Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0M02585g36035516060.0
YPL138C (SPP1)3533616502e-82
Scas_700.373693606452e-81
Sklu_1701.23343526273e-79
KLLA0D07260g3423546032e-75
Kwal_26.86973323515901e-73
ACR115W3483515205e-63
Scas_666.2*318371063e-05
KLLA0A06974g295551063e-05
CAGL0H02035g274681054e-05
YNL097C (PHO23)330371045e-05
Kwal_56.242061502581066e-05
Scas_541.4282511036e-05
Sklu_2376.2271641037e-05
YHR090C (YNG2)282521011e-04
AFL127C1521511022e-04
AEL100W28551974e-04
CAGL0G06556g31635984e-04
Sklu_2428.1120564954e-04
ADL263W29347974e-04
KLLA0C13409g39137966e-04
Kwal_26.838431837940.001
KLLA0C16203g145448940.002
Kwal_55.2172419358890.002
YMR176W (ECM5)141150880.008
YOR064C (YNG1)21942820.022
Scas_549.520131790.046
Scas_720.39145554800.074
CAGL0L10384g22186780.074
CAGL0L03091g78266780.13
Kwal_27.1110738872740.28
KLLA0F25828g62351740.32
Scas_717.1274291740.34
YKL005C (BYE1)59416740.37
CAGL0M10285g60759740.40
KLLA0F16533g22335700.77
Scas_629.2360216710.82
YMR075W684110701.0
YPL181W (CTI6)50669701.2
YJR119C72864701.3
YKR029C (SET3)75150691.5
Kwal_26.805963170681.8
AGL075C59439672.2
KLLA0F02882g79655663.9
Kwal_47.1815546541654.5
YDR228C (PCF11)62679646.3
CAGL0J01529g67166636.9
YER051W49246628.5
KLLA0E18898g44637629.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M02585g
         (355 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M02585g complement(297048..298130) similar to tr|Q03012 Sac...   623   0.0  
YPL138C (SPP1) [5308] chr16 complement(291365..292426) Component...   254   2e-82
Scas_700.37                                                           253   2e-81
Sklu_1701.2 YPL138C, Contig c1701 2003-3007 reverse complement        246   3e-79
KLLA0D07260g 619630..620658 similar to sgd|S0006059 Saccharomyce...   236   2e-75
Kwal_26.8697                                                          231   1e-73
ACR115W [1162] [Homologous to ScYPL138C (SPP1) - SH] complement(...   204   5e-63
Scas_666.2*                                                            45   3e-05
KLLA0A06974g complement(630572..631459) similar to sp|P38806 Sac...    45   3e-05
CAGL0H02035g 182137..182961 similar to sp|P38806 Saccharomyces c...    45   4e-05
YNL097C (PHO23) [4494] chr14 complement(441366..442358) Protein ...    45   5e-05
Kwal_56.24206                                                          45   6e-05
Scas_541.4                                                             44   6e-05
Sklu_2376.2 YHR090C, Contig c2376 1317-2132 reverse complement         44   7e-05
YHR090C (YNG2) [2380] chr8 complement(283778..284626) Component ...    44   1e-04
AFL127C [3068] [Homologous to ScYMR176W (ECM5) - SH] (193474..19...    44   2e-04
AEL100W [2406] [Homologous to ScYHR090C (YNG2) - SH] complement(...    42   4e-04
CAGL0G06556g 628181..629131 similar to sp|P50947 Saccharomyces c...    42   4e-04
Sklu_2428.11 YOR064C, Contig c2428 18153-18770                         41   4e-04
ADL263W [1478] [Homologous to ScYNL097C (PHO23) - SH] complement...    42   4e-04
KLLA0C13409g complement(1143660..1144835) some similarities with...    42   6e-04
Kwal_26.8384                                                           41   0.001
KLLA0C16203g complement(1414169..1418533) weakly similar to sp|Q...    41   0.002
Kwal_55.21724                                                          39   0.002
YMR176W (ECM5) [4131] chr13 (611739..615974) Protein involved in...    39   0.008
YOR064C (YNG1) [4872] chr15 complement(446080..446739) Component...    36   0.022
Scas_549.5                                                             35   0.046
Scas_720.39                                                            35   0.074
CAGL0L10384g complement(1109390..1110055) similar to tr|Q08465 S...    35   0.074
CAGL0L03091g complement(354241..356589) similar to sp|P36124 Sac...    35   0.13 
Kwal_27.11107                                                          33   0.28 
KLLA0F25828g complement(2401463..2403334) similar to sp|Q04779 S...    33   0.32 
Scas_717.12                                                            33   0.34 
YKL005C (BYE1) [3252] chr11 complement(432736..434520) Protein w...    33   0.37 
CAGL0M10285g complement(1029427..1031250) similar to sp|P36106 S...    33   0.40 
KLLA0F16533g complement(1525315..1525986) weakly similar to sgd|...    32   0.77 
Scas_629.23                                                            32   0.82 
YMR075W (YMR075W) [4034] chr13 (413981..416035) Protein containi...    32   1.0  
YPL181W (CTI6) [5266] chr16 (203420..204940) Protein that physic...    32   1.2  
YJR119C (YJR119C) [3011] chr10 complement(644219..646405) Protei...    32   1.3  
YKR029C (SET3) [3284] chr11 complement(497220..499475) Component...    31   1.5  
Kwal_26.8059                                                           31   1.8  
AGL075C [4236] [Homologous to ScYMR075W - SH] (568737..570521) [...    30   2.2  
KLLA0F02882g 269162..271552 weakly similar to sp|P36124 Saccharo...    30   3.9  
Kwal_47.18155                                                          30   4.5  
YDR228C (PCF11) [1064] chr4 complement(921918..923798) Component...    29   6.3  
CAGL0J01529g complement(143666..145681) similar to sp|Q04779 Sac...    29   6.9  
YER051W (YER051W) [1479] chr5 (254655..256133) Protein containin...    28   8.5  
KLLA0E18898g 1670923..1672263 weakly similar to sgd|S0006102 Sac...    28   9.7  

>CAGL0M02585g complement(297048..298130) similar to tr|Q03012
           Saccharomyces cerevisiae YPL138c, hypothetical start
          Length = 360

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/355 (87%), Positives = 311/355 (87%)

Query: 1   MSNLLPEWCPPYSTTKIDTNTGEDVYCICKKPDYGELMVGCDGCDDWFHFECMKIPETYR 60
           MSNLLPEWCPPYSTTKIDTNTGEDVYCICKKPDYGELMVGCDGCDDWFHFECMKIPETYR
Sbjct: 1   MSNLLPEWCPPYSTTKIDTNTGEDVYCICKKPDYGELMVGCDGCDDWFHFECMKIPETYR 60

Query: 61  NLVESFICPYCRVGITGPGSKGDGECPKSLWKKKCRLQDCYEPCESGSKYCSKEHGKEYM 120
           NLVESFICPYCRVGITGPGSKGDGECPKSLWKKKCRLQDCYEPCESGSKYCSKEHGKEYM
Sbjct: 61  NLVESFICPYCRVGITGPGSKGDGECPKSLWKKKCRLQDCYEPCESGSKYCSKEHGKEYM 120

Query: 121 SRLLNKVKIKNDLNNRYANESDDKLLKDVYHATKNNVEKFKTFGXXXXXXXXXXXXXXHG 180
           SRLLNKVKIKNDLNNRYANESDDKLLKDVYHATKNNVEKFKTFG              HG
Sbjct: 121 SRLLNKVKIKNDLNNRYANESDDKLLKDVYHATKNNVEKFKTFGSSSFIDSDIDRVDRHG 180

Query: 181 EXXXXXXXXXXXXXXLLTEKDNITNNQIEGLKKKVEELDKYLDWISSVNKLINGEDNTIE 240
           E              LLTEKDNITNNQIEGLKKKVEELDKYLDWISSVNKLINGEDNTIE
Sbjct: 181 EIYDKIINDDKYYKDLLTEKDNITNNQIEGLKKKVEELDKYLDWISSVNKLINGEDNTIE 240

Query: 241 QEENVNDTIXXXXXXXXXXXXXXXXAICGYSLNLAKIPCNPEEFYNKYSEITTSTPDCNE 300
           QEENVNDTI                AICGYSLNLAKIPCNPEEFYNKYSEITTSTPDCNE
Sbjct: 241 QEENVNDTIKTKKKKKKSQKRRSKKAICGYSLNLAKIPCNPEEFYNKYSEITTSTPDCNE 300

Query: 301 IEGICIKLRCNKHSDWSTMTSDQYTRQIISLETHLKRLDLSISTRKRQLNINYFE 355
           IEGICIKLRCNKHSDWSTMTSDQYTRQIISLETHLKRLDLSISTRKRQLNINYFE
Sbjct: 301 IEGICIKLRCNKHSDWSTMTSDQYTRQIISLETHLKRLDLSISTRKRQLNINYFE 355

>YPL138C (SPP1) [5308] chr16 complement(291365..292426) Component of
           SET1 and COMPASS complex, may be involved in chromatin
           remodeling [1062 bp, 353 aa]
          Length = 353

 Score =  254 bits (650), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 141/361 (39%), Positives = 197/361 (54%), Gaps = 27/361 (7%)

Query: 5   LPEWCPPYSTTKIDTNTGEDVYCICKKPDYGELMVGCDGCDDWFHFECMKIPETYRNLVE 64
           LP+WCPP+ST K +  TGEDVYCICK+PDYGELMVGCDGCDDWFHF C+ IPE +++LV 
Sbjct: 3   LPQWCPPHSTLKRNPTTGEDVYCICKRPDYGELMVGCDGCDDWFHFTCLHIPEQFKDLVF 62

Query: 65  SFICPYCRVGITGPGS----KGDGECPKSLWKKKCRLQDCYEPCESGSKYCSKEHGKEYM 120
           SF CPYC+ GITG        G+G  PK+LWK+KCR+ DCY+PC   SKYCS+EHG+E++
Sbjct: 63  SFYCPYCQAGITGKNKDAIINGEGSLPKTLWKRKCRISDCYKPCLQDSKYCSEEHGREFV 122

Query: 121 SRLLNKVKIKNDLNNRYANESDDKLLKDVYHATKNNVEKFKTFGXXXXXXXXXXXXXXHG 180
                     ND+ +R   + D  ++K +   T  +++KFK FG                
Sbjct: 123 ----------NDIWSRLKTDEDRAVVKKMVEQT-GHIDKFKKFGQLDFIDNNIVVKT--D 169

Query: 181 EXXXXXXXXXXXXXXLLTEKDNITNNQ---IEGLKKKVEELDKYLDWISSV-NKLINGED 236
           +              L T +D++   Q   +   KKK+E L+ YL W+ +V  ++   +D
Sbjct: 170 DEKEIFDQIVVRDMTLKTLEDDLQEVQEISLPLFKKKLELLEVYLGWLDNVYTEMRKLDD 229

Query: 237 NTIEQEE--NVNDTIXXXXXXXXXXXXXXXXAICGYSLNLAKIPCNPEEFYNKYSEITTS 294
           +     E    +                    ICGY     +IPC+ EEF   +     S
Sbjct: 230 DAASHVECGKEDSKGTKRKKKKNSSRSRARKNICGYCSTYERIPCSVEEFVRDFG----S 285

Query: 295 TPDCNEIEGICIKLRCNKHSDWSTMTSDQYTRQIISLETHLKRLDLSISTRKRQLNINYF 354
             +  +I  +C K +CN+H DW +   +QY +QI SLE+  +RL   I  RK+QLNI Y+
Sbjct: 286 NEEATKIHEVCTKWKCNRHLDWVSTNQEQYLQQIDSLESMQERLQHLIQARKKQLNIQYY 345

Query: 355 E 355
           E
Sbjct: 346 E 346

>Scas_700.37
          Length = 369

 Score =  253 bits (645), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 131/360 (36%), Positives = 197/360 (54%), Gaps = 16/360 (4%)

Query: 5   LPEWCPPYSTTKIDTNTGEDVYCICKKPDYGELMVGCDGCDDWFHFECMKIPETYRNLVE 64
           LP WCPPYS  K D  T E VYCICK+PD+GELMVGCDGCDDWFHF C+KIP  Y+ LV 
Sbjct: 7   LPAWCPPYSKQKKDPETNEAVYCICKRPDHGELMVGCDGCDDWFHFSCLKIPTVYQKLVF 66

Query: 65  SFICPYCRVGITGPGSKGDGE----CPKSLWKKKCRLQDCYEPCESGSKYCSKEHGKEYM 120
           SF CPYC+ GITGP +   G+     PK+LWK+KCRL DCY P    SKYCSKEHG E+M
Sbjct: 67  SFFCPYCQAGITGPKANALGDDQIPYPKTLWKRKCRLPDCYLPVMEKSKYCSKEHGVEFM 126

Query: 121 SRLLNKVKIKNDLNNRYANESDDKLLKDVYHATKNN-VEKFKTFGXXXXXXXXXXXXXXH 179
             +++K+ + +      + +  +  ++D+   ++N+ VE F   G              +
Sbjct: 127 KGIMDKLDVSDVGKTLRSEDDKESFVRDMIKRSENDQVEAFINLG-ASDFIDKEVPKELN 185

Query: 180 GEXXXXXXXXXXXXXXLLTEKDNITNNQIEGLKKKVEELDKYLDWISSVNKLINGEDNTI 239
            E              L   ++ +    I  +KK +  L+KY  W + +N  +N    ++
Sbjct: 186 PELYQKIITNDDRMIDLQRNQETVEGITIPEIKKNITLLEKYASWANDINIKLN---KSV 242

Query: 240 EQEENVNDT----IXXXXXXXXXXXXXXXXAICGYSLNLAKIPCNPEEFYNKYSEITTST 295
           E E +   +                     +ICGY  +   IPC+ E+F ++Y    ++ 
Sbjct: 243 EDEGDAMSSPTKKSTKGKKKKPHNKNKPKRSICGYIKSFETIPCSVEDFISEYD---SND 299

Query: 296 PDCNEIEGICIKLRCNKHSDWSTMTSDQYTRQIISLETHLKRLDLSISTRKRQLNINYFE 355
           P    I+G+C+  +C +H+ W +M  DQY +Q+ S +++L+R+ L + +R+ QL+I Y+E
Sbjct: 300 PTITHIQGVCLNSKCQRHAGWVSMRMDQYVQQLESSQSYLERIKLLMHSRRNQLHIQYYE 359

>Sklu_1701.2 YPL138C, Contig c1701 2003-3007 reverse complement
          Length = 334

 Score =  246 bits (627), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 133/352 (37%), Positives = 194/352 (55%), Gaps = 30/352 (8%)

Query: 5   LPEWCPPYSTTKIDTNTGEDVYCICKKPDYGELMVGCDGCDDWFHFECMKIPETYRNLVE 64
           LP WCPPY+T K D +TGEDVYCICKKPD G+LMVGCDGCDDWFHFEC+KI   ++ LV 
Sbjct: 4   LPAWCPPYNTKKKDLDTGEDVYCICKKPDNGDLMVGCDGCDDWFHFECLKISPKFKELVF 63

Query: 65  SFICPYCRVGITGPGSKGDGECPKSLWKKKCRLQDCYEPCESGSKYCSKEHGKEYMSRLL 124
           SF CPYC+ GITGPGS      PK++WK+KCRL  CY+ C   SKYC KEHGK+YM  L 
Sbjct: 64  SFYCPYCQAGITGPGSITPNRLPKTIWKRKCRLVGCYKECAKDSKYCCKEHGKKYMCTLW 123

Query: 125 NKVKIKNDLNNRYANESDDKLLKDVYHATKNNVEKFKTFGXXXXXXXXXXXXXXHGEXXX 184
            +V+ K        +++   ++K +  A++ +VE     G                    
Sbjct: 124 ERVRCK--------DKNPSHIVKKMLSASE-SVEALTNIGKGPIPTASIDRDPV---LYN 171

Query: 185 XXXXXXXXXXXLLTEKDNITNNQIEGLKKKVEELDKYLDWISSVN-KLINGEDNTIEQEE 243
                      L  + D I   +   +++++  L++YL+W+  VN +L   ED       
Sbjct: 172 KLVANDSSLIDLNRQLDKINAEEKPQVEQQIGALNRYLEWLKEVNGRLFASED------- 224

Query: 244 NVNDTIXXXXXXXXXXXXXXXXAICGYSLNLAKIPCNPEEFYNKYSEITTSTPDCNEIEG 303
              D                  ++CGY  +  +IPC+ E+F ++Y E  T       + G
Sbjct: 225 ---DAKVKSKPKSRRKKTGKQKSMCGYKADY-QIPCSLEDFVSEYDEEATI------VHG 274

Query: 304 ICIKLRCNKHSDWSTMTSDQYTRQIISLETHLKRLDLSISTRKRQLNINYFE 355
           +C KLRC++H+DWS + S+ +  Q+ +L+T ++RL L +  R+ QLN+ ++E
Sbjct: 275 VCCKLRCSRHADWSGVLSNGFELQLQTLQTSIQRLQLLVRVRQSQLNMQFYE 326

>KLLA0D07260g 619630..620658 similar to sgd|S0006059 Saccharomyces
           cerevisiae YPL138c, start by similarity
          Length = 342

 Score =  236 bits (603), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 134/354 (37%), Positives = 192/354 (54%), Gaps = 30/354 (8%)

Query: 5   LPEWCPPYSTTKIDTNTGEDVYCICKKPDYGELMVGCDGCDDWFHFECMKIPETYRNLVE 64
           LP WCP Y + K D  TGE+VYCICKKPD GELMVGCDGCDDWFHF C+KIPE YR+LV 
Sbjct: 3   LPSWCPRYDSRKHDPKTGEEVYCICKKPDTGELMVGCDGCDDWFHFSCLKIPEKYRDLVF 62

Query: 65  SFICPYCRVGITGPGSKGDGECPKSLWKKKCRLQDCYEPCE--SGSKYCSKEHGKEYMSR 122
           SF C YC  GITGP     G+ PK+LWK+KCRL +CY  C+  S SKYCSK+H  +Y+  
Sbjct: 63  SFYCSYCSAGITGPALINGGKLPKTLWKRKCRLPECYTECDANSRSKYCSKKHAVQYVQS 122

Query: 123 LLNKVKIKNDLNNRYANESDDKLLKDVYHATKNNVEKFKTFGXXXXXXXXXXXXXXHGEX 182
           +++K+ +     ++ A      LL+ + + T  ++E+FKT G                + 
Sbjct: 123 IVDKLNLPG--VDKIA------LLRQLLNET-TSLEEFKTLGRDKLPEVTSPLSK---DQ 170

Query: 183 XXXXXXXXXXXXXLLTEKDNITNNQIEGLKKKVEELDKYLDWISSVNKLINGEDNTIEQE 242
                        L+ E D + + ++  L ++   ++KY++WI  VN+ ++   N     
Sbjct: 171 YSKLLENDQHLNKLINEHDELVSVKLSKLNEEDAVIEKYVNWIGEVNERLSPHFNQPTGR 230

Query: 243 ENVNDTIXXXXXXXXXXXXXXXXAICGYSLNLAKIPCNPEEFYNKYSEITT-STPDCNEI 301
           +                       ICGY  N   IP + EEF +K  ++      +   +
Sbjct: 231 KKSKSA--------------SKVTICGYH-NEFTIPRSVEEFLDKLLQLKEDENSNITSV 275

Query: 302 EGICIKLRCNKHSDWSTMTSDQYTRQIISLETHLKRLDLSISTRKRQLNINYFE 355
           +G+C+K +C KH DW T++ +  + Q  SLE   +RLDL IS R  QL I++FE
Sbjct: 276 DGVCVKTKCAKHQDWITLSQNDLSEQKDSLENVKRRLDLLISVRTNQLRISFFE 329

>Kwal_26.8697
          Length = 332

 Score =  231 bits (590), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 122/351 (34%), Positives = 188/351 (53%), Gaps = 32/351 (9%)

Query: 5   LPEWCPPYSTTKIDTNTGEDVYCICKKPDYGELMVGCDGCDDWFHFECMKIPETYRNLVE 64
           LPEWCP Y++ K D  +GE+V+CICKKPD GELMVGCDGCDDWFHF C+++P+ +  LV 
Sbjct: 4   LPEWCPAYNSLKKDPLSGEEVFCICKKPDSGELMVGCDGCDDWFHFSCLRVPQKFNELVF 63

Query: 65  SFICPYCRVGITGPGSKGDGECPKSLWKKKCRLQDCYEPCESGSKYCSKEHGKEYMSRLL 124
           SF CPYC+ G+TGPGS+     PK+LW++KCR+ +CY+PC   SKYCS+EH  EYM  LL
Sbjct: 64  SFYCPYCQCGVTGPGSRSRN-LPKTLWRRKCRVLECYKPCSENSKYCSEEHALEYMRSLL 122

Query: 125 NKVKIKNDLNNRYANESDDKLLKDVYHATKNNVEKFKTFGXXXXXXXXXXXXXXHGEXXX 184
           ++V+ +        +     +L+ +   T  ++  F+  G                +   
Sbjct: 123 DRVESR--------SYDAPTVLRQMLQNT--DLASFQKMGQNDVPTPSE-------DLAP 165

Query: 185 XXXXXXXXXXXLLTEKDNITNNQIEGLKKKVEELDKYLDWISSVNKLINGEDNTIEQEEN 244
                      L ++ +++       ++ + ++L  Y+ W  SVN  + G  N+      
Sbjct: 166 GLLDDDKRIRELSSQINDVHKQAKPEVEAQFQKLANYVAWNKSVNAQLFGSQNS------ 219

Query: 245 VNDTIXXXXXXXXXXXXXXXXAICGYSLNLAKIPCNPEEFYNKYSEITTSTPDCNEIEGI 304
                                AICGY  N  +I C+PEEF ++Y+E      D  E+  +
Sbjct: 220 -ELASKASRAQKRKKKSVKPKAICGYHANF-EITCSPEEFVSQYNE------DIPELHSV 271

Query: 305 CIKLRCNKHSDWSTMTSDQYTRQIISLETHLKRLDLSISTRKRQLNINYFE 355
           C KLRC +H DW+ +  +    Q+ +LE+ L+RL L +  R+ QL + +++
Sbjct: 272 CCKLRCARHLDWAGIQENALQFQLETLESSLERLTLLLKIRQDQLKVQFYK 322

>ACR115W [1162] [Homologous to ScYPL138C (SPP1) - SH]
           complement(554695..555741) [1047 bp, 348 aa]
          Length = 348

 Score =  204 bits (520), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 111/351 (31%), Positives = 163/351 (46%), Gaps = 40/351 (11%)

Query: 5   LPEWCPPYSTTKIDTNTGEDVYCICKKPDYGELMVGCDGCDDWFHFECMKIPETYRNLVE 64
           LP+WCPP+  TK D +TGEDVYCICKKPD GELMV CDGC DWFHF C++IP  Y++LV 
Sbjct: 24  LPDWCPPFQGTKQDPSTGEDVYCICKKPDGGELMVQCDGCGDWFHFTCIRIPSAYKSLVF 83

Query: 65  SFICPYCRVGITGPGSKGDGECPKSLWKKKCRLQDCYEPCESGSKYCSKEHGKEYMSRLL 124
           SF CPYC+ GIT     G G  P+++WK++CR++ CY  C   SKYC  EHG+ YM  L+
Sbjct: 84  SFYCPYCQAGIT---YSGTGALPRTVWKRRCRMEGCYRACARDSKYCGPEHGEAYMRALV 140

Query: 125 NKVKIKNDLNNRYANESDDKLLKDVYHATKNNVEKFKTFGXXXXXXXXXXXXXXHGEXXX 184
            +           A      +++ +         +F++ G                    
Sbjct: 141 ER-----------AGPGGQAVVQQMV-----RTGQFESLGTGALPLARRDVDPA---LYD 181

Query: 185 XXXXXXXXXXXLLTEKDNITNNQIEGLKKKVEELDKYLDWISSVNKLINGEDNTIEQEEN 244
                      L  E   +   +   L  ++  L  YL W+  VN      D      E 
Sbjct: 182 RVVGADARLGELEAEAREVREARRSALCAQLAALSAYLAWVREVN------DALFHDTEE 235

Query: 245 VNDTIXXXXXXXXXXXXXXXXAICGYSLNLAKIPCNPEEFYNKYSEITTSTPDCNEIEGI 304
                                A+CG+  +  + P    +F   Y++      D   + G+
Sbjct: 236 AAPRR-----GKARARRKPKRALCGFRADY-QAPLPAADFAASYAD------DAALLHGV 283

Query: 305 CIKLRCNKHSDWSTMTSDQYTRQIISLETHLKRLDLSISTRKRQLNINYFE 355
           C +LRC +H DW++M       ++ +L++  +RL L IS RK  L++ + E
Sbjct: 284 CCRLRCPRHQDWASMRLGSVQFELEALDSAEQRLQLLISMRKEHLSLRFHE 334

>Scas_666.2*
          Length = 318

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%), Gaps = 4/37 (10%)

Query: 22  GEDVYCICKKPDYGELMVGCDGCD---DWFHFECMKI 55
           GE +YC C +  YGE MVGCDG D   +WFH +C+ +
Sbjct: 263 GEPLYCYCNQVAYGE-MVGCDGADCELEWFHLQCIGL 298

>KLLA0A06974g complement(630572..631459) similar to sp|P38806
           Saccharomyces cerevisiae YHR090c YNG2 component of NuA4
           histone acetyltransferase complex, start by similarity
          Length = 295

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 7/55 (12%)

Query: 25  VYCICKKPDYGELMVGCDGCD---DWFHFECMKIPETYRNLVESFICPYCRVGIT 76
           +YC C++  YGE MV CDG +   +WFH+ C+ + E  +     + CP CR+ I 
Sbjct: 234 LYCFCQRVSYGE-MVACDGPNCKYEWFHYSCVNLTEPPKG---QWYCPECRLEIA 284

>CAGL0H02035g 182137..182961 similar to sp|P38806 Saccharomyces
           cerevisiae YHR090c YNG2, start by similarity
          Length = 274

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 40/68 (58%), Gaps = 7/68 (10%)

Query: 12  YSTTKIDTNTGEDVYCICKKPDYGELMVGCDGCD---DWFHFECMKIPETYRNLVESFIC 68
           +S+   +    +++YC C++  +GE MV CDG +   +WFH+EC+ + E  +    ++ C
Sbjct: 203 FSSMNDNEKEDQNLYCFCQRVSFGE-MVACDGPNCKYEWFHYECVNLTEPPKG---TWYC 258

Query: 69  PYCRVGIT 76
           P C+  ++
Sbjct: 259 PDCKQEMS 266

>YNL097C (PHO23) [4494] chr14 complement(441366..442358) Protein
           involved in chromatin remodeling and possibly
           transcription regulation, involved in expression of PHO5
           [993 bp, 330 aa]
          Length = 330

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 24/37 (64%), Gaps = 4/37 (10%)

Query: 22  GEDVYCICKKPDYGELMVGCDGCD---DWFHFECMKI 55
           GE +YC C +  YGE MVGCDG D   +WFH  C+ +
Sbjct: 278 GEPLYCYCNQVAYGE-MVGCDGADCELEWFHLPCIGL 313

>Kwal_56.24206
          Length = 1502

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 6/58 (10%)

Query: 18   DTNTGEDVYCICKKPDYGELMVGCDGCDDWFHFECMKIPE----TYRNLVESFICPYC 71
            D N  +  YC C+  D G  MV C+ C +W+H  C+   +    +  N V  F+CP C
Sbjct: 1264 DPNKSDGHYCFCRGGDSGSRMVACEVCGEWYHMNCINKGKWALASSENTV--FVCPIC 1319

>Scas_541.4
          Length = 282

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 7/51 (13%)

Query: 25  VYCICKKPDYGELMVGCDGCD---DWFHFECMKIPETYRNLVESFICPYCR 72
           +YC C+   YGE MV CDG +   +WFH+ C+ + E  + L   + CP CR
Sbjct: 223 LYCFCQSVSYGE-MVACDGPNCKYEWFHYGCVNLKEPPKGL---WYCPDCR 269

>Sklu_2376.2 YHR090C, Contig c2376 1317-2132 reverse complement
          Length = 271

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 35/64 (54%), Gaps = 11/64 (17%)

Query: 20  NTGED----VYCICKKPDYGELMVGCDGCD---DWFHFECMKIPETYRNLVESFICPYCR 72
           N GE+    +YC C+   YGE MV CDG +   +WFH+ C+ + E  +    ++ CP CR
Sbjct: 201 NQGEEDDKQLYCFCQSVSYGE-MVACDGENCKYEWFHYTCVNLKEPPKG---AWYCPECR 256

Query: 73  VGIT 76
             I 
Sbjct: 257 QEIA 260

>YHR090C (YNG2) [2380] chr8 complement(283778..284626) Component of
           NuA4 histone acetyltransferase complex, involved in
           transcriptional regulation and chromatin remodeling [849
           bp, 282 aa]
          Length = 282

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 33/52 (63%), Gaps = 7/52 (13%)

Query: 25  VYCICKKPDYGELMVGCDGCD---DWFHFECMKIPETYRNLVESFICPYCRV 73
           +YC C++  +GE MV CDG +   +WFH++C+ + E  +    ++ CP C++
Sbjct: 223 LYCFCQRVSFGE-MVACDGPNCKYEWFHYDCVNLKEPPKG---TWYCPECKI 270

>AFL127C [3068] [Homologous to ScYMR176W (ECM5) - SH] (193474..198039)
            [4566 bp, 1521 aa]
          Length = 1521

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 5/51 (9%)

Query: 23   EDVYCICKKPDYGELMVGCDGCDDWFHFECMK-----IPETYRNLVESFIC 68
            + VYC C++ D G  MV C+ C +W+H  C+      +PE  R +    IC
Sbjct: 1294 QSVYCFCRQGDVGSTMVECEICREWYHVACINRGRWALPEDDRCVFLCMIC 1344

>AEL100W [2406] [Homologous to ScYHR090C (YNG2) - SH]
           complement(438074..438931) [858 bp, 285 aa]
          Length = 285

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 7/51 (13%)

Query: 25  VYCICKKPDYGELMVGCDGCD---DWFHFECMKIPETYRNLVESFICPYCR 72
           +YC C+   YGE MV CDG +   +WFH+ C+ + E  +     + CP CR
Sbjct: 225 LYCFCQSVSYGE-MVACDGPNCKYEWFHYGCVNLDEPPKG---QWYCPECR 271

>CAGL0G06556g 628181..629131 similar to sp|P50947 Saccharomyces
           cerevisiae YNL097c PHO23, start by similarity
          Length = 316

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 23/35 (65%), Gaps = 4/35 (11%)

Query: 22  GEDVYCICKKPDYGELMVGCDGCD---DWFHFECM 53
           GE +YC C +  YGE MVGCDG D   +WFH  C+
Sbjct: 262 GEPLYCYCNQVAYGE-MVGCDGEDCELEWFHLPCI 295

>Sklu_2428.11 YOR064C, Contig c2428 18153-18770
          Length = 205

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 4/64 (6%)

Query: 12  YSTTKIDTNTGEDVYCICKKPDYGELMVGCD--GCD-DWFHFECMKIPETYRNLVESFIC 68
           +S  +     G++++C C+   YG  MV CD  GC  +WFH+ C+ + +  RN  + +  
Sbjct: 131 FSKQETRREQGQELFCFCRDISYGP-MVACDNPGCPIEWFHYACVGLLKAPRNNAKWYCS 189

Query: 69  PYCR 72
             CR
Sbjct: 190 TKCR 193

>ADL263W [1478] [Homologous to ScYNL097C (PHO23) - SH]
           complement(242858..243739) [882 bp, 293 aa]
          Length = 293

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 26/47 (55%), Gaps = 4/47 (8%)

Query: 12  YSTTKIDTNTGEDVYCICKKPDYGELMVGCDG--CD-DWFHFECMKI 55
           YS        GE +YC C +  YGE MVGCDG  C  +WFH  C+ +
Sbjct: 233 YSARPKTNEYGEALYCYCNQVAYGE-MVGCDGENCQLEWFHLPCINL 278

>KLLA0C13409g complement(1143660..1144835) some similarities with
           sp|P50947 Saccharomyces cerevisiae YNL097c PHO23
           involved in transcriptional regulation of PHO5,
           hypothetical start
          Length = 391

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 24/37 (64%), Gaps = 4/37 (10%)

Query: 22  GEDVYCICKKPDYGELMVGCDGCD---DWFHFECMKI 55
           GE +YC C +  YGE MVGCDG +   +WFH  C+ +
Sbjct: 339 GEALYCYCNQVAYGE-MVGCDGENCQLEWFHLPCIGL 374

>Kwal_26.8384
          Length = 318

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 24/37 (64%), Gaps = 4/37 (10%)

Query: 22  GEDVYCICKKPDYGELMVGCDGCD---DWFHFECMKI 55
           GE +YC C +  YGE MVGCDG +   +WFH  C+ +
Sbjct: 266 GEALYCYCNQVAYGE-MVGCDGDNCILEWFHLPCIGL 301

>KLLA0C16203g complement(1414169..1418533) weakly similar to sp|Q03214
            Saccharomyces cerevisiae YMR176w ECM5 involved in cell
            wall biogenesis and architecture singleton, start by
            similarity
          Length = 1454

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 6/48 (12%)

Query: 8    WCPP--YSTTKIDTNTGEDVYCICKKPDYGELMVGCDGCDDWFHFECM 53
            W P   YS+T+ + N     YC C++ D G +MV C+ C +W+H  C+
Sbjct: 1262 WDPTDLYSSTEENNNK----YCFCRRGDNGNVMVQCEICSEWYHTSCI 1305

>Kwal_55.21724
          Length = 193

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 4/58 (6%)

Query: 19  TNTGEDVYCICKKPDYGELMVGCDGCD---DWFHFECMKIPETYRNLVESFICPYCRV 73
           ++  E VYCIC++  YG  M+ CD      +WFH+ C+ + +  +   + +    CR+
Sbjct: 114 SHPAEPVYCICREVSYGA-MIACDNSKCPIEWFHYGCIGLTQAPQGTQKWYCSERCRL 170

>YMR176W (ECM5) [4131] chr13 (611739..615974) Protein involved in cell
            wall structure or biosynthesis [4236 bp, 1411 aa]
          Length = 1411

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 6/50 (12%)

Query: 26   YCICKKPDYGELMVGCDGCDDWFHFECMK----IPETYRNLVESFICPYC 71
            YC C++ + G  MV C+ C +W+H +C+     +P    N++  F+C  C
Sbjct: 1240 YCFCRRVEEGTAMVECEICKEWYHVDCISNGELVPPDDPNVL--FVCSIC 1287

>YOR064C (YNG1) [4872] chr15 complement(446080..446739) Component of
           NuA3 histone acetyltransferase complex, required for
           interaction of NuA3 complex with chromatin, has
           similarity to human retinoblastoma binding protein 2
           [660 bp, 219 aa]
          Length = 219

 Score = 36.2 bits (82), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 4/42 (9%)

Query: 20  NTGEDVYCICKKPDYGELMVGCD--GCD-DWFHFECMKIPET 58
           N  E+VYC C+   YG  MV CD   C  +WFH+ C+ + + 
Sbjct: 151 NNQEEVYCFCRNVSYGP-MVACDNPACPFEWFHYGCVGLKQA 191

>Scas_549.5
          Length = 201

 Score = 35.0 bits (79), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 26  YCICKKPDYGELMVGCDGCD---DWFHFECM 53
           YC C +  YGE M+ CD  +   +WFH++C+
Sbjct: 128 YCFCNRESYGE-MIACDNPNCPYEWFHYDCI 157

>Scas_720.39
          Length = 1455

 Score = 35.4 bits (80), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 9/54 (16%)

Query: 23   EDVYCICKKPDYGELMVGCDGCDDWFHFECM-----KIPETYRNLVESFICPYC 71
            + VYC C+  D G  M+ C+ C +W+H  C+      +P+    +   FIC  C
Sbjct: 1259 QRVYCFCRGGDIGT-MIQCELCQEWYHTACINGGKWNVPDDPETI---FICSLC 1308

>CAGL0L10384g complement(1109390..1110055) similar to tr|Q08465
           Saccharomyces cerevisiae YOR064c, start by similarity
          Length = 221

 Score = 34.7 bits (78), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 34/86 (39%), Gaps = 34/86 (39%)

Query: 18  DTNTGEDVYCICKKPDYGELMVGCDG--CD-DWFHFECMKIPETYRNLVESFICPYCRVG 74
           D N  E+ YC C    YG  M+ CD   C+ +WFH+ C                    +G
Sbjct: 161 DANGDEERYCFCNDVSYG-AMIACDNSKCEREWFHYPC--------------------IG 199

Query: 75  ITGPGSKGDGECPKSLW--KKKCRLQ 98
           +T P        P   W   +KCRLQ
Sbjct: 200 MTKP--------PSGKWYCSEKCRLQ 217

>CAGL0L03091g complement(354241..356589) similar to sp|P36124
           Saccharomyces cerevisiae YKR029c, hypothetical start
          Length = 782

 Score = 34.7 bits (78), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 29/66 (43%), Gaps = 2/66 (3%)

Query: 6   PEWCPPYSTTKIDTNTGEDVYCICKKPDYGELMVGCDGCDDWFHFECMKIPETYRNLVES 65
           P+  P   +  +D + G  + C+C   D     + CD C+ W H  C  I +   N  + 
Sbjct: 119 PDQWPVSESYIVDIDAGI-ITCVCDFDDDDGFTIQCDHCNRWQHASCFGI-DNIENAPDD 176

Query: 66  FICPYC 71
           F+C  C
Sbjct: 177 FLCDKC 182

>Kwal_27.11107
          Length = 388

 Score = 33.1 bits (74), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 33/72 (45%), Gaps = 4/72 (5%)

Query: 24  DVYCICKK---PDYGELMVGCDGCDDWFHFECMKIPETYRNLVESFICPYCRVGITGPGS 80
           D  CIC +   PD   L + C+ C  W H  C+ I E   +  + + C  CR  +     
Sbjct: 34  DTRCICSETDPPDDSGLYIQCEQCSVWQHGFCVGITEGEDSAPDKYWCEQCRPDLHTLYK 93

Query: 81  KGDGECPKSLWK 92
              GE P+S++K
Sbjct: 94  TELGE-PRSVYK 104

>KLLA0F25828g complement(2401463..2403334) similar to sp|Q04779
           Saccharomyces cerevisiae YMR075w singleton, start by
           similarity
          Length = 623

 Score = 33.1 bits (74), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 1/51 (1%)

Query: 20  NTGEDVYCICKKPDYGELMVGCDGCDDWFHFECMKIPE-TYRNLVESFICP 69
           N GE        PD   L++ CD C   +H +C+ +P  + +NL   + CP
Sbjct: 408 NCGESKMGTWDHPDSQRLIMTCDYCSTPWHLDCLPLPRASLKNLGSKWKCP 458

>Scas_717.12
          Length = 742

 Score = 33.1 bits (74), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 40/91 (43%), Gaps = 27/91 (29%)

Query: 11  PY--STTKIDT--------NTGEDVYCICKK-----------PDYGELMVGCDGCDDWFH 49
           PY  S TK+DT        ++  D Y IC K           P+ G L++ CD C+  +H
Sbjct: 459 PYGQSVTKLDTYNPDIHIDSSNPDKYLICYKCRTTKMGTWDHPEKGRLIMRCDYCNTPWH 518

Query: 50  FECMKIPETYR----NLVESFICPYCRVGIT 76
            +C  IPE  R    N+   + CP   V  T
Sbjct: 519 LDC--IPEVPRASLKNIGLKWKCPLHAVQTT 547

>YKL005C (BYE1) [3252] chr11 complement(432736..434520) Protein with
           similarity to Drosophila transcription factor TFIIS,
           contains a PHD finger [1785 bp, 594 aa]
          Length = 594

 Score = 33.1 bits (74), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 11/16 (68%), Positives = 12/16 (75%)

Query: 38  MVGCDGCDDWFHFECM 53
           MV CDGCD W H +CM
Sbjct: 94  MVQCDGCDTWQHIKCM 109

>CAGL0M10285g complement(1029427..1031250) similar to sp|P36106
          Saccharomyces cerevisiae YKL005c, hypothetical start
          Length = 607

 Score = 33.1 bits (74), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 28/59 (47%), Gaps = 15/59 (25%)

Query: 9  CPPYSTTKIDTNTGEDVYCICKKPDYGELMVGCDGCDDWFHFECM------KIPETYRN 61
          C P  TT  D N  ED     + P YGE M+ CD CD W H  CM      K+P+   N
Sbjct: 47 CSPCGTT--DANYVED-----EDP-YGE-MIQCDQCDTWQHINCMLQVKDIKVPKELEN 96

>KLLA0F16533g complement(1525315..1525986) weakly similar to
           sgd|S0005590 Saccharomyces cerevisiae YOR064c YNG1
           component of histone acetyltransferase complex, has,
           start by similarity
          Length = 223

 Score = 31.6 bits (70), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 4/35 (11%)

Query: 24  DVYCICKKPDYGELMVGCDG---CDDWFHFECMKI 55
           + YC C+   YG  MV CD      +WFH+ C+ +
Sbjct: 158 ETYCFCRDVSYGP-MVACDNESCAIEWFHYPCVGL 191

>Scas_629.23
          Length = 602

 Score = 32.0 bits (71), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 11/16 (68%), Positives = 11/16 (68%)

Query: 38  MVGCDGCDDWFHFECM 53
           MV CDGCD W H  CM
Sbjct: 85  MVQCDGCDMWQHIRCM 100

>YMR075W (YMR075W) [4034] chr13 (413981..416035) Protein containing
           a PHD-finger, which may be involved in
           chromatin-mediated transcriptional regulation, has a
           region of weak similarity to a region of PHD zinc finger
           transcription factor (human PF1), which acts as a
           transcriptional corepressor [2055 bp, 684 aa]
          Length = 684

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 49/110 (44%), Gaps = 23/110 (20%)

Query: 15  TKIDTNTGEDVYCICKK-----------PDYGELMVGCDGCDDWFHFECMKIPE-TYRNL 62
           T ID+N+G+  + IC K           P+   L++ CD C   +H +C  +P  +++NL
Sbjct: 405 THIDSNSGK--FLICYKCNQTRLGSWSHPENSRLIMTCDYCQTPWHLDC--VPRASFKNL 460

Query: 63  VESFICPY---CRVGITGPGSKGDGECPKSLWKKKCRL----QDCYEPCE 105
              + CP     +V       + D      +WKK+  +    Q  YEP +
Sbjct: 461 GSKWKCPLHSPTKVYKKIHHCQEDNSVNYKVWKKQRLINKKNQLYYEPLQ 510

>YPL181W (CTI6) [5266] chr16 (203420..204940) Protein that
           physically links the SAGA complex to the Ssn6p-Tup1p
           repressor complex, acts in concert with the SAGA complex
           to relieve Ssn6p-Tup1p mediated transcriptional
           repression [1521 bp, 506 aa]
          Length = 506

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 6/69 (8%)

Query: 27  CICKK---PDYGELMVGCDGCDDWFHFECMKIPETYRNLVESFICPYCRVGITGPGSKGD 83
           CIC +   PD     + C+ C  W H  C+ I  T  N  + + C  CR  +    +   
Sbjct: 75  CICGELDTPDDSGFFIQCEQCSSWQHGYCVSI--TQDNAPDKYWCEQCRPELHQLFTTDT 132

Query: 84  GECPKSLWK 92
           GE  +S++K
Sbjct: 133 GEA-RSIYK 140

>YJR119C (YJR119C) [3011] chr10 complement(644219..646405) Protein
           containing a PHD-finger and jumonji (jmjN) and jumonji
           (jmjC) domains, has low similarity to a region of
           selected mouse cDNA on the Y homolog (human SMCY), which
           is a male-specific protein that elicits transplant
           rejection in female recipients [2187 bp, 728 aa]
          Length = 728

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 8/64 (12%)

Query: 18  DTNTG-------EDVYCICKKPDYGELMVGCDGCDDWFHFECMKIPETYRNLVESFICPY 70
           D+N+G       +D   +C+K +  +  + CD CD  FH  C+  P   R     +IC  
Sbjct: 223 DSNSGSDFEEDDDDACIVCRKTNDPKRTILCDSCDKPFHIYCLS-PPLERVPSGDWICNT 281

Query: 71  CRVG 74
           C VG
Sbjct: 282 CIVG 285

>YKR029C (SET3) [3284] chr11 complement(497220..499475) Component of
           the Set3p complex with histone deacetylase activity that
           represses meiotic-specific sporulation gene expression,
           has similarity to E(z) Enhancer of zeste in the
           C-terminal domain, contains a PHD finger and a SET
           domain [2256 bp, 751 aa]
          Length = 751

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 2/50 (4%)

Query: 6   PEWCPPYSTTKIDTNTGEDVYCICKKPDYGELMVGCDGCDDWFHFECMKI 55
           P+W  P S   +D + G  + CIC   D     + CD C+ W H  C  I
Sbjct: 101 PQWPVPDSYI-VDPDAGI-ITCICDLNDDDGFTIQCDHCNRWQHAICYGI 148

>Kwal_26.8059
          Length = 631

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 30/70 (42%), Gaps = 4/70 (5%)

Query: 10  PPYSTTKIDTNTGEDVYCICKKPDYGELMVGCDGCDDWFHFECMKIPETYRNLVES-FIC 68
           PP  ++   T   +D    C++P    + + CD C   FHF C   P    NL E  + C
Sbjct: 225 PPIVSSTEATVENDDFCSSCRQPG---IFLCCDTCPRSFHFACCNPPLDPDNLPEGDWSC 281

Query: 69  PYCRVGITGP 78
             C+  I  P
Sbjct: 282 AECQFKIRCP 291

>AGL075C [4236] [Homologous to ScYMR075W - SH] (568737..570521)
           [1785 bp, 594 aa]
          Length = 594

 Score = 30.4 bits (67), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 1/39 (2%)

Query: 32  PDYGELMVGCDGCDDWFHFECMKIPETYR-NLVESFICP 69
           P+   L++ CD C+  +H +C+ +P   R NL   + CP
Sbjct: 383 PETERLIMKCDYCNTPWHLDCLPVPRASRKNLGSKWKCP 421

>KLLA0F02882g 269162..271552 weakly similar to sp|P36124
           Saccharomyces cerevisiae YKR029c, start by similarity
          Length = 796

 Score = 30.0 bits (66), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 2/55 (3%)

Query: 17  IDTNTGEDVYCICKKPDYGELMVGCDGCDDWFHFECMKIPETYRNLVESFICPYC 71
           +D + G  + CIC   D     + CD C  W H  C  I E  ++  + F+C  C
Sbjct: 219 VDPDAGI-ITCICGYEDDDGFTIQCDHCFRWQHAICYGI-EHEKDAPDDFLCNIC 271

>Kwal_47.18155
          Length = 465

 Score = 29.6 bits (65), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 1/41 (2%)

Query: 25 VYCICKKPDYGELMVGCDGCDDWFHFECMKIPETYRNLVES 65
           YC    PD   L V C+ CD W H  C+ I +    + E+
Sbjct: 7  AYCSSSDPD-KLLWVQCEVCDSWVHVTCVPIKDIVNEMGEA 46

>YDR228C (PCF11) [1064] chr4 complement(921918..923798) Component of
           pre-mRNA cleavage and polyadenylation factor I,
           interacts with Rna14p and Rna15p [1881 bp, 626 aa]
          Length = 626

 Score = 29.3 bits (64), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 12/79 (15%)

Query: 55  IPETYRNLVESFICPYCRVGITGPGSKGDGECPKSLWKKKCRL------QDCY-EPCESG 107
           +PET +++  +F CP C+  +TG   +  GE    +WK    +        CY E  ++ 
Sbjct: 553 VPETSQDM--AFKCPICKETVTGVYDEESGEW---VWKNTIEVNGKYFHSTCYHETSQNS 607

Query: 108 SKYCSKEHGKEYMSRLLNK 126
           SK  S + G + + +L+ K
Sbjct: 608 SKSNSGKVGLDDLKKLVTK 626

>CAGL0J01529g complement(143666..145681) similar to sp|Q04779
           Saccharomyces cerevisiae YMR075w, hypothetical start
          Length = 671

 Score = 28.9 bits (63), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 29/66 (43%), Gaps = 15/66 (22%)

Query: 17  IDTNTGEDVYCI---------CKKPDYGELMVGCDGCDDWFHFECMKIPETYR----NLV 63
           ID  TG+ + C             P+   L++ CD C+  +H +C  +PE  R    NL 
Sbjct: 420 IDQTTGKILTCYRCGVSRLGSWSHPEEARLLIKCDYCNTRWHLDC--VPEVPRASLKNLG 477

Query: 64  ESFICP 69
             + CP
Sbjct: 478 SKWQCP 483

>YER051W (YER051W) [1479] chr5 (254655..256133) Protein containing
          a PHD-finger, which may be involved in
          chromatin-mediated transcriptional regulation, and a
          Jumonji (jmjC) domain, has low similarity to
          uncharacterized C. albicans Orf6.8281p [1479 bp, 492
          aa]
          Length = 492

 Score = 28.5 bits (62), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 20/46 (43%), Gaps = 1/46 (2%)

Query: 26 YCICKKPDYGELMVGCDGCDDWFHFECMKIPET-YRNLVESFICPY 70
          +C  K      + V CD C  W H +C+ +    Y NL  S +  Y
Sbjct: 9  HCQLKDNPGALIWVKCDSCPQWVHVKCVPLKRIHYSNLTSSEVLSY 54

>KLLA0E18898g 1670923..1672263 weakly similar to sgd|S0006102
          Saccharomyces cerevisiae YPL181w, start by similarity
          Length = 446

 Score = 28.5 bits (62), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 3/37 (8%)

Query: 24 DVYCICKK---PDYGELMVGCDGCDDWFHFECMKIPE 57
          +  CIC K   PD   L + C+ C  W H  C+ I E
Sbjct: 31 ETRCICGKIEPPDDSGLYIQCEQCHVWQHGYCVGISE 67

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.135    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,948,860
Number of extensions: 511782
Number of successful extensions: 1730
Number of sequences better than 10.0: 70
Number of HSP's gapped: 1717
Number of HSP's successfully gapped: 76
Length of query: 355
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 252
Effective length of database: 13,030,455
Effective search space: 3283674660
Effective search space used: 3283674660
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)