjct: 99  KKRVSKACDHCRKRKIKCDKVDPSTGKCSNCLK 131

>KLLA0D00396g complement(36277..37362) some similarities with
          ca|CA2346|CaSEF1 Candida albicans Putative
          transcription factor1, hypothetical start
          Length = 361

 Score = 29.3 bits (64), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 6/44 (13%)

Query: 11 KLYKSCIFCRRSHVNCDHQR----PCSRCIKREIGHLCVADENV 50
          K  +SC  CR++ V CD       PC+ C KR  G +C  D  V
Sbjct: 3  KPLRSCTRCRKNKVKCDSANTRPGPCTACSKR--GLVCTLDYVV 44

>CAGL0D03850g 384689..387193 weakly similar to sp|Q06639
          Saccharomyces cerevisiae YDR303c RSC3 or sp|P38781
          Saccharomyces cerevisiae YHR056c, hypothetical start
          Length = 834

 Score = 29.3 bits (64), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 20/39 (51%), Gaps = 1/39 (2%)

Query: 1  MEEPAAKKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKR 38
          M +    K+ K   +C  CRR  + CD  +P C  C+K+
Sbjct: 1  MYQAVLTKKVKKPPACQQCRRRKIGCDRGKPICGNCLKQ 39

>YMR168C (CEP3) [4123] chr13 complement(597331..599157) Component
          (subunit b) of the Cbf3 kinetochore protein complex
          [1827 bp, 608 aa]
          Length = 608

 Score = 29.3 bits (64), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 11/23 (47%)

Query: 16 CIFCRRSHVNCDHQRPCSRCIKR 38
          C  C R  V CD   PC  C KR
Sbjct: 14 CSVCTRRKVKCDRMIPCGNCRKR 36

>YGL013C (PDR1) [1960] chr7 complement(469095..472301) Zinc-finger
          transcription factor, in conjunction with Pdr3p
          regulates the expression of a network of genes involved
          in multiple drug resistance [3207 bp, 1068 aa]
          Length = 1068

 Score = 29.3 bits (64), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 18/29 (62%)

Query: 7  KKQKKLYKSCIFCRRSHVNCDHQRPCSRC 35
          K + K+ K+C  CR+  + C+ + PC+ C
Sbjct: 37 KPRSKVSKACDNCRKRKIKCNGKFPCASC 65

>Kwal_26.7014
          Length = 654

 Score = 29.3 bits (64), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 16/26 (61%)

Query: 15 SCIFCRRSHVNCDHQRPCSRCIKREI 40
          +C  CRR    C+ + PC+ C+K ++
Sbjct: 34 ACSNCRRRRKKCNMEYPCASCVKLKV 59

>YKR064W (YKR064W) [3315] chr11 (562189..564780) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [2592 bp, 863 aa]
          Length = 863

 Score = 29.3 bits (64), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 9/32 (28%), Positives = 17/32 (53%)

Query: 6  AKKQKKLYKSCIFCRRSHVNCDHQRPCSRCIK 37
           KK+ ++   C  C++    CD  +PC  C++
Sbjct: 9  TKKRHRITVVCTNCKKRKSKCDRTKPCGTCVR 40

>Kwal_23.3122
          Length = 788

 Score = 29.3 bits (64), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%)

Query: 7  KKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREI 40
          K  KK    C  C+R  V CD  +P C +C+  ++
Sbjct: 41 KFHKKSKNGCDNCKRRRVKCDEDKPSCQKCLNMKL 75

>CAGL0F07909g 776659..779808 some similarities with tr|Q12180
          Saccharomyces cerevisiae YOL089c HAL9 or sp|P38114
          Saccharomyces cerevisiae YBR150c TBS1, hypothetical
          start
          Length = 1049

 Score = 29.3 bits (64), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 22/44 (50%), Gaps = 4/44 (9%)

Query: 1  MEEPAAKKQKKLYKSCIFCRRSHVNCDHQRP----CSRCIKREI 40
          ME      +++  K+C  CR+  + CD   P    CS C+K ++
Sbjct: 26 MELLQQHYKRRSTKACDHCRKRKIRCDEVNPVTNKCSNCVKFKV 69

>Scas_638.14
          Length = 1043

 Score = 29.3 bits (64), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 17/29 (58%)

Query: 7  KKQKKLYKSCIFCRRSHVNCDHQRPCSRC 35
          K   K+ K+C  CR+  + C  ++PC+ C
Sbjct: 39 KPTNKVSKACDNCRKRKIKCTGKQPCATC 67

>CAGL0C01199g complement(121944..124712) similar to tr|Q12151
           Saccharomyces cerevisiae YDR213w UPC2, hypothetical
           start
          Length = 922

 Score = 29.3 bits (64), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 5/73 (6%)

Query: 7   KKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLCVADENVSN-IQSQYQYKNSMS 64
           K  KK    C  C+R  V CD  +P C +C    +  +CV    V N +  +   +   S
Sbjct: 39  KFHKKSKTGCDNCKRRRVKCDEGKPGCKKC--SNLNLVCVYSTVVDNKVAKKTTSRKGKS 96

Query: 65  PIGSTEIPNAEIN 77
           P G+  + N++ N
Sbjct: 97  P-GANSLENSDDN 108

>KLLA0C08723g 762625..765501 gi|7578634|gb|AAF64114.1|AF216585_1
           Kluyveromyces lactis Sec12p, start by similarity
          Length = 958

 Score = 29.3 bits (64), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 47/94 (50%), Gaps = 8/94 (8%)

Query: 127 NEFLMMLENPIPGESENTSQSNKEQERTAHSNMEDSIE------NTQEQTDNNEGIIGSV 180
           +EF + +E+ +P E     +++KE+   A    E SI+        QEQTD+ E  IG +
Sbjct: 582 SEFSIEIEDIVPEEIIIHERTDKEETEVAIEKTEPSIDILPEEATQQEQTDHEENNIG-I 640

Query: 181 SVNQEISQDINEASSKANGTKTVNDGQGQEQDQE 214
             N E++ DI  A    +  KT ++G   E + E
Sbjct: 641 ENNVEVALDIT-AEEVVSQDKTADEGPDLEIENE 673

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.129    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,729,413
Number of extensions: 639703
Number of successful extensions: 4440
Number of sequences better than 10.0: 529
Number of HSP's gapped: 4265
Number of HSP's successfully gapped: 617
Length of query: 455
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 350
Effective length of database: 12,961,219
Effective search space: 4536426650
Effective search space used: 4536426650
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 63 (28.9 bits)