Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M02607g1204118653730.0
YPL137C127695623550.0
Scas_700.38123992121660.0
Scas_640.21119992220920.0
Kwal_26.8687108890019170.0
YOR227W124693119160.0
CAGL0J04026g119898217960.0
KLLA0D07216g1278101017720.0
ACR113W110291117190.0
Kwal_23.548811125706394e-68
Scas_690.3314235556382e-67
YJL042W (MHP1)13985826256e-66
KLLA0E11847g12645536075e-64
CAGL0J00803g13145765916e-62
ACR059W12165534829e-49
KLLA0C01892g66459723.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M02607g
         (1186 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M02607g complement(298560..302174) similar to tr|Q03016 Sac...  2074   0.0  
YPL137C (YPL137C) [5309] chr16 complement(292816..296646) Protei...   911   0.0  
Scas_700.38                                                           838   0.0  
Scas_640.21                                                           810   0.0  
Kwal_26.8687                                                          743   0.0  
YOR227W (YOR227W) [5018] chr15 (762825..766565) Protein of unkno...   742   0.0  
CAGL0J04026g complement(376899..380495) similar to tr|Q12276 Sac...   696   0.0  
KLLA0D07216g 614450..618286 weakly similar to sgd|S0006058 Sacch...   687   0.0  
ACR113W [1160] [Homologous to ScYOR227W - SH; ScYPL137C - SH] co...   666   0.0  
Kwal_23.5488                                                          250   4e-68
Scas_690.33                                                           250   2e-67
YJL042W (MHP1) [2870] chr10 (361165..365361) Microtubule-interac...   245   6e-66
KLLA0E11847g complement(1044591..1048385) some similarities with...   238   5e-64
CAGL0J00803g complement(83483..87427) similar to sp|P43638 Sacch...   232   6e-62
ACR059W [1107] [Homologous to ScYJL042W (MHP1) - SH] complement(...   190   9e-49
KLLA0C01892g complement(149917..151911) weakly similar to sgd|S0...    32   3.0  

>CAGL0M02607g complement(298560..302174) similar to tr|Q03016
            Saccharomyces cerevisiae YPL137c, hypothetical start
          Length = 1204

 Score = 2074 bits (5373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1038/1186 (87%), Positives = 1038/1186 (87%)

Query: 1    MITNDVDVPVDWLYKGSKPHKKARRKNRSAVAVAGAAGKTEXXXXXXXXXXXXXHGMYAD 60
            MITNDVDVPVDWLYKGSKPHKKARRKNRSAVAVAGAAGKTE             HGMYAD
Sbjct: 1    MITNDVDVPVDWLYKGSKPHKKARRKNRSAVAVAGAAGKTERSRSLSISNASLSHGMYAD 60

Query: 61   PHAKRVSGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGARMPALTKTHSLNQETK 120
            PHAKRVSGT                                PGARMPALTKTHSLNQETK
Sbjct: 61   PHAKRVSGTMAIPRAMAGAIAGAGAVAIEDDDEVDIRADGGPGARMPALTKTHSLNQETK 120

Query: 121  DEVPVLXXXXXXXQSRNSPSLVSVXXXXXXXXXXXXXXXXXXXXXXXXXXXQSNDTEKKL 180
            DEVPVL       QSRNSPSLVSV                           QSNDTEKKL
Sbjct: 121  DEVPVLTPPPTPTQSRNSPSLVSVKRSASTSSKPKKTSLFGSLFGRSRSSSQSNDTEKKL 180

Query: 181  DTAKRLAISTASEKKTYPQELLTXXXXXXXXXXXXDIRRSTSITKSAKEHRARNSDNTTT 240
            DTAKRLAISTASEKKTYPQELLT            DIRRSTSITKSAKEHRARNSDNTTT
Sbjct: 181  DTAKRLAISTASEKKTYPQELLTPASPVSANSPSPDIRRSTSITKSAKEHRARNSDNTTT 240

Query: 241  DKNTHQETQKESGSRERPTDLTKISLKRVKFAVDKFETDPPQQLPSRTPKPGNIMIPDDM 300
            DKNTHQETQKESGSRERPTDLTKISLKRVKFAVDKFETDPPQQLPSRTPKPGNIMIPDDM
Sbjct: 241  DKNTHQETQKESGSRERPTDLTKISLKRVKFAVDKFETDPPQQLPSRTPKPGNIMIPDDM 300

Query: 301  ISELPAISVGITSNQQKNNLGPQFTKDSIEYKRALEIHQIALXXXXXXXXXXXXXXXXXX 360
            ISELPAISVGITSNQQKNNLGPQFTKDSIEYKRALEIHQIAL                  
Sbjct: 301  ISELPAISVGITSNQQKNNLGPQFTKDSIEYKRALEIHQIALKEAEKHQQEAHHAARRIA 360

Query: 361  XXVSNFSNGKQASAPGFMLNLVAQSDQSKRDQNSAVHDTDINIDLSEKLNKTGIDLPIHM 420
              VSNFSNGKQASAPGFMLNLVAQSDQSKRDQNSAVHDTDINIDLSEKLNKTGIDLPIHM
Sbjct: 361  HEVSNFSNGKQASAPGFMLNLVAQSDQSKRDQNSAVHDTDINIDLSEKLNKTGIDLPIHM 420

Query: 421  HEHHFDDPGSTLEGNQEITLDVVYTRCCHLREILPIPSTLKQVTDKTAPLQTLKFLNPKP 480
            HEHHFDDPGSTLEGNQEITLDVVYTRCCHLREILPIPSTLKQVTDKTAPLQTLKFLNPKP
Sbjct: 421  HEHHFDDPGSTLEGNQEITLDVVYTRCCHLREILPIPSTLKQVTDKTAPLQTLKFLNPKP 480

Query: 481  TLIDILSFCDFIAIVPIQTIVFDNVNLSTEMFKIVISSVAYSSVLEKISLRNVTMNKESW 540
            TLIDILSFCDFIAIVPIQTIVFDNVNLSTEMFKIVISSVAYSSVLEKISLRNVTMNKESW
Sbjct: 481  TLIDILSFCDFIAIVPIQTIVFDNVNLSTEMFKIVISSVAYSSVLEKISLRNVTMNKESW 540

Query: 541  QLLCKFLLTSQSLNKIDISQTRIKPETGTELLRSSMDWDLFAKTLAKRAEHLRPLEEILV 600
            QLLCKFLLTSQSLNKIDISQTRIKPETGTELLRSSMDWDLFAKTLAKRAEHLRPLEEILV
Sbjct: 541  QLLCKFLLTSQSLNKIDISQTRIKPETGTELLRSSMDWDLFAKTLAKRAEHLRPLEEILV 600

Query: 601  NGVNFDNIPLEDFQNFLITFATQKHLTNGIRLGLANATKSICSVQHYKFLLEWMSNYNVQ 660
            NGVNFDNIPLEDFQNFLITFATQKHLTNGIRLGLANATKSICSVQHYKFLLEWMSNYNVQ
Sbjct: 601  NGVNFDNIPLEDFQNFLITFATQKHLTNGIRLGLANATKSICSVQHYKFLLEWMSNYNVQ 660

Query: 661  GVDLGFNDLSNLIKPTLGKLSSLTYPNLHYFTLNSTNIQSTNDMXXXXXXXXXXPNLEFL 720
            GVDLGFNDLSNLIKPTLGKLSSLTYPNLHYFTLNSTNIQSTNDM          PNLEFL
Sbjct: 661  GVDLGFNDLSNLIKPTLGKLSSLTYPNLHYFTLNSTNIQSTNDMALLLKALSKLPNLEFL 720

Query: 721  DLSNLPQVFPDILPYMYKYLPRFPQLKRLHIDNENMTYKEMTVVCNLLAKCTGLIHVSML 780
            DLSNLPQVFPDILPYMYKYLPRFPQLKRLHIDNENMTYKEMTVVCNLLAKCTGLIHVSML
Sbjct: 721  DLSNLPQVFPDILPYMYKYLPRFPQLKRLHIDNENMTYKEMTVVCNLLAKCTGLIHVSML 780

Query: 781  SQKPPMSETESAENLSTNGDSNSGTVFAKNNFSATLYAFVRDSPNLVGLDIDYSSISDEV 840
            SQKPPMSETESAENLSTNGDSNSGTVFAKNNFSATLYAFVRDSPNLVGLDIDYSSISDEV
Sbjct: 781  SQKPPMSETESAENLSTNGDSNSGTVFAKNNFSATLYAFVRDSPNLVGLDIDYSSISDEV 840

Query: 841  SSRLALCLMRNMRRTMDSSXXXXXXXXXXXXXXXGSLVTMTAKDVLERLTQLNTKQIIEK 900
            SSRLALCLMRNMRRTMDSS               GSLVTMTAKDVLERLTQLNTKQIIEK
Sbjct: 841  SSRLALCLMRNMRRTMDSSFQLDELDSQDELLFDGSLVTMTAKDVLERLTQLNTKQIIEK 900

Query: 901  KDATKRYLLKKYVQKLHKIHNNVQQTIDNLFEKRKSGDLPMQEKENLVRLILLEKNLVHI 960
            KDATKRYLLKKYVQKLHKIHNNVQQTIDNLFEKRKSGDLPMQEKENLVRLILLEKNLVHI
Sbjct: 901  KDATKRYLLKKYVQKLHKIHNNVQQTIDNLFEKRKSGDLPMQEKENLVRLILLEKNLVHI 960

Query: 961  LDIFDNMPNLSEVLGENKIASSDSLVDHPNLRHVVETDNLNENSNERDLQVNENDNLQQR 1020
            LDIFDNMPNLSEVLGENKIASSDSLVDHPNLRHVVETDNLNENSNERDLQVNENDNLQQR
Sbjct: 961  LDIFDNMPNLSEVLGENKIASSDSLVDHPNLRHVVETDNLNENSNERDLQVNENDNLQQR 1020

Query: 1021 PHLMATESGRTIDTLTGRPVFSRRSSTTSLASKKQEEEEGDFHKWGFYIQQQKALYPDGE 1080
            PHLMATESGRTIDTLTGRPVFSRRSSTTSLASKKQEEEEGDFHKWGFYIQQQKALYPDGE
Sbjct: 1021 PHLMATESGRTIDTLTGRPVFSRRSSTTSLASKKQEEEEGDFHKWGFYIQQQKALYPDGE 1080

Query: 1081 SQYGEXXXXXXXXXXXXLPSIDSKEKKIFTKLPSGPELRTAIIKAKGVSSIEELIQKIND 1140
            SQYGE            LPSIDSKEKKIFTKLPSGPELRTAIIKAKGVSSIEELIQKIND
Sbjct: 1081 SQYGESSAVSASTSQTTLPSIDSKEKKIFTKLPSGPELRTAIIKAKGVSSIEELIQKIND 1140

Query: 1141 YHCCDIESLYNILKQNELEGNGIVTSESDLTDNEREHLEGAVKNIY 1186
            YHCCDIESLYNILKQNELEGNGIVTSESDLTDNEREHLEGAVKNIY
Sbjct: 1141 YHCCDIESLYNILKQNELEGNGIVTSESDLTDNEREHLEGAVKNIY 1186

>YPL137C (YPL137C) [5309] chr16 complement(292816..296646) Protein of
            unknown function, has low similarity to a region of S.
            cerevisiae Mhp1p, which is a microtubule-interacting
            protein that functions in stabilization of microtubules
            [3831 bp, 1276 aa]
          Length = 1276

 Score =  911 bits (2355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/956 (52%), Positives = 638/956 (66%), Gaps = 73/956 (7%)

Query: 260  DLTKISLKRVKFAVDKFETDPPQQLPSRTPKPGNIMIPDDMISELPAISVGITSNQQK-- 317
            DL+ +SLKRV FAVDKFE+DPPQQLPSRTPK GNI+IPDDMISE+P+ISVGI+S+ Q   
Sbjct: 276  DLSTVSLKRVSFAVDKFESDPPQQLPSRTPKKGNILIPDDMISEVPSISVGISSSNQSAK 335

Query: 318  ----NNLGPQFTKDSIEYKRALEIHQIALXXXXXXXXXXXXXXXXXXXXVSNFSNGKQAS 373
                N  GP +TK S EY  ALE  ++AL                    V+NF   K AS
Sbjct: 336  STNSNIKGPLYTKKSKEYILALENQKLALREAAKHQQEAHFAANRIAFEVANF---KTAS 392

Query: 374  APGFMLNLVAQSDQSKRDQNSAVHDTDINID-------LSEKLNKTGIDLPIHMHEHHFD 426
              G  L     S+ +   Q   V   ++  D       L+E L+K GID PIHMHEH+F 
Sbjct: 393  DAGGKLT-EKSSEGTITKQREEVSPPNVEADRELENNKLAENLSKAGIDKPIHMHEHYFK 451

Query: 427  DP-------GSTLEGNQEITLDVVYTRCCHLREILPIPSTLKQVTDKTAPLQTLKFLNPK 479
            +P       G ++E N E+TLDV+YTRCCHLREILPIPSTL+QV DKTAPLQ LKFLNPK
Sbjct: 452  EPDQDKYQDGHSIENN-EVTLDVIYTRCCHLREILPIPSTLRQVKDKTAPLQILKFLNPK 510

Query: 480  PTLIDILSFCDFIAIVPIQTIVFDNVNLSTEMFKIVISSVAYSSVLEKISLRNVTMNKES 539
            PTLIDILSFCDFI I PI TIVFDNV L+ +MF+I+IS++  S+VL+K+SLRNV ++++ 
Sbjct: 511  PTLIDILSFCDFITIAPIHTIVFDNVALNQDMFRIIISALVNSTVLDKLSLRNVRIDQDG 570

Query: 540  WQLLCKFLLTSQSLNKIDISQTRIKPETGTELLRSSMDWDLFAKTLAKRAEHLRPLEEIL 599
            W+LLCKFLL ++SLNK+DISQT+IK +    L R +MDW+LF   L++R+   +P+EE+L
Sbjct: 571  WKLLCKFLLLNKSLNKLDISQTKIKSDLAESLYRHNMDWNLFTDVLSQRSH--KPIEELL 628

Query: 600  VNGVNFDNIPLEDFQNFLITFATQKHL-TNGIRLGLANATKSICSVQHYKFLLEWMSNYN 658
             NG+ F  IP   F   L +FATQK+   +GIRLGLA AT S  S    KF+  WMS YN
Sbjct: 629  FNGIQFSKIPYSCFARLLTSFATQKNFPESGIRLGLAGATTSNISQDCLKFIFNWMSQYN 688

Query: 659  VQGVDLGFNDLSNLIKPTLGKLSSLTYPNLHYFTLNSTNIQSTNDMXXXXXXXXXXPNLE 718
            VQGVDL FNDLS +IKP +GKLS+L+Y NL YF LNSTNI ++ D+          PNL 
Sbjct: 689  VQGVDLAFNDLSTMIKPMVGKLSALSYDNLRYFILNSTNISTSYDLALLLKYLSKLPNLI 748

Query: 719  FLDLSNLPQVFPDILPYMYKYLPRFPQLKRLHIDNENMTYKEMTVVCNLLAKCTGLIHVS 778
            FLDLSNL Q FPDILPYMYKYLPRFP LKR+H+D+ N+T KE+ VVCN+L KC  L HVS
Sbjct: 749  FLDLSNLSQCFPDILPYMYKYLPRFPNLKRIHLDSNNLTLKELAVVCNILIKCKSLSHVS 808

Query: 779  MLSQKPP----MSETES-AENLSTNGDSNSGTV------FAKNNFSATLYAFVRDSPNLV 827
            M +Q       M+ T+S  +  +T+GD +S +       FAKN+FS+TLYAF RDSPNL+
Sbjct: 809  MTNQNVENFYLMNGTDSPVQQTNTDGDLDSSSTLDVKGQFAKNSFSSTLYAFARDSPNLI 868

Query: 828  GLDIDYSSISDEVSSRLALCLMRNMRRTMDSSXXXXXXXXXXXXXXXGSLVTMTAKDVLE 887
            GLD DY  IS+E+ SR+ALCLMRNM+RTMDS+               GSLVTMTA+ VLE
Sbjct: 869  GLDFDYDLISEEIQSRIALCLMRNMKRTMDSTFQLDELDSQDDLLFDGSLVTMTAESVLE 928

Query: 888  RLTQLNTKQIIEKKDATKRYLLKKYVQKLHKIHNNVQQTIDNLFEKRKSGDLPMQEKENL 947
            +L  L+ K    KKD TKRYLLKKY++K H +H+NVQ TID +FEKRKSG+LP+QEKENL
Sbjct: 929  KLNLLSDKSTKVKKDTTKRYLLKKYIEKFHILHHNVQHTIDTMFEKRKSGELPLQEKENL 988

Query: 948  VRLILLEKNLVHILDIFDNMPNLSEVLGENKIASSDSLVDH------PNLRHVVETDNLN 1001
            VRL+LLE+NL +IL++F + PNL++VLG ++  S +S VD       P L+HV    ++ 
Sbjct: 989  VRLLLLEQNLCNILELFSHNPNLNDVLGSSRDDSKES-VDSSEDSKLPALKHVESGYHVP 1047

Query: 1002 ENSNERDLQVNENDNLQQRPHLMATESGRTIDTLTGRP-VFSRRSSTTSLASKKQEEEEG 1060
            E   +      END +  RPHLMAT+SG+TID  TG+P VF   SS+TS+  KKQEEEEG
Sbjct: 1048 EEKIQP-----ENDVITARPHLMATDSGKTIDVFTGKPLVFKHTSSSTSVGCKKQEEEEG 1102

Query: 1061 DFHKWGFYIQQQKALYPDGES----------------QYGEXXXXXXXXXXXXLPSIDS- 1103
            + HKWGF++QQQ++LYP+ ES                  G+              +  S 
Sbjct: 1103 ELHKWGFFVQQQRSLYPENESTRQTPFASGDTPINTETAGKSTSSPSVSTSNNETATTSL 1162

Query: 1104 ---KEKKIFTKLPSGPELRTAIIKAKGVSSIEELIQKINDYHCCDIESLYNILKQN 1156
                  KI  K+PSG  LR+AI+KAKG+ SI++LIQ +N  +  ++E++Y    QN
Sbjct: 1163 FSPANPKILPKIPSGAVLRSAIMKAKGIDSIDDLIQNVNSNN-IELENIYGESIQN 1217

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/27 (66%), Positives = 20/27 (74%), Gaps = 6/27 (22%)

Query: 1  MITN-DVDVPVDWLYKGSKPHKKARRK 26
          MITN + DVPVDWLYKG     K+RRK
Sbjct: 1  MITNTEFDVPVDWLYKG-----KSRRK 22

>Scas_700.38
          Length = 1239

 Score =  838 bits (2166), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/921 (50%), Positives = 614/921 (66%), Gaps = 62/921 (6%)

Query: 261  LTKISLKRVKFAVDKFETDPPQQLPSRTPKPGNIMIPDDMISELPAISVGITSNQQKNNL 320
            L+ I LKRV FAVDKFE DP QQLPSRTPK GN+++PDDMISE+P+IS+GI++N  ++  
Sbjct: 261  LSSIKLKRVTFAVDKFEADPAQQLPSRTPKQGNVLVPDDMISEVPSISMGISANTPQSTK 320

Query: 321  GPQFTKDSIEYKRALEIHQIALXXXXXXXXXXXXXXXXXXXXVSNF---SNGKQASAPGF 377
             P F+K+S EY+ ALE  + A+                    V+NF   S+ +++S P  
Sbjct: 321  TPSFSKNSKEYRLALENQRFAIKEAEKHQKEAHFAAKRIADEVANFKATSSEQKSSIPVT 380

Query: 378  MLNLVAQSDQSKRDQNSAVHDTDINIDLSEKLNKTGIDLPIHMHEHHFDDPGSTLEGNQE 437
            +L     +D                 +L+EK+N   ID PIH+HEHHF+   ST     E
Sbjct: 381  LLPSTTAADS----------------ELNEKIN--NIDKPIHVHEHHFEQEIST----GE 418

Query: 438  ITLDVVYTRCCHLREILPIPSTLKQVTDKTAPLQTLKFLNPKPTLIDILSFCDFIAIVPI 497
            +TLD+VYTRCCHLREILPIPSTL+QV  KTAPLQTLKFLNPKPTLIDILSFCDFI+IVPI
Sbjct: 419  VTLDIVYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPKPTLIDILSFCDFISIVPI 478

Query: 498  QTIVFDNVNLSTEMFKIVISSVAYSSVLEKISLRNVTMNKESWQLLCKFLLTSQSLNKID 557
             TI+FDNV+L++EMFKI+ISSV  S+VLEK+ LRNV ++KE+W+LLCKF+L ++S+ K+D
Sbjct: 479  NTIIFDNVSLTSEMFKIIISSVVKSTVLEKLGLRNVIIDKENWKLLCKFMLNNKSIVKLD 538

Query: 558  ISQTRIKPETG--TELLRSSMDWDLFAKTLAKRAEHLRPLEEILVNGVNFDNIPLEDFQN 615
            ISQT+I+ E+     + R +MDW+LFA  L  R    +PLEEIL+NG+ F+NIP+  F++
Sbjct: 539  ISQTKIRTESNDLENIYRHNMDWELFANVLQYRLG--KPLEEILLNGIKFNNIPVHIFKD 596

Query: 616  FLITFATQKHLTN-GIRLGLANATKSICSVQHYKFLLEWMSNYNVQGVDLGFNDLSNLIK 674
             L + ++Q++ T+ GIR+GLA    S  S+   K ++ W+S  NVQGVDL FNDL+  +K
Sbjct: 597  LLHSISSQRNATSVGIRVGLAT---SDISLDCLKAVMNWISANNVQGVDLSFNDLAAFVK 653

Query: 675  PTLGKLSSLTYPNLHYFTLNSTNIQSTNDMXXXXXXXXXXPNLEFLDLSNLPQVFPDILP 734
            P +GKLSSLT+PNL YFTLN+TNI S+ D+          PNL+FLDLSNLPQ++PD+LP
Sbjct: 654  PLVGKLSSLTFPNLEYFTLNNTNISSSYDVALILKYLCKLPNLKFLDLSNLPQIYPDVLP 713

Query: 735  YMYKYLPRFPQLKRLHIDNENMTYKEMTVVCNLLAKCTGLIHVSMLSQKPPMSETESAEN 794
            YMYKYLPRFPQLKR+H DN N+++KE+TVVCN+L KC  L HVSMLSQ    S T +A +
Sbjct: 714  YMYKYLPRFPQLKRIHFDNNNLSFKELTVVCNILLKCHSLAHVSMLSQL--QSPTAAASD 771

Query: 795  LSTN-GDSNSGTVFAKNNFSATLYAFVRDSPNLVGLDIDYSSISDEVSSRLALCLMRNMR 853
             STN     S + FA+NN  ATLYA  +DSPNLVGLDIDY  I +E+  R+ALCLMRNM 
Sbjct: 772  SSTNVVGPESQSQFARNNLWATLYALAKDSPNLVGLDIDYDRIPEEIQQRIALCLMRNMN 831

Query: 854  RTMDSSXXXXXXXXXXXXXXXGSLVTMTAKDVLERLTQL--NTKQIIEKKDATKRYLLKK 911
            R MDS+               G+L+T TA+DVL +L +L  NT    +KKD TKRYLLKK
Sbjct: 832  RAMDSTFQLDELASQDDLLFDGTLITETAEDVLTKLNKLNENTSASTDKKDVTKRYLLKK 891

Query: 912  YVQKLHKIHNNVQQTIDNLFEKRKSGDLPMQEKENLVRLILLEKNLVHILDIFDNMPNLS 971
            Y++KLH++H N Q  ID +FEKR SG+L +QEKENL+RL+LLEKNL ++++I   +P +S
Sbjct: 892  YLEKLHRVHFNTQHKIDCMFEKRNSGELTLQEKENLLRLLLLEKNLSNLMEILGALPQVS 951

Query: 972  EVLGENKIASSDSLVDHPNLRHVVETDNLNENSNERDLQVNENDN-----LQQRPHLMAT 1026
             VLG NK  S   +         V +   +E+ +   L+  E+        + RPHLMAT
Sbjct: 952  SVLGSNKEDSMQPVYQQSQEGSTVTSGTSSESVSSVVLKHVESVEPIVVPPETRPHLMAT 1011

Query: 1027 ESGRTIDTLTGRPVFSRR-SSTTSLASKKQEEEEGDFHKWGFYIQQQKALYPDGESQYGE 1085
            +SGRT+D LTG+PV  RR SS+TS+  KKQ EEEG+ HKWG+++QQQ ++YP+ E    +
Sbjct: 1012 DSGRTVDVLTGKPVLFRRGSSSTSVVGKKQIEEEGELHKWGYFVQQQCSIYPENEVTKSK 1071

Query: 1086 XXXXXXXXXXXXLPSIDSKEKK--------------IFTKLPSGPELRTAIIKAKGVSSI 1131
                          S  +                  I  K+PSG ELR AIIKAKG+ SI
Sbjct: 1072 ETVNPPTPTTPTTASTSTTSTATHTPTPTTSKTPIIIVPKIPSGTELRKAIIKAKGIDSI 1131

Query: 1132 EELIQKINDYHCCDIESLYNI 1152
            ++LIQ +N     D + L NI
Sbjct: 1132 DDLIQNVNQ----DEDELINI 1148

 Score = 35.0 bits (79), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 20/29 (68%)

Query: 4  NDVDVPVDWLYKGSKPHKKARRKNRSAVA 32
          +D DVP++WLYKG K  ++ + + +S+  
Sbjct: 6  SDFDVPLEWLYKGGKSKRRTKSRTKSSTG 34

>Scas_640.21
          Length = 1199

 Score =  810 bits (2092), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/922 (48%), Positives = 601/922 (65%), Gaps = 58/922 (6%)

Query: 261  LTKISLKRVKFAVDKFETDPPQQLPSRTPKPGNIMIPDDMISELPAISVGITSNQQKNNL 320
            ++ ISL+RVKF+VDKF  DPPQQLPSR PK G+++IP+DMISE+P ISVGIT+    NN 
Sbjct: 249  ISNISLRRVKFSVDKFTDDPPQQLPSRKPKLGDVLIPNDMISEVPPISVGITTTD--NNS 306

Query: 321  G--------PQFTKDSIEYKRALEIHQIALXXXXXXXXXXXXXXXXXXXXVSNFSNGKQA 372
            G        P +TKDS EYK ALE ++ +L                    V + S  +  
Sbjct: 307  GSTLITNQHPMYTKDSKEYKIALERYKKSLKEGERHQEEAQKAAERIAREVYSSSRHRAN 366

Query: 373  SAPGFMLNLVAQSDQSK-RDQNSAVHDTDINIDLSEKLNKTGIDLPIHMHEHHFDDPGST 431
            S    +    + +  +    QNS   DT +++    K     ID PIHMH+++F D  ST
Sbjct: 367  SLTSSLTKTTSNTSSNPLSKQNSNELDTKVDV----KAKTLSIDKPIHMHQNNFGDDFST 422

Query: 432  LEGNQEITLDVVYTRCCHLREILPIPSTLKQVTDKTAPLQTLKFLNPKPTLIDILSFCDF 491
               N E+TLDV+YTRCCHLREILPIPSTL+QV  KTAPLQTLKFLNP+PTLIDILSFCDF
Sbjct: 423  HNTN-EVTLDVIYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPRPTLIDILSFCDF 481

Query: 492  IAIVPIQTIVFDNVNLSTEMFKIVISSVAYSSVLEKISLRNVTMNKESWQLLCKFLLTSQ 551
            I+I+PI TIVFDNV L++EMF+IV+SS+  S+VLEK+ LRNVT+++E W++ CKFL+ ++
Sbjct: 482  ISIIPIHTIVFDNVALTSEMFRIVLSSIVNSNVLEKLGLRNVTIDEEDWKIFCKFLIDNK 541

Query: 552  SLNKIDISQTRIKPETGTELLRSSMDWDLFAKTLAKRAEHLRPLEEILVNGVNFDNIPLE 611
            SL K+DISQT+I+PE+     R +MDW LF + L +R    +PLEE+L+NGV F+ IPL 
Sbjct: 542  SLIKLDISQTKIRPESSISCYRENMDWSLFCQVLKRRKG--KPLEELLLNGVKFNRIPLG 599

Query: 612  DFQNFLITFATQKHLTNGIRLGLANATKSICSVQHYKFLLEWMSNYNVQGVDLGFNDLSN 671
             FQ+ L  FA     TN +RLGLA +  S+  +   K L  WMS Y+V+GVDL FN+L++
Sbjct: 600  IFQDLLHVFAKMNPKTN-VRLGLAVSDISLGCL---KILFPWMSKYSVEGVDLAFNNLAD 655

Query: 672  LIKPTLGKLSSLTYPNLHYFTLNSTNIQSTNDMXXXXXXXXXXPNLEFLDLSNLPQVFPD 731
            L+KP +  LS+L + +L YFTLNSTNI S +DM          PNL+FLDLSNLPQ+FP+
Sbjct: 656  LLKPIIESLSTLDFKHLKYFTLNSTNISSVDDMALLIKYLSKLPNLQFLDLSNLPQLFPN 715

Query: 732  ILPYMYKYLPRFPQLKRLHIDNENMTYKEMTVVCNLLAKCTGLIHVSMLSQKPPMS-ETE 790
            I+P ++KYLP+FP LKR++ +N ++TY+E++++CN+L KC  + HVS+LSQ PP + E E
Sbjct: 716  IIPDLHKYLPQFPSLKRIYFENNDLTYREISMICNILQKCKLISHVSLLSQHPPSTLENE 775

Query: 791  SAENLSTNGDSNSGTVFAKNNFSATLYAFVRDSPNLVGLDIDYSSISDEVSSRLALCLMR 850
            +  +     D ++  +F ++   ATLY+  R SPNLV LDIDY  +S+E+ SR+ALCLMR
Sbjct: 776  NHIDTELGKDDSNKDLFNRHTLWATLYSLARSSPNLVSLDIDYDELSEEMRSRIALCLMR 835

Query: 851  NMRRTMDSSXXXXXXXXXXXXXXXGSLVTMTAKDVLERLTQLNTKQIIEKKDATKRYLLK 910
            NM+RTMDSS               GSL++ TA  VL +L   +   I    D T++YLLK
Sbjct: 836  NMQRTMDSSFELDEALLQDNLLFDGSLISETADTVLNKLNDESKDDI----DPTRKYLLK 891

Query: 911  KYVQKLHKIHNNVQQTIDNLFEKRKSGDLPMQEKENLVRLILLEKNLVHILDIFDNMPNL 970
            KY++KL  +HN+VQQTID++FEKRKSG+LP++EKENLVRL+LLEKNL +IL+IF  +P L
Sbjct: 892  KYLEKLENLHNSVQQTIDSMFEKRKSGELPLEEKENLVRLLLLEKNLSNILEIFSKIPFL 951

Query: 971  SEVLGE------------NKIASSDSLVDHPNLRHVVETDNLNENSNERDLQVNENDNLQ 1018
            S+V                 I   +  V  P L+H+     L++        V  ++N  
Sbjct: 952  SDVFNSTLASSPIQTNQTTAITDDEVPVRRPQLKHLDSARLLHQ------AIVPSSENTG 1005

Query: 1019 QRPHLMATESGRTIDTLTGRPVFSRRSSTTSLASKKQEEEEGDFHKWGFYI---QQQKAL 1075
              PH+MATE+G  IDT TG+PV  + SS TSL SKKQEEEEG+ HKWG ++   QQQ+  
Sbjct: 1006 D-PHIMATEAGSVIDTYTGKPVLHKSSSNTSLFSKKQEEEEGELHKWGVFVQQKQQQENA 1064

Query: 1076 YPDGESQYG---EXXXXXXXXXXXXLP-SIDSKEK----KIFTKLPSGPELRTAIIKAKG 1127
             P  ES      E             P S+  ++K    KI  K+PSGP+LR AII AKG
Sbjct: 1065 VPGSESSSNLSKESISSQASPTHRSSPTSLQLEDKTATPKILPKIPSGPQLREAIINAKG 1124

Query: 1128 VSSIEELIQKINDYHCCDIESL 1149
            ++SI++LIQ +N+    ++ES+
Sbjct: 1125 IASIDDLIQNVNEKR-VEVESI 1145

 Score = 37.4 bits (85), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 23/32 (71%), Gaps = 7/32 (21%)

Query: 1  MITNDVDVPVDWLYKGSKPHKKARRKNRSAVA 32
          +I++D+DVP+DWLYKG       +RK+R+  A
Sbjct: 24 IISSDIDVPLDWLYKG-------KRKSRTKAA 48

>Kwal_26.8687
          Length = 1088

 Score =  743 bits (1917), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/900 (44%), Positives = 544/900 (60%), Gaps = 84/900 (9%)

Query: 261  LTKISLKRVKFAVDKFETDPPQQLPSRTPKPGNIMIPDDMISELPAISVGITSNQQ--KN 318
            L K SL+RV FAVDKF TDPPQQ+PSR PK GN+++P DM+   P+ISVGIT+ Q   + 
Sbjct: 180  LAKTSLRRVTFAVDKFSTDPPQQIPSRKPKRGNVLVPQDMMCPTPSISVGITNTQGNIEQ 239

Query: 319  NLGPQFTKDSIEYKRALEIHQIALXXXXXXXXXXXXXXXXXXXXVSNFSNGKQASAPGFM 378
            +  P F ++S EYK ALE H+ AL                    V  F     + AP   
Sbjct: 240  SASP-FDENSKEYKLALEEHRKALRESEKHQQEAHYAAQRIAHEVLKFKTRPLSGAPH-- 296

Query: 379  LNLVAQSDQSKRDQNSAVHDTDINIDLSEKLNKTGIDLPIHMHEHHF-DDPGSTLEGNQE 437
              L A S  +  + ++    T+  ID  E+     ID PIHMHEHHF DD  S+ E   +
Sbjct: 297  -QLTASSSNTNVESSAPSGTTNAAID--ERAKNLEIDKPIHMHEHHFQDDTSSSAENGDK 353

Query: 438  ITLDVVYTRCCHLREILPIPSTLKQVTDKTAPLQTLKFLNPKPTLIDILSFCDFIAIVPI 497
            +TLD +YTRCCHLREILPIPSTLKQV  K+APLQTLKFLNP+PTLID+LSFCDFIAIVPI
Sbjct: 354  LTLDKIYTRCCHLREILPIPSTLKQVKGKSAPLQTLKFLNPRPTLIDVLSFCDFIAIVPI 413

Query: 498  QTIVFDNVNLSTEMFKIVISSVAYSSVLEKISLRNVTMNKESWQLLCKFLLTSQSLNKID 557
              +VFDNV+L++EM K VISS+  S V+EK+  RNV  N ++W LLCKFL+ + SL K+D
Sbjct: 414  HNVVFDNVSLTSEMLKNVISSLVTSKVIEKVGFRNVVFNSDTWILLCKFLMRTSSLLKLD 473

Query: 558  ISQTRIKPETGTELLRSSMDWDLFAKTLAKRAEHLRPLEEILVNGVNFDNIPLEDFQNFL 617
            ISQT+IKP+    L R++MDWDLF   L +R+   RPLEE+L+NGV  ++   + F + L
Sbjct: 474  ISQTKIKPDLEKNLYRANMDWDLFIDVLQRRSG--RPLEELLINGVKIES--FDSFVSLL 529

Query: 618  ITFATQKHLTNGIRLGLANATKSICSVQHYKFLLEWMSNYNVQGVDLGFNDLSNLIKPTL 677
             TFA      NG RLG+A   +S  S  H KFL+ WMS++ +QGVD+ FND S L++P +
Sbjct: 530  NTFAAGS-TQNGKRLGIA---QSELSADHLKFLMSWMSDFKIQGVDMAFNDFSELVRPLV 585

Query: 678  GKLSSLTYPNLHYFTLNSTNIQSTNDMXXXXXXXXXXPNLEFLDLSNLPQVFPDILPYMY 737
            GKLSSL + +L YFTLN+TNI +  D           PNL FLDLSNLPQVFP+I PY+ 
Sbjct: 586  GKLSSLPFQHLQYFTLNNTNIPTAYDAALLLRALSRLPNLYFLDLSNLPQVFPEIFPYLN 645

Query: 738  KYLPRFPQLKRLHIDNENMTYKEMTVVCNLLAKCTGLIHVSMLSQKPPMSETESAENLST 797
            KYLPR   LKRLH+D+   T +E+ ++ ++L+KC  L+H+S+++           E+ +T
Sbjct: 646  KYLPRMANLKRLHLDSNEFTSREVVMITSVLSKCNELLHLSLMNI--------PQESFTT 697

Query: 798  NGDSNSGTVFAKNNFSATLYAFVRDSPNLVGLDIDYSSISDEVSSRLALCLMRNMRRTMD 857
                            A LY  VR    L  LD+ Y+ I +E+SSR+A+CLMR M+R  +
Sbjct: 698  -------------GMCANLYDCVRQCSKLTNLDVTYAYIPEEISSRIAICLMRRMQRDFE 744

Query: 858  SSXXXXXXXXXXXXXXXGSLVTMTAKDVLERLTQLNTKQIIEKKDATKRYLLKKYVQKLH 917
                             G+L++ TA++VLE+L      +     D T+RYLLKKY +K +
Sbjct: 745  ----LDDLTNQDDLLFDGTLLSETAENVLEKLNNFEDLET----DVTRRYLLKKYWEKFN 796

Query: 918  KIHNNVQQTIDNLFEKRKSGDLPMQEKENLVRLILLEKNLVHILDIFDNMPNLSEVLG-- 975
            ++H+NVQ TID +FEKR +G+L +Q KENL+RL+ LE NL HILD+  + P +++V G  
Sbjct: 797  RVHDNVQSTIDQMFEKRSAGELNLQSKENLLRLLFLENNLSHILDVLKSYPQVADVAGIE 856

Query: 976  -ENKIASSDSLVDHPNLRHVVETDNLNENSNERDLQVNENDNLQQRPHLMATESGRTIDT 1034
               + A SD L+                    + +     +N   RPHLMAT+SGRTID 
Sbjct: 857  PNARSAGSDHLL--------------------KGITSEAENNSHVRPHLMATDSGRTIDV 896

Query: 1035 LTGRPVFSRRSSTTSLASKKQEEEEGDFHKWGFYIQQQKALYPD----------GESQYG 1084
             TG PV  +  S  SL  K+QEEEEG+FHKWGF++QQQ ++YPD           E + G
Sbjct: 897  TTGTPVLVKTPSHVSLVGKRQEEEEGEFHKWGFFVQQQNSIYPDHHSRNTNDEPPEKRPG 956

Query: 1085 EXXXXXXXXXXXXLPSID-----SKEKKIFTKLPSGPELRTAIIKAKGVSSIEELIQKIN 1139
                           +I      +    + +K+PSG ELR A+++AKG+ SIEELI+ +N
Sbjct: 957  SAASSTESPKSSQPSAISQTASQAAAHALISKIPSGAELREAVMRAKGIDSIEELIENVN 1016

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 14/22 (63%), Positives = 17/22 (77%)

Query: 5  DVDVPVDWLYKGSKPHKKARRK 26
          DVDV VDWLYKG +  K+ R+K
Sbjct: 6  DVDVDVDWLYKGKRKAKQPRKK 27

>YOR227W (YOR227W) [5018] chr15 (762825..766565) Protein of unknown
            function, interacts with Glc7p [3741 bp, 1246 aa]
          Length = 1246

 Score =  742 bits (1916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/931 (45%), Positives = 582/931 (62%), Gaps = 78/931 (8%)

Query: 261  LTKISLKRVKFAVDKFETDPPQQLPSRTPKPGNIMIPDDMISELPAISVGITSNQQKN-- 318
            ++K++LKRV  AV +F +DPPQQLPSR PK GN++IP+DMIS  P IS+GIT++  ++  
Sbjct: 301  VSKVNLKRVTIAVQEFNSDPPQQLPSRKPKRGNVLIPEDMISAPPLISLGITNSSDQSSF 360

Query: 319  --NLGPQFTKDSIEYKRALEIHQIALXXXXXXXXXXXXXXXXXXXXVSNFSNGKQASAPG 376
              N+ P ++KDS EYK ALE  + A                     V+N+   +  ++P 
Sbjct: 361  QSNISPSYSKDSKEYKLALENFKKAAKEAEKHQKDAYYVAERMAQEVANYKARQLKTSP- 419

Query: 377  FMLNLVAQSDQSKRDQNSAVHDTDINIDLSEKLNKTGIDLPIHMHEHHFD---DPGSTLE 433
             +      +  S  DQ S+         L  + +K  ID PI++  H F+   D      
Sbjct: 420  -LTGATNSAADSATDQESS--------SLDARASKLHIDKPINVGAHPFETHQDDNIKYS 470

Query: 434  GNQEITLDVVYTRCCHLREILPIPSTLKQVTDKTAPLQTLKFLNPKPTLIDILSFCDFIA 493
             + E TLDV YTRCCHLREILPIPSTL+QV  KTAPLQTLKFLNPKPTL+DILSFCDFIA
Sbjct: 471  SHLEQTLDVAYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPKPTLVDILSFCDFIA 530

Query: 494  IVPIQTIVFDNVNLSTEMFKIVISSVAYSSVLEKISLRNVTMNKESWQLLCKFLLTSQSL 553
            I PI  I+FDNV+L+ +MFKIVI S+  S V+EK+ LRNV +N++SW+LLCKFLL +++L
Sbjct: 531  ITPIHNIIFDNVSLTHDMFKIVICSLVTSPVVEKLGLRNVVINEQSWKLLCKFLLQNKTL 590

Query: 554  NKIDISQTRIKPETGTELLRSSMDWDLFAKTLAKRAEHLRPLEEILVNGVNFDNIPLEDF 613
             K+DISQT+ + +      R  MDW+LF + L  R    RPLEE+L+NG+ FD +    F
Sbjct: 591  IKLDISQTKARTDLNDSNYRDQMDWELFCEVLRNREG--RPLEELLLNGLRFDKMSFSHF 648

Query: 614  QNFLITFATQKHLTNGIRLGLANATKSICSVQHYKFLLEWMSNYNVQGVDLGFNDLSNLI 673
            +N L+TFA Q +  N IRLG+AN      S + + FL  WMS YNVQGVDL +N+L +L 
Sbjct: 649  KNILLTFA-QMNPKNPIRLGMANVE---FSTECFDFLFNWMSEYNVQGVDLAYNNLESLA 704

Query: 674  KPTLGKLSSLTYPNLHYFTLNSTNIQSTNDMXXXXXXXXXXPNLEFLDLSNLPQVFPDIL 733
            K  + KL+ L Y +L YFTLNSTNI S +DM          P+++FLDLSNLPQ+FP IL
Sbjct: 705  KRMIKKLARLPYKHLEYFTLNSTNITSVDDMSYILKYLSRLPSIKFLDLSNLPQLFPGIL 764

Query: 734  PYMYKYLPRFPQLKRLHIDNENMTYKEMTVVCNLLAKCTGLIHVSMLSQKPPMSETESAE 793
               YKY P+FPQLKR+H D ++++ KE T++ ++LAKC  L HVS++ Q P    ++ ++
Sbjct: 765  TSGYKYFPQFPQLKRIHFDFDDLSIKETTMLVSILAKCETLSHVSLIGQSPMPDASKISD 824

Query: 794  NL----STNGDSNSGTVFAKNNFSATLYAFVRDSPNLVGLDIDYSSISDEVSSRLALCLM 849
            +      +  +     VF +N   A+LYAFVRDS NLV LD+DY  + DE+ SR+ALCLM
Sbjct: 825  STDEPDKSKDEKKEQIVFMRNTLWASLYAFVRDSHNLVSLDVDYDQVPDEIQSRIALCLM 884

Query: 850  RNMRRTMDSSXXXXXXXXXXXXXXXGSLVTMTAKDVLERLTQLNTKQIIEKKDATKRYLL 909
             NM+R MDSS               GSL+T TA++VL+R   LN K +++  D  K+YLL
Sbjct: 885  HNMKRIMDSSFKLDELTVQDDLIFDGSLITETAEEVLKR---LNDKSLLQ-NDVGKKYLL 940

Query: 910  KKYVQKLHKIHNNVQQTIDNLFEKRKSGDLPMQEKENLVRLILLEKNLVHILDIFDNMPN 969
            KKY +K+ K+H+NVQ TID++FEKRKSG+LP+QEKENL+RL+LLEKNL +ILDIF +MPN
Sbjct: 941  KKYFEKMEKVHHNVQNTIDSMFEKRKSGELPLQEKENLLRLLLLEKNLSNILDIFASMPN 1000

Query: 970  LSEVLGENKIASS-----DSLVD-------HPNLRHVVETDNLNENSNERDLQVNENDNL 1017
            +++V+  +K  +S     DS V         P+L+H +++D L       D+ + END+ 
Sbjct: 1001 IADVVPFSKADNSFPNIGDSTVSANYNDGIRPSLKH-LDSDRLIN-----DVSIPENDS- 1053

Query: 1018 QQRPHLMATESGRTIDTLTGRPVFSRRSSTTSLASKKQEEEEGDFHKWGFYIQQQK---- 1073
              RPHLMAT+SGR ID  TG+ +  + SS TSLA K+QEEEEG+ HKWG ++Q Q     
Sbjct: 1054 SIRPHLMATDSGRIIDVTTGKALLFKSSSNTSLAGKRQEEEEGELHKWGVFVQHQSSRHN 1113

Query: 1074 --------------ALYPDGESQYGEXXXXXXXXXXXXLPSIDSKEKKIFTKLPSGPELR 1119
                          +L PD     G+                     KI  K+P+G ELR
Sbjct: 1114 SGLPSSANSSRISGSLTPDSSVAGGKKGESSRTS---------GTRPKILPKIPTGAELR 1164

Query: 1120 TAIIKAKGVSSIEELIQKINDYHCCDIESLY 1150
             AIIKAKG+ S+++LI+ +       +ESLY
Sbjct: 1165 DAIIKAKGIDSVDDLIKNVTS-EKVGLESLY 1194

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 7/30 (23%)

Query: 5  DVDVPVDWLYKGSKPHKKARRKNRSAVAVA 34
          D+DVP+DWLYKG       +R+NR+  A +
Sbjct: 9  DIDVPLDWLYKG-------KRRNRTKSAAS 31

>CAGL0J04026g complement(376899..380495) similar to tr|Q12276
            Saccharomyces cerevisiae YOR227w or tr|Q03016
            Saccharomyces cerevisiae YPL137c, hypothetical start
          Length = 1198

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/982 (41%), Positives = 585/982 (59%), Gaps = 71/982 (7%)

Query: 249  QKESGSRERPTDLTKISLKRVKFAVDKFETDPPQQLPSRTPKPGNIMIPDDMISELPAIS 308
            Q +S  +E    L KI LKRV FA+DKF  +P QQLPSR PK G+I++P+DMISE P IS
Sbjct: 216  QGQSRDKESIEKLNKIDLKRVSFALDKFHHEPAQQLPSRKPKMGDIVVPEDMISEEPKIS 275

Query: 309  VGI-TSNQQKNNLGP--QFTKDSIEYKRALEIHQIALXXXXXXXXXXXXXXXXXXXXVSN 365
            VGI T++  K +  P  +++KDS EYK  LE ++                       V+ 
Sbjct: 276  VGITTTSDNKASSAPKRKYSKDSQEYKMVLENYKRLQKESERQQLEAHRVAERIANEVTG 335

Query: 366  F---SNGKQASAPGFMLNLVAQSDQSKRDQNSAVHDTDINIDLSEKLNKTGIDLPIHMHE 422
            +   S     +A   ++N V           ++V D+D  + L  ++ +  ID PIH HE
Sbjct: 336  YRIRSGSLFEAAHNAVVNKVLSPSSP---TEASVIDSDPTVALDSRVAELTIDKPIHAHE 392

Query: 423  HHFDDPG---STLEGN---------QEITLDVVYTRCCHLREILPIPSTLKQVTDKTAPL 470
              F+  G   ST + N          E+ LDVVYTRCCHLREILPIPSTL+QV  KTAPL
Sbjct: 393  TFFETEGYDSSTSQVNSNPDLHQHHHELPLDVVYTRCCHLREILPIPSTLRQVKGKTAPL 452

Query: 471  QTLKFLNPKPTLIDILSFCDFIAIVPIQTIVFDNVNLSTEMFKIVISSVAYSSVLEKISL 530
            QTLKFLNPKPTLIDILSFCDFI+I PIQ +VFDNV L+++M +IV+SS+  S  +EK+ +
Sbjct: 453  QTLKFLNPKPTLIDILSFCDFISITPIQVVVFDNVALNSDMIQIVLSSLINSKSIEKLGI 512

Query: 531  RNVTMNKESWQLLCKFLLTSQSLNKIDISQTRIKPETGTELLRSSMDWDLFAKTLAKRAE 590
            RNV ++ + W++LCKFLL ++S+ ++D+SQT+IKP+   E  R +M+W LF   L +R  
Sbjct: 513  RNVVLSSKDWEMLCKFLLVNKSIIRLDLSQTKIKPDLPAECYRHNMNWKLFCNVLRERTG 572

Query: 591  HLRPLEEILVNGVNFDNIPLEDFQNFLITFATQKHLTNGIRLGLANATKSICSVQHYKFL 650
              RPLEE+L+NGV+FD +  +D+Q+ L+TFA++    N  RLG+A A+    S +   FL
Sbjct: 573  --RPLEELLLNGVHFDEMSFDDYQDLLLTFASKNSSPNK-RLGMAAAS---FSEKCMSFL 626

Query: 651  LEWMSNYNVQGVDLGFNDLSNLIKPTLGKLSSLTYPNLHYFTLNSTNIQSTNDMXXXXXX 710
             + +S ++VQGVDLGFN+L   I   + KLS+L Y NL YFTLNS++   T ++      
Sbjct: 627  FDVISQFSVQGVDLGFNELEPYIHIIIDKLSTLPYNNLEYFTLNSSSFSCTQNIGSLLKY 686

Query: 711  XXXXPNLEFLDLSNLPQVFPDILPYMYKYLPRFPQLKRLHIDNENMTYKEMTVVCNLLAK 770
                PNL FLD+SN+P++FP +  Y+YKYLP FP L+R+H D+  +TYK+  ++C +L K
Sbjct: 687  LSRLPNLRFLDMSNIPEMFPSVFAYLYKYLPLFPSLQRIHFDSNCLTYKQCIMLCEILQK 746

Query: 771  CTGLIHVSMLSQ--KPPMSETESAENLSTNGDSNSGTVFAKNNFSATLYAFVRDSPNLVG 828
            C  L HVSM ++   P   + +  E+ S   D  S   FA     ATLY F RD   L+G
Sbjct: 747  CPKLAHVSMKNELTYPEAIKDQEKEDGS---DDKSTKEFAARTLGATLYGFCRDRSTLLG 803

Query: 829  LDIDYSSISDEVSSRLALCLMRNMRRTMDSSXXXXXXXXXXXXXXXGSLVTMTAKDVLER 888
            LD+DY  ISDE+ SR+A+ LM NM++T+DS+               G +++  A+ +L R
Sbjct: 804  LDVDYGDISDEIQSRIAVTLMINMKKTIDSNFSQDEVTSQDDLLFDGKVISENAEGILHR 863

Query: 889  LTQLNTKQIIEKKDATKRYLLKKYVQKLHKIHNNVQQTIDNLFEKRKSGDLPMQEKENLV 948
            LT      + ++ D TK YLLKK+V+K+  +H  VQ+ ID +FEKR++G LP++EKENL+
Sbjct: 864  LTS----NLGDQSDPTKMYLLKKFVEKIESLHYEVQKKIDIMFEKRETGTLPLKEKENLL 919

Query: 949  RLILLEKNLVHILDIFDNMPNL-------SEVLGENKIA-----SSDSLVDHPNLRHV-- 994
            RL+LLEKNL +I+ +F +  ++       +E++G+   A     S+D   +  N  H+  
Sbjct: 920  RLVLLEKNLSNIMQLFASTSSMKIMETPEAELIGKANFADDSNDSADEKNNSTNTSHIRP 979

Query: 995  ----VETDNLNENSNERDLQVNENDNLQQRPHLMATESGRTIDTLTGRPVFSRRSSTTSL 1050
                +++D +   ++    +  + D   Q PH MATESG+ +D  TG+ +  + SS+TSL
Sbjct: 980  FLKHLDSDRIFGFASHHSPKSPDVD-ASQIPHSMATESGKVVDATTGKALLYKTSSSTSL 1038

Query: 1051 ASKKQEEEEGDFHKWGFYIQQQKALYPDGESQYGEXXXXXXXXXXXXLPSIDSKEKKIFT 1110
              KKQE EEG+FHKWGF++ Q+    PD + +                P   +  K    
Sbjct: 1039 LVKKQEHEEGEFHKWGFFVHQKGTTNPDTDDKKSGPEKTPNVSENTNAPERVTVPK--IQ 1096

Query: 1111 KLPSGPELRTAIIKAKGVSSIEELIQKI--NDYHCCDI--ESL--YNIL--------KQN 1156
             +PSG ELR AIIKAKG+ SIE+LI+K+  +D+    I  ESL  + IL         +N
Sbjct: 1097 TVPSGNELREAIIKAKGIDSIEDLIKKVSKDDHGLKKIYGESLKPFPILGAQDVDYTSRN 1156

Query: 1157 ELEGNGIVTSESDLTDNEREHL 1178
              EGN   +  S  TD++ + L
Sbjct: 1157 ASEGNTEASGRSTSTDSKTDEL 1178

>KLLA0D07216g 614450..618286 weakly similar to sgd|S0006058
            Saccharomyces cerevisiae YPL137c, start by similarity
          Length = 1278

 Score =  687 bits (1772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/1010 (41%), Positives = 578/1010 (57%), Gaps = 134/1010 (13%)

Query: 260  DLTKISLKRVKFAVDKFETDPPQQLPSRTPKPGNIMIPDDMISELPAISVGITSNQQKNN 319
            +LT+I+LKRV FAVD+F  DPPQQ+PSR PK GN+++P+DMIS++P+IS GIT+  Q ++
Sbjct: 265  ELTEINLKRVTFAVDEFGMDPPQQIPSRKPKLGNVLVPNDMISDIPSISQGITTTAQPSS 324

Query: 320  LG---------PQFTKDSIEYKRALEIHQIALXXXXXXXXXXXXXXXXXXXXVSNF---- 366
             G           +TKDS EY+ ALE H+  L                    V+ F    
Sbjct: 325  HGNDQHGALPASAYTKDSKEYQLALENHKKCLKESEKHQQEAHYAAQRIASEVAGFKLKP 384

Query: 367  --SNGKQASAPGFMLNLVAQSDQSKRDQNSAVHDTDINIDLSEKLNKTGIDLPIHMHEHH 424
              S   + SA G +    A +D     +   V D        EK+    ID PIHMHEHH
Sbjct: 385  STSTDLKPSANGTVPKSGAATDDEANAEAGVVAD--------EKIKSLEIDKPIHMHEHH 436

Query: 425  FDD---------------PGSTL----EGNQEITLDVVYTRCCHLREILPIPSTLKQVTD 465
            F +               P ST     E   E+ LDVVYTRCCHLREILPIPSTL+Q+ +
Sbjct: 437  FKESSGSSNGTGSEHGANPSSTSGTQDENGNELMLDVVYTRCCHLREILPIPSTLRQLKE 496

Query: 466  KTAPLQTLKFLNPKPTLIDILSFCDFIAIVPIQTIVFDNVNLSTEMFKIVISSVAYSSVL 525
            K APLQTLKFLNP+PTLIDILSF DFIAIVPI  +VFDNV LS EMFKIVISS+  S  L
Sbjct: 497  KKAPLQTLKFLNPRPTLIDILSFSDFIAIVPIHNVVFDNVGLSPEMFKIVISSLVKSITL 556

Query: 526  EKISLRNVTMNKESWQLLCKFLLTSQSLNKIDISQTRIKPETGTELLRSSMDWDLFAKTL 585
            E++S+RNV  ++  W+LLCKFL+ ++SL K+DISQT+I+ +   +L RS MDW LF   L
Sbjct: 557  ERLSMRNVVFDERGWKLLCKFLMRNKSLTKLDISQTKIRHDLDLKLHRSQMDWSLFIDVL 616

Query: 586  AKRAEHLRPLEEILVNGVNFDNIPLEDFQNFLITFATQKH-LTNGIRLGLANATKSICSV 644
             KR    +PLEE+L+NGV+F N  L  F+N +  F++ K+  +   +LGLA +   I S 
Sbjct: 617  HKR--QGKPLEELLLNGVSFAN-NLHTFENMINAFSSTKNEFSRKRKLGLAQS--QIASS 671

Query: 645  QHYKFLLEWMSNYNVQGVDLGFNDLSNLIKPTLGKLSSLTYPNLHYFTLNSTNIQSTNDM 704
            +  + L  WMS  ++ GVDL FND  NL KP + +LS  ++ +L YFTLNSTNIQS  + 
Sbjct: 672  EQLEILFRWMSENDIIGVDLAFNDFENLTKPIIKELSQRSFDSLQYFTLNSTNIQSVQEA 731

Query: 705  XXXXXXXXXXPNLEFLDLSNLPQVFPDILPYMYKYLPRFPQLKRLHIDNENMTYKEMTVV 764
                      P L FLDLS LP +FP I PY+ KYLPRFP LKRLH D+   TYK++++V
Sbjct: 732  ALIIRELSKLPKLYFLDLSGLPSLFPAIFPYLNKYLPRFPSLKRLHFDSNEWTYKDISLV 791

Query: 765  CNLLAKCTGLIHVSMLSQKPPMSETESAENLSTNGDSNSGTVFAKNNFSATLYAFVRDSP 824
              +L KC  L+HVSM++Q P  S   SA             VF        LY  +++S 
Sbjct: 792  TQILPKCKELLHVSMMNQ-PQESWAMSA------------AVF--------LYDCIKNSD 830

Query: 825  NLVGLDIDYSSISDEVSSRLALCLMRNMRRTMDSSXXXXXXXXXXXXXXXGSLVTMTAKD 884
             L+ LD +Y +I +E++SR+A+ L+RN ++++DS+               G L++ TA +
Sbjct: 831  KLINLDFNYENIPEEINSRIAIALVRNAQKSIDSNWQLDELSSQDDLLFDGELISETAGN 890

Query: 885  VLERLTQLNTKQIIEKKDATKRYLLKKYVQKLHKIHNNVQQTIDNLFEKRKSGDLPMQEK 944
            +L++L      Q    +D+TKRYLLK+Y +K+H IH NVQ+TID++FE+R S +L +Q K
Sbjct: 891  ILDKLNDSAKLQ----EDSTKRYLLKRYWEKIHTIHANVQKTIDSMFEQRISKELSLQSK 946

Query: 945  ENLVRLILLEKNLVHILDIFDNMPNLSEV-LGENK----IASSDSLVDHPNLRHVVE--- 996
            ENL+RLI +E  L +IL+     P + E+   +NK     +SSD   + P L+HV     
Sbjct: 947  ENLLRLIFMENTLGNILEYLSTNPYIQELNYAKNKDDDNYSSSD---ERPVLKHVDSERI 1003

Query: 997  ------TDNLNENSNERDLQVNENDNLQQRPHLMATESGRTIDTLTGRPVFSRRSSTTSL 1050
                   D ++++ ++ +L+ +E D+   +PHLMAT+SGRTID  TGRP+ ++ SS  S+
Sbjct: 1004 MYAKPLVDPIDQDIDQ-ELE-HEQDSNSAKPHLMATDSGRTIDVTTGRPILTKTSSQRSI 1061

Query: 1051 ASKKQEEEEGDFHKWGFYIQQQKALYPDG------------------------------- 1079
              KKQEEEEG+ HKWGF++QQQ+++YP+                                
Sbjct: 1062 FGKKQEEEEGELHKWGFFVQQQRSIYPENTPMSKYQQQQQHKHAQRKEPQLSQIVEKPRE 1121

Query: 1080 ESQYGEXXXXXXXXXXXXLP----------SIDSKEKKIFTKLPSGPELRTAIIKAKGVS 1129
            + Q  +             P          S  +   K+  K+PSG ELR AIIKAKG++
Sbjct: 1122 QVQTSQKTGQPAATPTASTPPTSSNSIPALSKSAASAKLIGKIPSGTELREAIIKAKGIN 1181

Query: 1130 SIEELIQKINDYHCCDIESLYNILKQNELEGNGIVTSESDLTDNEREHLE 1179
            SIE+LI  +N      ++++Y I  +   +   +V S     D    H E
Sbjct: 1182 SIEDLIDNVN-CQQVKLDNIYGIQVEPPADAKPLVLSPGGRPDGNVSHDE 1230

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 13/21 (61%), Positives = 15/21 (71%)

Query: 5  DVDVPVDWLYKGSKPHKKARR 25
          D+DV VDWLYKG K  +  RR
Sbjct: 6  DLDVEVDWLYKGKKKVRANRR 26

>ACR113W [1160] [Homologous to ScYOR227W - SH; ScYPL137C - SH]
            complement(550378..553686) [3309 bp, 1102 aa]
          Length = 1102

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/911 (41%), Positives = 543/911 (59%), Gaps = 98/911 (10%)

Query: 261  LTKISLKRVKFAVDKFETDPPQQLPSRTPKPGNIMIPDDMISELPAISVGITSNQ----Q 316
            L+ + L+RV FAVDKF TDPPQQ+PSR P+ GN++IPD+++ E+P IS GI++ +    Q
Sbjct: 208  LSGVQLRRVAFAVDKFSTDPPQQIPSRRPRRGNVLIPDEILGEVPTISQGISNPEGICGQ 267

Query: 317  KNNLGPQFTKDSIEYKRALEIHQIALXXXXXXXXXXXXXXXXXXXXVSNFSNGKQASAPG 376
            K +   Q TKDS EYK ALE ++ AL                    V+ F   KQ+ +  
Sbjct: 268  KES---QLTKDSKEYKIALENYRKALKESKKHQQEAHMAALRTANEVAAFKY-KQSHSQR 323

Query: 377  FMLNLVAQSDQSKRDQNSAVHDTDINIDLSEKLNKTGIDLPIHMHEHHFD--DPGSTLEG 434
             ++   A  D++K  +                     ID P   +E  FD  D     E 
Sbjct: 324  ELVPEAAVDDRAKHLE---------------------IDKPTQANETSFDGEDTECGDES 362

Query: 435  NQEITLDVVYTRCCHLREILPIPSTLKQVTDKTAPLQTLKFLNPKPTLIDILSFCDFIAI 494
             +E+TLD +YTRCCHLREILPIPSTLKQV +KTAPL TLKFLNPKPTLID+LSFCDFIA+
Sbjct: 363  GKELTLDQIYTRCCHLREILPIPSTLKQVKNKTAPLHTLKFLNPKPTLIDLLSFCDFIAV 422

Query: 495  VPIQTIVFDNVNLSTEMFKIVISSVAYSSVLEKISLRNVTMNKESWQLLCKFLLTSQSLN 554
            VPI  +VFDNVNL+ EMFKI+I+S+  S+ LE++S+RNV  + + W  LCKF+L+++SL 
Sbjct: 423  VPIHNVVFDNVNLTPEMFKIMITSLVNSTALERLSIRNVVTDADCWAALCKFILSNRSLI 482

Query: 555  KIDISQTRIKPETGTELLRSSMDWDLFAKTLAKRAEHLRPLEEILVNGVNFDNIPLEDFQ 614
            K+DISQT+++ +    L RS+M+W LF + L +R +H  PLEE+L+NG+ F ++ +  F 
Sbjct: 483  KLDISQTKVRQDLARTLYRSNMNWPLFIEVLQRR-QHA-PLEELLLNGIQFFDLSI--FN 538

Query: 615  NFLITFATQKHLTNGIRLGLANATKSICSVQHYKFLLEWMSNYNVQGVDLGFNDLSNLIK 674
              L  F  +    +  RLG+A+   S    +H K L +W S YNVQG+DL FN+L++L+K
Sbjct: 539  GLLHAFTLRP--ASKKRLGVAH---SFLKEEHLKLLFDWASTYNVQGIDLAFNNLTDLVK 593

Query: 675  PTLGKLSSLTYPNLHYFTLNSTNIQSTNDMXXXXXXXXXXPNLEFLDLSNLPQVFPDILP 734
            P + KL+++ + +LHYFTLNST +    D           PNL FLDLS+LP +FP+I P
Sbjct: 594  PMVSKLTTMNFDHLHYFTLNSTAL-GFCDAALCLRALSKLPNLYFLDLSSLPAIFPEIFP 652

Query: 735  YMYKYLPRFPQLKRLHIDNENMTYKEMTVVCNLLAKCTGLIHVSMLSQKPPMSETESAEN 794
            ++ KYLPRFP LKRLH+D+ +     ++++  +L KC  L+H+SML Q       ES+  
Sbjct: 653  FLNKYLPRFPFLKRLHLDSNDFMMDHISLLSQILQKCKELLHLSMLYQ------PESSYG 706

Query: 795  LSTNGDSNSGTVFAKNNFSATLYAFVRDSPNLVGLDIDYSSISDEVSSRLALCLMRNMRR 854
            +S                 A LY FV +SP L  LD+DY  I +E+SSR+A+CL+RN ++
Sbjct: 707  MSA---------------CAALYDFVANSPKLKNLDVDYEYIPEEISSRIAVCLIRNAQK 751

Query: 855  TMDSSXXXXXXXXXXXXXXXGSLVTMTAKDVLERLTQLNTKQIIEKKDATKRYLLKKYVQ 914
            +++                 G L+T TA  +L +L   + K      D+++RYLLKKY Q
Sbjct: 752  SLNEDFELDELTSQDDLLFDGELITKTAGGILSKLGTSSEKS---NDDSSRRYLLKKYWQ 808

Query: 915  KLHKIHNNVQQTIDNLFEKRKSGDLPMQEKENLVRLILLEKNLVHILDIFDNMPNLSEVL 974
            K++++H NVQ TID+LFEKR   +L +Q KENL+RL+ +E  L  IL+I  +   ++ +L
Sbjct: 809  KINRVHTNVQSTIDDLFEKRSKDELTLQGKENLLRLLFVENTLSKILEILADSQEVASLL 868

Query: 975  GENKIASSDSLVDHPNLRHV-----------VETDNLNENSNERDLQVNENDNLQQRPHL 1023
             +N        +  PNL  V           +E   L+        QV+       RPH 
Sbjct: 869  DDNPEG-----ISAPNLEAVDSSTLLMPATRLEDGYLDTQGISASTQVD-------RPHF 916

Query: 1024 MATESGRTIDTLTGRPVFSRRSSTTSLASKKQEEEEGDFHKWGFYIQQQKALYPDGE--S 1081
            MAT+SGRTID  TGRPV  R+SS TS+  KKQEEEEG+ HKWG+++ Q+++  P  +  S
Sbjct: 917  MATDSGRTIDVTTGRPVVLRQSSQTSIVCKKQEEEEGELHKWGYFVAQKRSGLPLPQYVS 976

Query: 1082 QYGEXXXXXXXXXXXXLPSIDSKEKKIFTKLPSGPELRTAIIKAKGVSSIEELIQKINDY 1141
            ++              +       + I +K+PSG EL+ AIIKAKG++S+E+LI  +N +
Sbjct: 977  EHPAQSQPSQADNATDM-------RVIISKIPSGAELKAAIIKAKGIASMEDLIDNVN-H 1028

Query: 1142 HCCDIESLYNI 1152
            +   ++++Y I
Sbjct: 1029 NRVHLDNIYGI 1039

>Kwal_23.5488
          Length = 1112

 Score =  250 bits (639), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 167/570 (29%), Positives = 278/570 (48%), Gaps = 91/570 (15%)

Query: 425  FDDPGSTLEGNQEITLDVVYTRCCHLREILPIPSTLKQVT-DKTAPLQTLKFLNPKPTLI 483
            F  PG       +I  D+VYTRCCHLREILPIP+TLKQ+    T P+  L+  NPKP+LI
Sbjct: 562  FPPPG------MKIPHDLVYTRCCHLREILPIPATLKQLKKGSTDPIPLLQMRNPKPSLI 615

Query: 484  DILSFCDFIAIVPIQTIVFDNVNLSTEMFKIVISSVAYSSVLEKISLRNVTMNKESWQLL 543
            ++LSF DF+ I P+  +  D VNLS  M +I++ S+      EK+SLRN  ++ E W++L
Sbjct: 616  EVLSFSDFLGITPVLCLSLDGVNLSAGMLRIILCSLMNKKQFEKLSLRNTPLDHEGWKIL 675

Query: 544  CKFLLTSQSLNKIDIS-----------------QTRIKPETGTELLRSSMDWDLFAKTLA 586
            C F+   +SLN ID++                 ++R+   T +   R  M+W+L   +L 
Sbjct: 676  CYFISQCKSLNSIDLTMVPGISINVQKPSKSSQRSRVVRMTCSMTDRKEMNWNLLVASLI 735

Query: 587  KRAEHLRPLEEILVNGVNFDNIPLEDFQNFLITFATQKHLTNGIRLGLA--NATKSICSV 644
                 +  LEEI+++G       L++F++FL     Q   T  +RLGLA    T   C+V
Sbjct: 736  ----SVEGLEEIIISGAKMS---LKEFKDFL-----QLGCTKTLRLGLAYNELTTEQCNV 783

Query: 645  QHYKFLLEWMSNYNVQGVDLGFNDLSNLIKPTLGKLSSLTYPN---LHYFTLNSTNIQST 701
                 L  W+++ NV G+D+GFNDL   +      +   T  +     YF+L+STN++ +
Sbjct: 784  -----LAGWLAHSNVTGIDIGFNDLRGKLGAFASGIIDRTKSSRNVFKYFSLSSTNLEVS 838

Query: 702  -------NDMXXXXXXXXXXPNLEFLDLSNLPQVFPDILPYMYKYLPRFPQLKRLHIDNE 754
                   +D            +L+ LD+SN P++FP +  ++  Y+P F  L RLH+DN 
Sbjct: 839  EDSTPENDDFLKLISVLCYCEDLKLLDISNNPKLFPYVTSHLTNYMPVFVNLLRLHMDNN 898

Query: 755  NMTYKEMTVVCNLLAKCTGLIHVSMLSQKPPMSETESAENLSTNGDSNSGTVFAKNNFSA 814
            N+    +  +  +L  C  L HVSM                 T  D  +G   A      
Sbjct: 899  NIPAPSVVALAEVLPMCQKLSHVSM---------------RGTKLDYATGCALA------ 937

Query: 815  TLYAFVRDSPNLVGLDIDYSSISDEVSSRLALCLMRNMRRTMDSSXXXXXXXXXXXXXXX 874
               A +R S +L+ +D+D  ++ +++  +++L  M+NM +T++                 
Sbjct: 938  ---AAMRQSSSLLTIDLDAENLPNKIKDKMSLYSMKNMEKTLN-------RVDKSTSPEM 987

Query: 875  GSLVTMTAKDVLERLTQLNTKQIIEKKDATKRYLLKKYVQKLHKIHNNVQQTIDNLFEKR 934
               +    K++ + LT+   KQ +E        + + ++ +L K  + +++  ++LF+ R
Sbjct: 988  SDTLACLQKELADLLTEQPNKQDVE-------VMAQNFLLRLSKARSFIKKVTEDLFKLR 1040

Query: 935  KSGDLPMQEKENLVRLILLEKNLVHILDIF 964
              G+L    KE L+R   ++      L + 
Sbjct: 1041 VEGNLSTGGKETLIRFCFIDATFERGLQLL 1070

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 21/34 (61%)

Query: 266 LKRVKFAVDKFETDPPQQLPSRTPKPGNIMIPDD 299
            ++V FA + +  DPPQQ+ S+ P+ G + +  D
Sbjct: 389 FRKVSFATNTYFNDPPQQICSKNPRRGEVEVKPD 422

>Scas_690.33
          Length = 1423

 Score =  250 bits (638), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 171/555 (30%), Positives = 281/555 (50%), Gaps = 84/555 (15%)

Query: 435  NQEITLDVVYTRCCHLREILPIPSTLKQVT-DKTAPLQTLKFLNPKPTLIDILSFCDFIA 493
            N +I  DVVYTRCCHLREILPIP+TLKQ+    T P+  L+  NP+P++++I SF DF++
Sbjct: 659  NLKIPYDVVYTRCCHLREILPIPATLKQLKPGSTDPIPLLQLRNPRPSMVEIWSFSDFLS 718

Query: 494  IVPIQTIVFDNVNLSTEMFKIVISSVAYSSVLEKISLRNVTMNKESWQLLCKFLLTSQSL 553
            I P+  +  D V+L+ +M K++++S++    LEKISLRN  ++ E W+LLC F+  S+SL
Sbjct: 719  IAPVSCLSLDGVSLTVDMLKVLLASLSAKRNLEKISLRNTPLDDEGWKLLCYFISKSRSL 778

Query: 554  NKIDIS-----QTRIKPETGTELL------------RSSMDWDLFAKTLAKRAEHLRPLE 596
              ID++     +T ++  + + L             R+  +W+L A ++A +      LE
Sbjct: 779  VSIDLTMVPHIKTNVQKPSKSSLKSNIIRMECDLDNRTKRNWNLLAGSIAMKGG----LE 834

Query: 597  EILVNGVNFDNIPLEDFQNFLITFATQKHLTNGIRLGLA--NATKSICSVQHYKFLLEWM 654
            E++V+GV    + L  F+NF+             RLGLA  N +K  C +     L +W+
Sbjct: 835  ELVVSGV---KMSLNHFKNFIEVACISTE-----RLGLAYNNLSKEQCDI-----LAKWL 881

Query: 655  SNYNVQGVDLGFND----LSNLIKPTLGKLSSLTYPNL-HYFTLNSTNIQ-------STN 702
                V G+DLGFND    L+        K+ S    N+  Y +LN T+++        TN
Sbjct: 882  VKSKVTGLDLGFNDLRGKLTTFSDAVWQKIQSNEVKNVFKYLSLNDTSLEVEEGATSETN 941

Query: 703  DMXXXXXXXXXXPNLEFLDLSNLPQVFPDILPYMYKYLPRFPQLKRLHIDNENMTYKEMT 762
            ++           +L+FLDLSN P+ FP  L  + K LP F  L R+H+DNE +T   + 
Sbjct: 942  EVLRLLSILCYSEDLKFLDLSNNPKCFPHCLDTLVKCLPVFVNLVRIHLDNEQLTSTNII 1001

Query: 763  VVCNLLAKCTGLIHVSMLSQKPPMSETESAENLSTNGDSNSGTVFAKNNFSATLYAFVRD 822
            ++   L  C+ LIH SML                       GT     +  A   AF R 
Sbjct: 1002 MLAEALPLCSRLIHFSML-----------------------GTPLDLASCKALAEAF-RR 1037

Query: 823  SPNLVGLDIDYSSISDEVSSRLALCLMRNMRRTMDSSXXXXXXXXXXXXXXXGSLVTMTA 882
            S +L+ LD++Y  + D +  ++ +  MRNM+  +                  G  ++   
Sbjct: 1038 STSLLTLDVNYVYMPDNIKEKITMYSMRNMQNEL---RKVNSENEADGKATDGFHLSNLQ 1094

Query: 883  KDVLERLTQLNTKQIIEKKDATKRYLLKKYVQKLHKIHNNVQQTIDNLFEKRKSGDLPMQ 942
            +++ E LT+        + D+TK   +  ++ ++ +I + + + +++LF  +  G L ++
Sbjct: 1095 QELSELLTE------NYEADSTKNADI--FITRIEQIRSKISRVVEDLFNLKVQGQLNLE 1146

Query: 943  EKENLVRLILLEKNL 957
             KE L+RL  L++ L
Sbjct: 1147 GKETLIRLCFLDRTL 1161

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 20/31 (64%)

Query: 266 LKRVKFAVDKFETDPPQQLPSRTPKPGNIMI 296
           LK V F+ + +  DPPQQ+ S+ P+ G + +
Sbjct: 455 LKHVSFSTNTYFNDPPQQICSKNPRKGEVEV 485

>YJL042W (MHP1) [2870] chr10 (361165..365361) Microtubule-interacting
            protein, functions in stabilization of microtubules [4197
            bp, 1398 aa]
          Length = 1398

 Score =  245 bits (625), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 173/582 (29%), Positives = 291/582 (50%), Gaps = 107/582 (18%)

Query: 426  DDPGSTLEG-NQEITLDVVYTRCCHLREILPIPSTLKQVT-DKTAPLQTLKFLNPKPTLI 483
            DD G  L   + +I  D+VYTRCCHLREILPIP+TLKQ+    T P+  L+  NP+P+++
Sbjct: 623  DDEGEILPPPSLKIPHDIVYTRCCHLREILPIPATLKQLKKGSTDPIPILQLRNPRPSMV 682

Query: 484  DILSFCDFIAIVPIQTIVFDNVNLSTEMFKIVISSVAYSSVLEKISLRNVTMNKESWQLL 543
            +I SF DF++I P+  +  D V L+ +M +I++SS+ Y    +K+SLRN  +++E W++L
Sbjct: 683  EIWSFSDFLSIAPVLCLSLDGVQLTVQMLRIILSSLVYKQHFQKLSLRNTPLDEEGWKVL 742

Query: 544  CKFLLTSQSLNKIDIS---------QTRIKPETGTELL--------RSSMDWDLFAKTLA 586
            C F+  ++SL+ ID++         Q   K    +++L        RS M+WDL   ++A
Sbjct: 743  CYFVSKAKSLHSIDLTMVPSIKTNVQKPSKSSLKSKILRMQCNLENRSDMNWDLLTASIA 802

Query: 587  KRAEHLRPLEEILVNGVNFDNIPLEDFQNFLIT--FATQKHLTNGIRLGLA--NATKSIC 642
                 +  LEEI+++G   ++     F+NF++    AT+       RLGLA    +KS C
Sbjct: 803  L----MGGLEEIVISGAKMNSA---QFKNFILVACIATE-------RLGLAYNGLSKSQC 848

Query: 643  SVQHYKFLLEWMSNYNVQGVDLGFND----LSNLIKPTLGKLSSLTYPNLHYF-TLNSTN 697
                   L +WM    V G+D+GFND    LS+     LGK+      N+  F +LN TN
Sbjct: 849  DD-----LAKWMVQSKVTGLDVGFNDLNGKLSSFTDAVLGKIQKANEKNVFKFLSLNGTN 903

Query: 698  IQ-------STNDMXXXXXXXXXXPNLEFLDLSNLPQVFPDILPYMYKYLPRFPQLKRLH 750
            ++         N++           NL+FLD+SN P +FP  +P +  +LP F  L RLH
Sbjct: 904  LRVNEHDTFENNEVLKLISVLCYLENLKFLDISNNPAIFPHCVPTLIDFLPVFVNLVRLH 963

Query: 751  IDNENMTYKEMTVVCNLLAKCTGLIHVSMLSQKPPMSETESAENLSTNGDSNSGTVFAKN 810
            ID  N++   + ++  +L  C+ L + SML      +E + A                  
Sbjct: 964  IDYNNLSSTSVVMLAEILPMCSRLNYFSMLG-----TELDLAS----------------- 1001

Query: 811  NFSATLYAFVRDSPNLVGLDIDYSSISDEVSSRLALCLMRNMRRTMDSSXXXXXXXXXXX 870
              S  L   VR S +L+ LD+DY  + + +  +++L  +RN++                 
Sbjct: 1002 --SKALAEAVRKSSSLMTLDVDYVYMPENIKEKISLYALRNIQ----------------- 1042

Query: 871  XXXXGSLVTMTAKDVLERLTQL------NTKQIIEKKDATKRY--LLKKYVQKLHKIHNN 922
                G L  + + D   + +Q        +  + EK D ++ Y  +++ ++ K+      
Sbjct: 1043 ----GELKRVNSDDKDIKDSQFSSLQDQLSLLLTEKADNSEHYNKMVENFMAKIALARIK 1098

Query: 923  VQQTIDNLFEKRKSGDLPMQEKENLVRLILLEKNLVHILDIF 964
            + + + +LF+ + +G L ++ KE L+RL  +E +L    D+ 
Sbjct: 1099 ISKVVHDLFDLKLNGQLNLEGKEALIRLCFIEASLERGCDLL 1140

 Score = 34.3 bits (77), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 266 LKRVKFAVDKFETDPPQQLPSRTPKPGNIMI 296
           LK V FA + +  DPPQQ+ S+ P+ G + +
Sbjct: 446 LKHVSFATNTYFNDPPQQICSKNPRKGEVEV 476

>KLLA0E11847g complement(1044591..1048385) some similarities with
            sp|P43638 Saccharomyces cerevisiae YJL042w MHP1
            microtubule-associated protein, hypothetical start
          Length = 1264

 Score =  238 bits (607), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 163/553 (29%), Positives = 274/553 (49%), Gaps = 84/553 (15%)

Query: 435  NQEITLDVVYTRCCHLREILPIPSTLKQVT-DKTAPLQTLKFLNPKPTLIDILSFCDFIA 493
            N +I  DVVYTRCCHLREILPIP+T+KQ+    T P+  L+  NPKP+ +++LSF DF++
Sbjct: 616  NIKIPHDVVYTRCCHLREILPIPATMKQLKKGSTEPIPFLQLRNPKPSKVEVLSFSDFLS 675

Query: 494  IVPIQTIVFDNVNLSTEMFKIVISSVAYSSVLEKISLRNVTMNKESWQLLCKFLLTSQSL 553
            I P+  +  D V+LS EM +I++SS+ Y    EK+SLRN  ++ + W++L  F+   +SL
Sbjct: 676  IAPVLCLSLDGVSLSVEMLRIILSSITYKDKFEKLSLRNTPVDHDGWKVLSYFVSKCKSL 735

Query: 554  NKIDIS---------QTRIKPETGTELL--------RSSMDWDLFAKTLAKRAEHLRPLE 596
            N +D++         Q   K   G+ +         RS M+W L +  +A +      LE
Sbjct: 736  NSLDVTMIPGLALNVQKPSKSSNGSTVPRMVCNMENRSDMNWSLLSAAVAAKGG----LE 791

Query: 597  EILVNGVNFDNIPLEDFQNFLITFATQKHLTNGIRLGLA--NATKSICSVQHYKFLLEWM 654
            E++V+G   + + L++F    I  A  K L    RLGLA  N T   C     + L  WM
Sbjct: 792  EMIVSGAFMNQVQLQNF----IDIAWTKTL----RLGLAYNNLTLEQC-----QCLATWM 838

Query: 655  SNYNVQGVDLGFNDLSNLIKPTLGKLSSLTYPN---LHYFTLNSTNI-------QSTNDM 704
            +N  +QGVD+G+NDL+  + P +  +   T        + +LNSTN+          N++
Sbjct: 839  TNSKIQGVDVGYNDLNGKLGPFISAVIEKTKKGKNVFKFLSLNSTNLSVPKGAKSEDNEV 898

Query: 705  XXXXXXXXXXPNLEFLDLSNLPQVFPDILPYMYKYLPRFPQLKRLHIDNENMTYKEMTVV 764
                       +L+FLDLSN P +FP  +  +   LP F  L RLH+DN N++   +   
Sbjct: 899  LSLLNGLCYCDSLKFLDLSNNPGLFPYGMRTLTAILPVFVSLLRLHLDNNNLSTTAVMQF 958

Query: 765  CNLLAKCTGLIHVSMLSQKPPMSETESAENLSTNGDSNSGTVFAKNNFSATLYAFVRDSP 824
              +L  C  + ++S+L             NL+                ++ L A V++S 
Sbjct: 959  AEVLPMCQRINYISLL-----------GTNLNI-------------ISASALAAAVKNSK 994

Query: 825  NLVGLDIDYSSISDEVSSRLALCLMRNMRRTMDSSXXXXXXXXXXXXXXXGSLVTMTAKD 884
             ++ +DIDY+ + D +  ++++  MRN +R ++                 G       K 
Sbjct: 995  TIITMDIDYAHVPDRIKEKISVYSMRNTQRELE-----------QINKSGGDDGHEKLKS 1043

Query: 885  VLERLTQLNTKQIIEKKDATKRYLLKKYVQKLHKIHNNVQQTIDNLFEKRKSGDLPMQEK 944
            + E L +L T+    + D     L+  +++++  +   +   I+ LF+ R +G+L  + K
Sbjct: 1044 LQEELGRLLTEDSSTRSDYDT--LVSNFLERIQTVRAKLHAAIEELFKLRLNGELSTEGK 1101

Query: 945  ENLVRLILLEKNL 957
            E L++   ++ + 
Sbjct: 1102 ETLIKFCFIDASF 1114

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (64%)

Query: 266 LKRVKFAVDKFETDPPQQLPSRTPKPGNIMIPDD 299
           LKRV FA + +  DPPQQ+ SR P+ G + +  D
Sbjct: 435 LKRVAFAANTYFNDPPQQICSRNPRKGEVEVKAD 468

>CAGL0J00803g complement(83483..87427) similar to sp|P43638
            Saccharomyces cerevisiae YJL042w MHP1, hypothetical start
          Length = 1314

 Score =  232 bits (591), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 167/576 (28%), Positives = 288/576 (50%), Gaps = 95/576 (16%)

Query: 435  NQEITLDVVYTRCCHLREILPIPSTLKQVT-DKTAPLQTLKFLNPKPTLIDILSFCDFIA 493
            N +I  DVVYTRCCHLREILPIP+TLKQ+    T P+  L+  NP+P+L++I SF DF++
Sbjct: 504  NLKIPHDVVYTRCCHLREILPIPATLKQIKKGSTDPIPLLQLRNPRPSLLEIWSFSDFLS 563

Query: 494  IVPIQTIVFDNVNLSTEMFKIVISSVAYSSVLEKISLRNVTMNKESWQLLCKFLLTSQSL 553
            I P+  +  D V+L+ EM +I++SS+  +  LEK+++RN  +N++ W++L  F +T Q  
Sbjct: 564  ISPVLCVSLDGVSLTEEMLRIILSSLVSNPHLEKLTMRNTPLNEDGWKILSYF-ITKQKK 622

Query: 554  NKIDISQTRI--------KPETGT--------ELL---------RSSMDWDLFAKTLAKR 588
            N + +  T +        KP   +         LL         RS M+WDL    +A +
Sbjct: 623  NFVALDLTMVPTIKTNVQKPSKSSLAKNANNPNLLKRMECNTHNRSDMNWDLLTAAVATK 682

Query: 589  AEHLRPLEEILVNGVNFDNIPLEDFQNFLITFATQKHLTNGIRLGLANATKSICSVQHYK 648
                  +EE ++ G          F+NF+     +   TN  RLGLA    +  +++  K
Sbjct: 683  EGG---IEEFVLAGACMS---YTQFKNFI-----ELACTNTDRLGLA---YNKLTMEQCK 728

Query: 649  FLLEWMSNYNVQGVDLGFNDL----SNLIKPTLGKLSSLTYPN-LHYFTLNSTNIQ---- 699
             L EW+   N++G+DLGFNDL    S        K+ ++   N + Y +LNSTN+     
Sbjct: 729  VLAEWIVTSNIRGLDLGFNDLKGKTSVFTDAVANKVQNVGEKNEMKYISLNSTNLSVEAD 788

Query: 700  ---STNDMXXXXXXXXXXPNLEFLDLSNLPQVFPDILPYMYKYLPRFPQLKRLHIDNENM 756
                 N++           NL+FLDLSN P++FP  +  +   LP +  L RLH+D  ++
Sbjct: 789  TTPENNEVLRLLSVLCYSENLKFLDLSNNPKIFPHCIKTLTTSLPVYVNLIRLHLDYNDL 848

Query: 757  TYKEMTVVCNLLAKCTGLIHVSMLSQKPPMSETESAENLSTNGDSNSGTVFAKNNFSATL 816
                + V+   L  C+ L H+S+L  K          NL++               +  L
Sbjct: 849  DCASIVVLAESLPLCSKLHHLSLLGSK---------LNLAS---------------AKAL 884

Query: 817  YAFVRDSPNLVGLDIDYSSISDEVSSRLALCLMRNMRRTMDSSXXXXXXXXXXXXXXXGS 876
               V  S  L+ LD++Y+++ + +  R++L  MRN++  +D+                 S
Sbjct: 885  TEAVNKSNTLMTLDLEYNTVPESIKERMSLYTMRNIQNELDNVQKTKRKAGL-------S 937

Query: 877  LVTMTAKDVLERLTQLNTKQ------IIEKKDATKRY--LLKKYVQKLHKIHNNVQQTID 928
            L ++  +++     Q++T Q      + +K + +  Y  L+ ++++K+ K+   +++ + 
Sbjct: 938  LPSVPQEEMAANEKQISTLQEELSSLLTDKFEDSLEYDKLVVEFIEKITKVRTKIEKVVS 997

Query: 929  NLFEKRKSGDLPMQEKENLVRLILLEKNL---VHIL 961
            +LF+ R   +L  + KE L+ L L++ +    +H+L
Sbjct: 998  DLFDLRVKNELSCEGKETLINLCLIDSSFEQGIHLL 1033

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 19/31 (61%)

Query: 266 LKRVKFAVDKFETDPPQQLPSRTPKPGNIMI 296
           LK V FA   +  DPPQQ+ S+ P+ G + +
Sbjct: 328 LKHVAFATTTYFNDPPQQICSKNPRKGEVEV 358

>ACR059W [1107] [Homologous to ScYJL042W (MHP1) - SH]
           complement(459751..463401) [3651 bp, 1216 aa]
          Length = 1216

 Score =  190 bits (482), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 143/553 (25%), Positives = 257/553 (46%), Gaps = 85/553 (15%)

Query: 441 DVVYTRCCHLREILPIPSTLKQVTDKTA-PLQTLKFLNPKPTLIDILSFCDFIAIVPIQT 499
           D++YTRCC+LREILPIP+ LKQ+   ++ P+  L+  NPKP++I+ILS  DF++I P+  
Sbjct: 475 DMLYTRCCYLREILPIPAMLKQLKPGSSDPIPLLQLRNPKPSMIEILSLGDFLSIAPVLC 534

Query: 500 IVFDNVNLSTEMFKIVISSVAYSSVLEKISLRNVTMNKESWQLLCKFLLTSQSLNKIDIS 559
              D V+LS +M  I++SS+     LEK+S+RN  +++E W+ L  F+ +S++L  +D++
Sbjct: 535 FSMDGVSLSVQMLHIILSSLRCMGRLEKLSMRNTPLDEEGWKTLAYFISSSKTLRGLDLT 594

Query: 560 -----------------QTRIKPETGTELL-RSSMDWDLFAKTLAKRAEHLRPLEEILVN 601
                            Q  I P    +L  R+  +W+LF   +A        LEE++++
Sbjct: 595 MIPGIPLNVQKPSKSSGQCSI-PRMKCDLTSRAEQNWNLFTAAIAINGN----LEELIIS 649

Query: 602 GVNFDNIPLEDFQNFLITFATQKHLTNGIRLGLANATKSICSVQHYKFLLEWMSNYNVQG 661
           G             F I      H     RLGLA    +  S  H + L  W+    V G
Sbjct: 650 GAKI------SLGQFKILLDIGCHSLE--RLGLAF---NDLSHGHCEALASWLPGCKVTG 698

Query: 662 VDLGFNDLSNLIKP---TLGKLSSLTYPNLHYFTLNSTNIQ-------STNDMXXXXXXX 711
           +D+GFN L+  ++P    L + S +   ++   +LNST++         T+D+       
Sbjct: 699 LDIGFNPLNGKMRPLAEALMRKSKVGNNSIACISLNSTDLAIPPNATVETSDVVALLSAL 758

Query: 712 XXXPNLEFLDLSNLPQVFPDILPYMYKYLPRFPQLKRLHIDNENMTYKEMTVVCNLLAKC 771
               NL+FL LSN P +F   +  +   LP      RL +D  N++   +  +  +L  C
Sbjct: 759 GYCENLKFLPLSNNPNMFIYGMKPLTDILPVLVGFARLQLDYNNLSSTSIITLAEVLPMC 818

Query: 772 TGLIHVSMLSQKPPMSETESAENLSTNGDSNSGTVFAKNNFSATLYAFVRDSPNLVGLDI 831
           T + ++S++  K                D++SG         A L   ++ S +L  +D 
Sbjct: 819 TTIGYLSLVGSKL---------------DTSSG---------AALVLALKKSGSLFTIDA 854

Query: 832 DYSSISDEVSSRLALCLMRNMRRTMDSSXXXXXXXXXXXXXXXGSLVTMTAKDVLERLTQ 891
           D+S + D +   +++  ++N+   ++ S                      +  + + L  
Sbjct: 855 DFSEMPDAIRHDVSIYSLKNLENVLELSKTGHDMGK--------------STSLQQELAV 900

Query: 892 LNTKQIIEKKDATKRYLLKKYVQKLHKIHNNVQQTIDNLFEKRKSGDLPMQEKENLVRLI 951
           L   +  +K+D    +L++ + +++  I   ++    +LF+ R  G+L  + KE L+R  
Sbjct: 901 LLAGKTQDKEDYD--HLVESFAKRICDIRKRLKTVTKDLFKLRVRGELSTEGKETLIRFC 958

Query: 952 LLEKNLVHILDIF 964
            L+ +    L + 
Sbjct: 959 FLDSSFEKALGLL 971

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 21/34 (61%)

Query: 266 LKRVKFAVDKFETDPPQQLPSRTPKPGNIMIPDD 299
           LKRV FA + +   PPQQ+ SR P+ G + +  D
Sbjct: 335 LKRVSFARNTYFNSPPQQICSRNPRKGEVEVKAD 368

>KLLA0C01892g complement(149917..151911) weakly similar to
            sgd|S0002907 Saccharomyces cerevisiae YDR499w LCD1 cell
            cycle checkpoint protein, start by similarity
          Length = 664

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 1101 IDSKEKKIF-TKLPSGPELRTAIIKAKGVSSIEELIQKINDYHCCDIESLYNILKQNEL 1158
            I S E KI   +LP GP +R+ I K K + ++++L+ K  +     I+S+ ++L +N+L
Sbjct: 189  ILSPEHKIIKARLPLGPPIRSLIFKWKSIYTLDQLVDKTLEILAIAIKSV-SVLPENKL 246

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.130    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 34,868,897
Number of extensions: 1487261
Number of successful extensions: 4726
Number of sequences better than 10.0: 46
Number of HSP's gapped: 4779
Number of HSP's successfully gapped: 62
Length of query: 1186
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1073
Effective length of database: 12,684,275
Effective search space: 13610227075
Effective search space used: 13610227075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 67 (30.4 bits)