Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L11880g98096546340.0
AGR117C79996116430.0
Kwal_56.2345382873314780.0
YER169W (RPH1)79637413751e-177
Scas_681.1986438513351e-170
KLLA0C17710g82136812881e-163
Scas_76.12282266478e-78
YDR096W (GIS1)8943646687e-74
ABR167C7762953126e-29
Kwal_55.218555212933068e-29
KLLA0D10758g8501553037e-28
Sklu_2303.67951872983e-27
CAGL0H00528g7401892902e-26
Scas_691.277352652715e-24
YJR119C7281802662e-23
CAGL0G08107g625792188e-18
Scas_709.328221131733e-12
Scas_602.9547571642e-11
CAGL0E04884g1489531618e-11
CAGL0L06072g300561541e-10
Scas_707.312891071541e-10
Sklu_2181.1410541561e-10
AGR031W140501451e-10
Sklu_2443.22213981501e-10
Kwal_47.17241403541542e-10
ACL057W520541553e-10
Scas_649.287301481563e-10
KLLA0C17072g474541526e-10
AGR172W1057531536e-10
Sklu_2357.7157501418e-10
YKL062W (MSN4)630981518e-10
YJR127C (ZMS1)1380731529e-10
Kwal_26.8351698651519e-10
CAGL0K02145g317571471e-09
CAGL0M13189g541581491e-09
KLLA0F13046g1379861502e-09
Sklu_2351.6548551482e-09
Scas_703.231341711502e-09
ABR089C571561473e-09
Scas_721.921152571465e-09
AER159C1191791448e-09
Kwal_47.166211178731448e-09
YDR043C (NRG1)231501379e-09
YDR216W (ADR1)13231381439e-09
Kwal_56.2420615022171431e-08
KLLA0B04477g1332671431e-08
YER130C443571401e-08
YML081W1251641421e-08
KLLA0F26961g694511411e-08
CAGL0M00594g1020641412e-08
Kwal_27.10925264501352e-08
CAGL0K12078g4631011383e-08
YMR037C (MSN2)704511383e-08
AFL127C15212031393e-08
CAGL0H04213g1321731384e-08
CAGL0F05995g597541365e-08
KLLA0F18524g357501345e-08
KLLA0E10989g474551347e-08
CAGL0A01628g424551348e-08
Scas_718.44266501301e-07
AFR471C389551321e-07
YGL035C (MIG1)504561312e-07
Kwal_14.2278463551293e-07
CAGL0L07480g314501273e-07
Scas_575.3455551284e-07
YOR113W (AZF1)914511294e-07
Scas_569.2293501247e-07
ACR264W769581277e-07
YMR176W (ECM5)14112141278e-07
Kwal_47.17888786501251e-06
Scas_717.17525531241e-06
KLLA0B07909g922531242e-06
AFR580C838531242e-06
YPL038W (MET31)177551172e-06
CAGL0K09372g396501222e-06
Scas_712.42*290511212e-06
YBR066C (NRG2)220501182e-06
Scas_378.1208571172e-06
Scas_697.35839511204e-06
Scas_719.681350671206e-06
KLLA0F23782g782501196e-06
YGR067C794511189e-06
Scas_683.25879511189e-06
CAGL0K04631g1013511171e-05
YGL209W (MIG2)382511151e-05
YPL230W391751151e-05
Scas_693.31635601161e-05
Kwal_47.19045266671122e-05
KLLA0B00605g239511112e-05
Kwal_26.8021507521106e-05
AGL207W277501086e-05
CAGL0L03916g642501106e-05
ADL198W5471191107e-05
YMR070W (MOT3)490581097e-05
AGL071C396531088e-05
KLLA0B03454g472541071e-04
YDR146C (SWI5)709601071e-04
CAGL0M06831g645481062e-04
CAGL0C02519g318501042e-04
YDR253C (MET32)191501013e-04
AGL197W844531063e-04
Scas_636.14d275551033e-04
Scas_687.33288511033e-04
Kwal_27.11460531551043e-04
Scas_720.33316531033e-04
Kwal_56.23925745581035e-04
CAGL0E01331g689601035e-04
Scas_627.17d275551005e-04
YER028C394511025e-04
Scas_568.519954986e-04
KLLA0E18645g431571018e-04
AEL174W661491019e-04
KLLA0D16456g854471000.001
KLLA0E08679g596421000.001
CAGL0K03003g647751000.001
KLLA0F11682g37458990.001
YJL056C (ZAP1)880411000.001
CAGL0J05060g713411000.001
Scas_717.60d16788940.001
Scas_711.5683241990.002
KLLA0C16203g1454199990.002
CAGL0E06116g61343980.002
CAGL0M01870g31550970.002
Scas_720.391455104970.003
KLLA0C16005g33154950.003
YLR131C (ACE2)77060960.003
Kwal_23.540042982960.003
Sklu_1527.120577930.003
YMR182C (RGM1)21169920.004
Kwal_27.1182419991910.005
CAGL0B02651g18981910.005
Sklu_2389.276744940.006
CAGL0I02838g65586930.007
Scas_695.257163930.007
Scas_713.11465145920.009
KLLA0F20636g28554900.009
Kwal_14.220625448900.010
KLLA0A04609g42351910.010
CAGL0M04323g70355910.012
AGL246W22754880.014
AEL278W47650900.015
KLLA0F01463g78149900.016
CAGL0G10021g39453890.018
YNL027W (CRZ1)67858900.018
Scas_718.67473193890.019
Kwal_27.1046730282880.022
Scas_631.743350880.023
Scas_721.5619949860.024
CAGL0L12562g22348860.027
Kwal_14.254371151880.031
AFL136W40943870.033
YPR186C (PZF1)42953860.038
Scas_627.6120798870.040
Kwal_47.1657788150860.046
Kwal_47.1833753696860.047
CAGL0E04312g68871830.10
CAGL0L00583g38839810.15
CAGL0E03762g58449810.17
Scas_718.36d33050800.21
Sklu_2436.951799800.24
Sklu_2126.544844800.24
KLLA0D11902g28954790.25
CAGL0K01727g499132790.27
YDL020C (RPN4)53172790.28
Sklu_2289.129161770.37
Scas_604.458535780.37
Sklu_2244.327150770.39
CAGL0H07557g47652780.44
KLLA0F10109g623101780.45
KLLA0E00726g51749780.46
Scas_641.2453284770.48
Scas_660.1236769770.51
CAGL0C03355g30999760.56
YGL254W (FZF1)29954760.62
CAGL0I02816g29155750.67
YDR463W (STP1)51977750.87
AFR461C54464750.90
YHR006W (STP2)54186750.90
CAGL0K02343g116285750.98
YPR022C113351751.0
KLLA0A10373g20655721.1
YHL027W (RIM101)62545741.3
Kwal_33.14227551148731.8
Kwal_27.11573956111722.1
AFR190C43244722.2
KLLA0C00286g51244712.4
ADL042W28152702.6
ADL040W33050712.6
Kwal_55.2063441982703.4
Scas_670.2435102703.8
Kwal_26.930030424693.9
Sklu_2359.572257704.2
Scas_712.232752685.0
YLR375W34347685.0
Scas_591.868044695.3
CAGL0K06413g35974669.2
Scas_683.3047873669.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L11880g
         (965 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L11880g 1272624..1275566 some similarities with sp|P39956 S...  1789   0.0  
AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W (...   637   0.0  
Kwal_56.23453                                                         573   0.0  
YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsiv...   534   e-177
Scas_681.19                                                           518   e-170
KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces...   500   e-163
Scas_76.1                                                             253   8e-78
YDR096W (GIS1) [946] chr4 (637133..639817) DNA damage-responsive...   261   7e-74
ABR167C [760] [Homologous to ScYJR119C - SH] (714425..716755) [2...   124   6e-29
Kwal_55.21855                                                         122   8e-29
KLLA0D10758g 917125..919677 similar to sp|P47156 Saccharomyces c...   121   7e-28
Sklu_2303.6 YJR119C, Contig c2303 8969-11356                          119   3e-27
CAGL0H00528g 52511..54733 similar to sp|P47156 Saccharomyces cer...   116   2e-26
Scas_691.27                                                           108   5e-24
YJR119C (YJR119C) [3011] chr10 complement(644219..646405) Protei...   107   2e-23
CAGL0G08107g 768772..770649 weakly similar to tr|Q03833 Saccharo...    89   8e-18
Scas_709.32                                                            71   3e-12
Scas_602.9                                                             68   2e-11
CAGL0E04884g complement(469295..473764) weakly similar to sp|P07...    67   8e-11
CAGL0L06072g complement(679924..680826) some similarities with s...    64   1e-10
Scas_707.31                                                            64   1e-10
Sklu_2181.1 YER130C, Contig c2181 4015-5247                            65   1e-10
AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C (...    60   1e-10
Sklu_2443.22 , Contig c2443 45390-46027                                62   1e-10
Kwal_47.17241                                                          64   2e-10
ACL057W [992] [Homologous to ScYER130C - SH] complement(264934.....    64   3e-10
Scas_649.28                                                            65   3e-10
KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959 Saccha...    63   6e-10
AGR172W [4483] [Homologous to ScYDR216W (ADR1) - SH] complement(...    64   6e-10
Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement        59   8e-10
YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger transcr...    63   8e-10
YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein w...    63   9e-10
Kwal_26.8351                                                           63   9e-10
CAGL0K02145g 190055..191008 some similarities with sp|P39959 Sac...    61   1e-09
CAGL0M13189g complement(1294293..1295918) weakly similar to sp|P...    62   1e-09
KLLA0F13046g 1201353..1205492 some similarities with sp|P07248 S...    62   2e-09
Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement       62   2e-09
Scas_703.23                                                            62   2e-09
ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C (M...    61   3e-09
Scas_721.92                                                            61   5e-09
AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -...    60   8e-09
Kwal_47.16621                                                          60   8e-09
YDR043C (NRG1) [896] chr4 complement(542670..543365) Transcripti...    57   9e-09
YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger transcri...    60   9e-09
Kwal_56.24206                                                          60   1e-08
KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces c...    60   1e-08
YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein...    59   1e-08
YML081W (YML081W) [3888] chr13 (104777..108532) Protein with sim...    59   1e-08
KLLA0F26961g 2486804..2488888 some similarities with sp|P33748 S...    59   1e-08
CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces cer...    59   2e-08
Kwal_27.10925                                                          57   2e-08
CAGL0K12078g complement(1168989..1170380) weakly similar to sp|Q...    58   3e-08
YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-fing...    58   3e-08
AFL127C [3068] [Homologous to ScYMR176W (ECM5) - SH] (193474..19...    58   3e-08
CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces c...    58   4e-08
CAGL0F05995g complement(598819..600612) some similarities with s...    57   5e-08
KLLA0F18524g complement(1701498..1702571) some similarities with...    56   5e-08
KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA Kluy...    56   7e-08
CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces c...    56   8e-08
Scas_718.44                                                            55   1e-07
AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W (...    55   1e-07
YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finge...    55   2e-07
Kwal_14.2278                                                           54   3e-07
CAGL0L07480g complement(822240..823184) some similarities with s...    54   3e-07
Scas_575.3                                                             54   4e-07
YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent t...    54   4e-07
Scas_569.2                                                             52   7e-07
ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH] complement(...    54   7e-07
YMR176W (ECM5) [4131] chr13 (611739..615974) Protein involved in...    54   8e-07
Kwal_47.17888                                                          53   1e-06
Scas_717.17                                                            52   1e-06
KLLA0B07909g 697885..700653 some similarities with sp|P53243 Sac...    52   2e-06
AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)...    52   2e-06
YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protei...    50   2e-06
CAGL0K09372g complement(924818..926008) similar to sp|P53035 Sac...    52   2e-06
Scas_712.42*                                                           51   2e-06
YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor ...    50   2e-06
Scas_378.1                                                             50   2e-06
Scas_697.35                                                            51   4e-06
Scas_719.68                                                            51   6e-06
KLLA0F23782g 2219920..2222268 some similarities with sp|P41696 S...    50   6e-06
YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein...    50   9e-06
Scas_683.25                                                            50   9e-06
CAGL0K04631g complement(440721..443762) some similarities with s...    50   1e-05
YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein in...    49   1e-05
YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative transcr...    49   1e-05
Scas_693.31                                                            49   1e-05
Kwal_47.19045                                                          48   2e-05
KLLA0B00605g complement(46736..47455) some similarities with sp|...    47   2e-05
Kwal_26.8021                                                           47   6e-05
AGL207W [4105] [Homologous to NOHBY] complement(310750..311583) ...    46   6e-05
CAGL0L03916g complement(448955..450883) weakly similar to sp|P41...    47   6e-05
ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH] complement(...    47   7e-05
YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription facto...    47   7e-05
AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH] (574723..57...    46   8e-05
KLLA0B03454g complement(314015..315433) some similarities with s...    46   1e-04
YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcripti...    46   1e-04
CAGL0M06831g 695162..697099 weakly similar to sp|P53968 Saccharo...    45   2e-04
CAGL0C02519g 253051..254007 weakly similar to sp|P39943 Saccharo...    45   2e-04
YDR253C (MET32) [1086] chr4 complement(963982..964557) Zinc-fing...    44   3e-04
AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C (...    45   3e-04
Scas_636.14d                                                           44   3e-04
Scas_687.33                                                            44   3e-04
Kwal_27.11460                                                          45   3e-04
Scas_720.33                                                            44   3e-04
Kwal_56.23925                                                          44   5e-04
CAGL0E01331g 124362..126431 weakly similar to sp|P08153 Saccharo...    44   5e-04
Scas_627.17d                                                           43   5e-04
YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein th...    44   5e-04
Scas_568.5                                                             42   6e-04
KLLA0E18645g complement(1648263..1649558) some similarities with...    44   8e-04
AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH] complement(...    44   9e-04
KLLA0D16456g complement(1387846..1390410) weakly similar to sp|P...    43   0.001
KLLA0E08679g 777005..778795 some similarities with sp|P53968 Sac...    43   0.001
CAGL0K03003g 276756..278699 weakly similar to sp|P54785 Saccharo...    43   0.001
KLLA0F11682g complement(1068992..1070116) some similarities with...    43   0.001
YJL056C (ZAP1) [2855] chr10 complement(330347..332989) Zinc-resp...    43   0.001
CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces c...    43   0.001
Scas_717.60d                                                           41   0.001
Scas_711.56                                                            43   0.002
KLLA0C16203g complement(1414169..1418533) weakly similar to sp|Q...    43   0.002
CAGL0E06116g complement(604708..606549) some similarities with t...    42   0.002
CAGL0M01870g complement(219813..220760) some similarities with t...    42   0.002
Scas_720.39                                                            42   0.003
KLLA0C16005g 1397274..1398269 some similarities with sgd|S000615...    41   0.003
YLR131C (ACE2) [3541] chr12 complement(404511..406823) Metalloth...    42   0.003
Kwal_23.5400                                                           42   0.003
Sklu_1527.1 YPL038W, Contig c1527 389-1006                             40   0.003
YMR182C (RGM1) [4137] chr13 complement(624531..625166) Transcrip...    40   0.004
Kwal_27.11824                                                          40   0.005
CAGL0B02651g complement(253495..254064) weakly similar to sp|Q12...    40   0.005
Sklu_2389.2 YJL056C, Contig c2389 3525-5828                            41   0.006
CAGL0I02838g complement(248704..250671) similar to sp|P41696 Sac...    40   0.007
Scas_695.2                                                             40   0.007
Scas_713.11                                                            40   0.009
KLLA0F20636g complement(1914452..1915309) some similarities with...    39   0.009
Kwal_14.2206                                                           39   0.010
KLLA0A04609g complement(411494..412765) some similarities with s...    40   0.010
CAGL0M04323g complement(474158..476269) similar to sp|P21192 Sac...    40   0.012
AGL246W [4066] [Homologous to ScYDR253C (MET32) - SH; ScYPL038W ...    39   0.014
AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH] complement(...    39   0.015
KLLA0F01463g 140343..142688 some similarities with sp|P47043 Sac...    39   0.016
CAGL0G10021g complement(959154..960338) similar to sp|P39933 Sac...    39   0.018
YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-depende...    39   0.018
Scas_718.67                                                            39   0.019
Kwal_27.10467                                                          39   0.022
Scas_631.7                                                             39   0.023
Scas_721.56                                                            38   0.024
CAGL0L12562g complement(1350878..1351549) similar to sp|Q12041 S...    38   0.027
Kwal_14.2543                                                           39   0.031
AFL136W [3059] [Homologous to ScYPL230W - SH; ScYMR182C (RGM1) -...    38   0.033
YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA polym...    38   0.038
Scas_627.6                                                             38   0.040
Kwal_47.16577                                                          38   0.046
Kwal_47.18337                                                          38   0.047
CAGL0E04312g 412563..414629 some similarities with sp|Q00947 Sac...    37   0.10 
CAGL0L00583g 69547..70713 similar to tr|Q12132 Saccharomyces cer...    36   0.15 
CAGL0E03762g complement(351003..352757) weakly similar to sp|P33...    36   0.17 
Scas_718.36d                                                           35   0.21 
Sklu_2436.9 YDR463W, Contig c2436 18516-20069                          35   0.24 
Sklu_2126.5 YHL027W, Contig c2126 7763-9109                            35   0.24 
KLLA0D11902g 1015273..1016142 some similarities with sp|Q12041 S...    35   0.25 
CAGL0K01727g complement(152569..154068) similar to sp|Q03465 Sac...    35   0.27 
YDL020C (RPN4) [840] chr4 complement(415110..416705) Subunit of ...    35   0.28 
Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement          34   0.37 
Scas_604.4                                                             35   0.37 
Sklu_2244.3 , Contig c2244 4100-4915 reverse complement                34   0.39 
CAGL0H07557g 738086..739516 some similarities with sp|P32805 Sac...    35   0.44 
KLLA0F10109g complement(939195..941066) weakly similar to sp|Q00...    35   0.45 
KLLA0E00726g 80516..82069 gi|5531271|emb|CAB50896.1 Kluyveromyce...    35   0.46 
Scas_641.24                                                            34   0.48 
Scas_660.12                                                            34   0.51 
CAGL0C03355g 337923..338852 similar to sp|P53743 Saccharomyces c...    34   0.56 
YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor i...    34   0.62 
CAGL0I02816g complement(247817..248692) similar to sp|P41696 Sac...    33   0.67 
YDR463W (STP1) [1281] chr4 (1386804..1388363) Transcription fact...    33   0.87 
AFR461C [3653] [Homologous to ScYDR463W (STP1) - SH] (1269565..1...    33   0.90 
YHR006W (STP2) [2292] chr8 (117808..119433) Transcription factor...    33   0.90 
CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces c...    33   0.98 
YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predic...    33   1.0  
KLLA0A10373g complement(907244..907864) some similarities with c...    32   1.1  
YHL027W (RIM101) [2259] chr8 (51109..52986) Transcription factor...    33   1.3  
Kwal_33.14227                                                          33   1.8  
Kwal_27.11573                                                          32   2.1  
AFR190C [3382] [Homologous to ScYHL027W (RIM101) - SH] (783110.....    32   2.2  
KLLA0C00286g 19668..21206 similar to ca|CA3134|IPF11499.repeat2 ...    32   2.4  
ADL042W [1699] [Homologous to ScYPR015C - SH] complement(615818....    32   2.6  
ADL040W [1701] [Homologous to ScYPR013C - SH] complement(618855....    32   2.6  
Kwal_55.20634                                                          32   3.4  
Scas_670.2                                                             32   3.8  
Kwal_26.9300                                                           31   3.9  
Sklu_2359.5 YPR022C, Contig c2359 10655-12818                          32   4.2  
Scas_712.2                                                             31   5.0  
YLR375W (YLR375W) [3755] chr12 (871696..872727) Protein with str...    31   5.0  
Scas_591.8                                                             31   5.3  
CAGL0K06413g 627811..628890 some similarities with sp|Q00947 Sac...    30   9.2  
Scas_683.30                                                            30   9.6  

>CAGL0L11880g 1272624..1275566 some similarities with sp|P39956
           Saccharomyces cerevisiae YER169w, hypothetical start
          Length = 980

 Score = 1789 bits (4634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 890/965 (92%), Positives = 890/965 (92%)

Query: 1   MEVVDGVPVFRPAWEEFKDFMGYMEKIRPHGMASGIVKVIPPREWLDRAGREPREDLLRE 60
           MEVVDGVPVFRPAWEEFKDFMGYMEKIRPHGMASGIVKVIPPREWLDRAGREPREDLLRE
Sbjct: 1   MEVVDGVPVFRPAWEEFKDFMGYMEKIRPHGMASGIVKVIPPREWLDRAGREPREDLLRE 60

Query: 61  VRIRNPIQQHVSGSKGVYMISNVEKNKTYNMIQWKDLSYDFRVPDDPSSLKNKSEESIQD 120
           VRIRNPIQQHVSGSKGVYMISNVEKNKTYNMIQWKDLSYDFRVPDDPSSLKNKSEESIQD
Sbjct: 61  VRIRNPIQQHVSGSKGVYMISNVEKNKTYNMIQWKDLSYDFRVPDDPSSLKNKSEESIQD 120

Query: 121 NEXXXXXXXXXXGIKLKNCDSATEEDFQNFMKEYNAENIRDFDDEERLKFLESYYWKTLN 180
           NE          GIKLKNCDSATEEDFQNFMKEYNAENIRDFDDEERLKFLESYYWKTLN
Sbjct: 121 NERSQQRRRSSSGIKLKNCDSATEEDFQNFMKEYNAENIRDFDDEERLKFLESYYWKTLN 180

Query: 181 FTTPLYGADSSGSIFPSDLEEWNVAKLPNVLSHIDQDIPGVNQAYLYAGLWKASFTWHLE 240
           FTTPLYGADSSGSIFPSDLEEWNVAKLPNVLSHIDQDIPGVNQAYLYAGLWKASFTWHLE
Sbjct: 181 FTTPLYGADSSGSIFPSDLEEWNVAKLPNVLSHIDQDIPGVNQAYLYAGLWKASFTWHLE 240

Query: 241 DQDLYSINYIHFGAPKQWYSIPQEDHEKFYEFMKEKFPEEASKCKEFLRHKMFLVSPKVL 300
           DQDLYSINYIHFGAPKQWYSIPQEDHEKFYEFMKEKFPEEASKCKEFLRHKMFLVSPKVL
Sbjct: 241 DQDLYSINYIHFGAPKQWYSIPQEDHEKFYEFMKEKFPEEASKCKEFLRHKMFLVSPKVL 300

Query: 301 KENNIKCNKVTHYEHEFIITYPYGYHAGFNYGYNLAESVNFALEDWLEIGKKAGKCRCIS 360
           KENNIKCNKVTHYEHEFIITYPYGYHAGFNYGYNLAESVNFALEDWLEIGKKAGKCRCIS
Sbjct: 301 KENNIKCNKVTHYEHEFIITYPYGYHAGFNYGYNLAESVNFALEDWLEIGKKAGKCRCIS 360

Query: 361 DSVEVDVDKLAENWSNFKKKREIEDPETEDSPQKKRKSSTVDSNETISNVSATXXXXXXX 420
           DSVEVDVDKLAENWSNFKKKREIEDPETEDSPQKKRKSSTVDSNETISNVSAT       
Sbjct: 361 DSVEVDVDKLAENWSNFKKKREIEDPETEDSPQKKRKSSTVDSNETISNVSATKEDDEVK 420

Query: 421 XXXXXXXXXLIKDVKKEVTDSNEDDLNASVDVQRQSNDNTFGDNSNPATNIKMESNKTKI 480
                    LIKDVKKEVTDSNEDDLNASVDVQRQSNDNTFGDNSNPATNIKMESNKTKI
Sbjct: 421 NEDNDDNSKLIKDVKKEVTDSNEDDLNASVDVQRQSNDNTFGDNSNPATNIKMESNKTKI 480

Query: 481 EANVPGVAKKLRGFDELLNRSPQNSPRMETSLKNDPFFARDSPLRSNSPGTNLFFNQSIQ 540
           EANVPGVAKKLRGFDELLNRSPQNSPRMETSLKNDPFFARDSPLRSNSPGTNLFFNQSIQ
Sbjct: 481 EANVPGVAKKLRGFDELLNRSPQNSPRMETSLKNDPFFARDSPLRSNSPGTNLFFNQSIQ 540

Query: 541 RMSSPILSKMIDLSNIVEPTLDDPTLKFKRKTNLPSQLIGNSNISSPLLXXXXXXXXXXX 600
           RMSSPILSKMIDLSNIVEPTLDDPTLKFKRKTNLPSQLIGNSNISSPLL           
Sbjct: 541 RMSSPILSKMIDLSNIVEPTLDDPTLKFKRKTNLPSQLIGNSNISSPLLQNIQDQQNQQQ 600

Query: 601 XXXXXXXGTPLSNLSFGPMRSGLGSNPVXXXXXXXXXXXXXXTSMANSRPSSPRLHHINI 660
                  GTPLSNLSFGPMRSGLGSNPV              TSMANSRPSSPRLHHINI
Sbjct: 601 QQQRSQNGTPLSNLSFGPMRSGLGSNPVLLDNNDDNMLALSLTSMANSRPSSPRLHHINI 660

Query: 661 PNEANSKMKSGSNDTVNAASNFVTSGSNVQQGMSVVSPKPVPYYGNQFERTFXXXXXXXX 720
           PNEANSKMKSGSNDTVNAASNFVTSGSNVQQGMSVVSPKPVPYYGNQFERTF        
Sbjct: 661 PNEANSKMKSGSNDTVNAASNFVTSGSNVQQGMSVVSPKPVPYYGNQFERTFNSMPSPIP 720

Query: 721 XXXXXXXXXFIKRLKSPNIVTLNISREGSKSPVSLQNEVRSPLGLNTTLSYPIPTEKQLS 780
                    FIKRLKSPNIVTLNISREGSKSPVSLQNEVRSPLGLNTTLSYPIPTEKQLS
Sbjct: 721 MSPGGSNMPFIKRLKSPNIVTLNISREGSKSPVSLQNEVRSPLGLNTTLSYPIPTEKQLS 780

Query: 781 NLNPVNNSNYQAASPALMDDKNNINPNQNMNSLLDMGLSAFQNSPSNGLRQISSETYESS 840
           NLNPVNNSNYQAASPALMDDKNNINPNQNMNSLLDMGLSAFQNSPSNGLRQISSETYESS
Sbjct: 781 NLNPVNNSNYQAASPALMDDKNNINPNQNMNSLLDMGLSAFQNSPSNGLRQISSETYESS 840

Query: 841 PLMSLAAAANKDIELTNSMMRPSRSKTKLPTDKARSKSKSVEAQGPKFEKGEVILSDSGK 900
           PLMSLAAAANKDIELTNSMMRPSRSKTKLPTDKARSKSKSVEAQGPKFEKGEVILSDSGK
Sbjct: 841 PLMSLAAAANKDIELTNSMMRPSRSKTKLPTDKARSKSKSVEAQGPKFEKGEVILSDSGK 900

Query: 901 IYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIPCIPGV 960
           IYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIPCIPGV
Sbjct: 901 IYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIPCIPGV 960

Query: 961 GSSAG 965
           GSSAG
Sbjct: 961 GSSAG 965

>AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W
           (GIS1) - SH] (964417..966816) [2400 bp, 799 aa]
          Length = 799

 Score =  637 bits (1643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/961 (39%), Positives = 510/961 (53%), Gaps = 193/961 (20%)

Query: 6   GVPVFRPAWEEFKDFMGYMEKIRPHGMASGIVKVIPPREWLDRAGREPREDLLREVRIRN 65
           GVPVFRP+WEEF+DF  YM  I  +GM SG+VK+IPPREW++R G  P  + LR + IR+
Sbjct: 11  GVPVFRPSWEEFQDFYKYMFLIDEYGMKSGVVKIIPPREWVERLGERPGVEQLRRIHIRS 70

Query: 66  PIQQHVSGSKGVYMISNVEKNKTYNMIQWKDLSYDFRVPDDPSSLKNKSEESIQDNEXXX 125
           PIQQHVSGSKGV+++ NVE+ K+YN+IQWKDL+ D+++PD           S+  +    
Sbjct: 71  PIQQHVSGSKGVFVVQNVERQKSYNIIQWKDLAQDYQLPD-----MRGYGGSLSRSAAAG 125

Query: 126 XXXXXXXGIKLKNCDSATEEDFQNFMKEYNAENIRDFDDEERLKFLESYYWKTLNFTTPL 185
                   I+ +  DS ++EDF+ F + YN E +  +DDE  L+ LE+YYWKTLNFT P+
Sbjct: 126 GARPRPSNIRTRTQDSFSDEDFREFQEHYNVEGLAQYDDESFLRGLENYYWKTLNFTEPM 185

Query: 186 YGADSSGSIFPSDLEEWNVAKLPNVLSHIDQDIPGVNQAYLYAGLWKASFTWHLEDQDLY 245
           YGAD+ G++FP  L +WNV++LPN+L H+++ +PGVNQ+YLYAGLWKASF WHLEDQDLY
Sbjct: 186 YGADTLGTLFPDSLHQWNVSRLPNLLDHLEEKVPGVNQSYLYAGLWKASFAWHLEDQDLY 245

Query: 246 SINYIHFGAPKQWYSIPQEDHEKFYEFMKEKFPEEASKCKEFLRHKMFLVSPKVLKENNI 305
           SINY+HFGAPKQWYSIPQED  KF++FM+E+FPEE+++C+EFLRHKMF+VSPKVL+ N I
Sbjct: 246 SINYLHFGAPKQWYSIPQEDSHKFFKFMQEQFPEESAQCREFLRHKMFMVSPKVLERNGI 305

Query: 306 KCNKVTHYEHEFIITYPYGYHAGFNYGYNLAESVNFALEDWLEIGKKAGKCRCISDSVEV 365
           +CN + H +HEF++TYP        YGY+   +  + L +                    
Sbjct: 306 RCNSIVHRQHEFMVTYP--------YGYHSGFNYGYNLAE-------------------- 337

Query: 366 DVDKLAENWSNFKKKREIEDPETEDSPQKKRKSSTVDSNETISNVSATXXXXXXXXXXXX 425
            V+   E+W                  +K +K   VD +  I                  
Sbjct: 338 SVNFALESWLPIG--------------EKAKKCMCVDDSVGID----------------- 366

Query: 426 XXXXLIKDVKKEVTDSNEDDLNASVDVQRQSNDNTFGDNSNPATNIKMESNKTK-IEANV 484
                I+ +K     S ++D   S D +             P   +K E N +  ++A +
Sbjct: 367 -----IQKLKSAYFRSLQEDRAGSADPE------------PPRKRLKQEPNTSSFVQAPI 409

Query: 485 PGVAKKLRGFDELLNRSPQNSPRMETSLKNDPFFARDSP----LRSNSPGTNLFFNQSIQ 540
                 L+ F+EL+N S      ME           D+P    +RS +P    F N SI 
Sbjct: 410 LDTGDSLKSFNELINHSAYELQAME-----------DNPNQRSIRSTTP-NQYFSNPSIS 457

Query: 541 RMSSPILSKMIDLSNIVEPTLDDPTLKFKRKTNLPSQLIGNSNISSPLLXXXXXXXXXXX 600
           RMSSP+LS+M+DLSNIVEPTL+DPTLKFKRK  + +Q   N+   +P+            
Sbjct: 458 RMSSPLLSRMMDLSNIVEPTLEDPTLKFKRK--VVAQDTSNAMAPNPV------------ 503

Query: 601 XXXXXXXGTPLSNLSFGPMRSGLGSNPVXXXXXXXXXXXXXXTSMANSRPSSPRLHHINI 660
                  G P++++  GP        P                SMANS  SSPR      
Sbjct: 504 ----SGVGAPVTSVCVGP--------PALNNLHEESVLALSLASMANSGNSSPR------ 545

Query: 661 PNEANSKMKSGSNDTVNAASNFVTSGSNVQQGMSVVSPKPVPYYGNQFERTFXXXXXXXX 720
                       N  V  +  +  +G  +          P+ YY  Q  ++         
Sbjct: 546 ------NALPPLNSAVGNSRPYTPTGDAILAPRPSYDQNPLSYYSTQTTKS--------- 590

Query: 721 XXXXXXXXXFIKRLKSPNIVTLNISREGSKSPVSLQNEVRSPLGLNTTLSYPIPTEKQLS 780
                      KR+ SPN VTLNISRE S+SP+S  +E   P      LS P P      
Sbjct: 591 ------PMPLFKRINSPNRVTLNISRESSRSPISFGSEYGKP-----PLSKPHPLNAGAV 639

Query: 781 NLNPVNNSNYQAASPALMDDKNNINPNQNMNSLLDMGLSAFQNSPSNGLRQISSETYESS 840
           NL  +N  +                  +N+ S  D    A+     N +  +SS  +   
Sbjct: 640 NLTSLNQVS---------------TIERNIPSHRDRSAKAYHGDKVN-IHGVSSGKFVGH 683

Query: 841 PLMSLAAAANKDIELTNSMM----RPSRSKTKLPTDKARSKSKSVEAQGPKFEKGEVILS 896
            +    A  N D  LTNS++    RP R+ +  PT K  ++              E+I+S
Sbjct: 684 QINDSLALLNDDA-LTNSVLPGAGRPERATS--PTSKISAE--------------EIIIS 726

Query: 897 DSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIPC 956
           D GK YVCQEC+RQFSSGHHLTRHKKSVHSGEKPHSCPKCGK+FKRRDHVLQHLNKKIPC
Sbjct: 727 DKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPC 786

Query: 957 I 957
           +
Sbjct: 787 V 787

>Kwal_56.23453
          Length = 828

 Score =  573 bits (1478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/733 (42%), Positives = 433/733 (59%), Gaps = 82/733 (11%)

Query: 6   GVPVFRPAWEEFKDFMGYMEKIRPHGMASGIVKVIPPREWLDRAGREPREDLLREVRIRN 65
           GVPVFRP +E FKDF  YM  +  +G  SGIVKVIPP+EWLD+    P  + L+++RIR 
Sbjct: 12  GVPVFRPNYERFKDFYEYMRAVDKYGKKSGIVKVIPPQEWLDQLEMPPGVETLQKIRIRT 71

Query: 66  PIQQHVSGSKGVYMISNVEKNKTYNMIQWKDLSYDFRVPDDPSSLKNKSEESIQD--NEX 123
           PIQQH +GSKGV+++ NVEK+K+YN+IQWKD+SYD+R+PD        SE    D     
Sbjct: 72  PIQQHFNGSKGVFVVQNVEKSKSYNIIQWKDISYDYRLPDGGGEASGSSEADAGDTLGAR 131

Query: 124 XXXXXXXXXGIKLKNCDSATEEDFQNFMKEYNAENIRDFDDEERLKFLESYYWKTLNFTT 183
                     IKL++ +S ++ +F+ F   YN +N+ DF D  R +FLESY+WKTL FT 
Sbjct: 132 KSPSPLKSSKIKLRSPESFSDAEFEKFSAHYNHDNLGDFRDPSRREFLESYFWKTLAFTP 191

Query: 184 PLYGADSSGSIFPSDLEEWNVAKLPNVLSHIDQDIPGVNQAYLYAGLWKASFTWHLEDQD 243
           P+YGADS GS+F   L+ WNV+KLPN+L H++  +PGVN +YLYAGLWKASF+WHLEDQD
Sbjct: 192 PMYGADSLGSLFQDKLDVWNVSKLPNILDHMNTKVPGVNGSYLYAGLWKASFSWHLEDQD 251

Query: 244 LYSINYIHFGAPKQWYSIPQEDHEKFYEFMKEKFPEEASKCKEFLRHKMFLVSPKVLKEN 303
           LYSINYIHFGAPKQWYSIPQED +KFY+FM+E+FPE A+KC EFLRHK FLVSPK+L++N
Sbjct: 252 LYSINYIHFGAPKQWYSIPQEDSDKFYKFMQEQFPEHAAKCDEFLRHKTFLVSPKILEKN 311

Query: 304 NIKCNKVTHYEHEFIITYPYGYHAGFNYGYNLAESVNFALEDWLEIGKKAGKCRCISDSV 363
            I+CNK+ HY+ EFIITYPYGYHAGFNYGYNLAESVNFALE+WL+IG KA +C CI D+V
Sbjct: 312 GIRCNKIVHYQQEFIITYPYGYHAGFNYGYNLAESVNFALENWLDIGIKAKRCLCIDDAV 371

Query: 364 EVDVDKLAENWSNFKKKREIEDPETEDSPQKKRKSSTVDSNETISNVSATXXXXXXXXXX 423
            +DV+KL ++W     K++ E P+ +   Q+ ++ S   S +                  
Sbjct: 372 GIDVEKLRDDW--LSSKQKAEKPKVKHEIQESQRGSNGVSKKA----------------- 412

Query: 424 XXXXXXLIKDVKKEVTDSNEDDLNASVDVQRQSNDNTFGDNSNPATNIKMESNKTKIEAN 483
                   K  K   +     + + + DV+   +D +  +   P     +  N+   + N
Sbjct: 413 --------KFEKDSASTKQPSEGSKNADVKNDKSDKSNIEVVCPTPGRSLPFNRLTNKEN 464

Query: 484 VPGVAKKLRGFDELLNRSPQNSPRMETSLKNDPFFARDSPLRSNSPGTNLFF---NQSIQ 540
                 +++GF+ELL+ S      ME    ++P   + S +RS +P    ++   +QSI 
Sbjct: 465 -----PRMKGFNELLHHSSYELQAME----DNP---QQSAIRSTTPNPGQYYSGLSQSIS 512

Query: 541 RMSSPILSKMIDLSNIVEPTLDDPTLKFKRKTNLPSQLIGNSNISSPLLXXXXXXXXXXX 600
           R+SSP+LS+M+DLSNIVEPTL+DPTLKFK+ +NL  Q     N  +P +           
Sbjct: 513 RISSPLLSRMMDLSNIVEPTLEDPTLKFKKSSNLSQQ-----NSQTPQVLEDNDDNMLAL 567

Query: 601 XXXXXXXGT--------PLSNLSFGPMRSG---LGSNPVXXXXXXXXXXXXXXTSMANSR 649
                  G         P+    + P  +G   L S P+              ++M + +
Sbjct: 568 SLASMASGASSPRYPLPPIQPRPYSPAVAGDSMLASGPLYEQNPFSYYSTNFKSTMGSPQ 627

Query: 650 PSSPRLHH--------------INIPNEA-------NSKMKSGSNDTVNAASNFVTSGSN 688
           PSSP L +              +NI  E+       NS+ KS  ++ + A  N   + SN
Sbjct: 628 PSSPALSNLPFIKRLKSPNRVTLNISRESSRSPILLNSEFKSPLSNNIAANGNTAVN-SN 686

Query: 689 VQQGMSVVSPKPV 701
           + Q  +V    PV
Sbjct: 687 LSQATTVEHSPPV 699

 Score =  159 bits (401), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 101/234 (43%), Positives = 117/234 (50%), Gaps = 75/234 (32%)

Query: 730 FIKRLKSPNIVTLNISREGSKSPVSLQNEVRSPLGLNTTLSYPIPTEKQLSNLNPVNNSN 789
           FIKRLKSPN VTLNISRE S          RSP+ LN+    P+                
Sbjct: 638 FIKRLKSPNRVTLNISRESS----------RSPILLNSEFKSPL---------------- 671

Query: 790 YQAASPALMDDKNNINPNQNMNSLLDMGLSAFQNSPSNGLRQISSETYESSPLMSLAAAA 849
                       NNI    N N+ ++  LS              + T E SP +S     
Sbjct: 672 -----------SNNIA--ANGNTAVNSNLS-------------QATTVEHSPPVSPPIPN 705

Query: 850 NKDIELTNSMMRPSRSKTKLPTDKARSKSKSVEAQGPKFEKGEVILSDSGKIYVCQECKR 909
           N   + +   + PS                       K    E+I+SD GK+YVCQEC+R
Sbjct: 706 NSIADFSKRPIAPS-----------------------KINSEEIIVSDKGKVYVCQECRR 742

Query: 910 QFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIPCIPGVGSS 963
           QFSSGHHLTRHKKSVHSGEKPHSCPKCGK+FKRRDHVLQHLNKKIPC    G S
Sbjct: 743 QFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPCTAEGGQS 796

>YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsive
           repressor of PHR1, contains two C2H2-type zinc finger
           domains [2391 bp, 796 aa]
          Length = 796

 Score =  534 bits (1375), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 238/374 (63%), Positives = 298/374 (79%), Gaps = 12/374 (3%)

Query: 2   EVVDGVPVFRPAWEEFKDFMGYMEKIRPHGMASGIVKVIPPREWLDRAGREPREDLLREV 61
           E+V GVPVF+P +E+F+DF  Y + I  +GM SG+VKVIPP+EW D+       + L+++
Sbjct: 9   EIVGGVPVFKPTYEQFEDFYAYCKAINKYGMKSGVVKVIPPKEWKDKLDLPYSAETLQKI 68

Query: 62  RIRNPIQQHVSGSKGVYMISNVEKNKTYNMIQWKDLSYDFRVPDDPSSLKNKSEESIQDN 121
           +I++PIQQH+SG+KG++M+ NVEKNKTYN+IQWKDLS D+  P+DP + +N  + S+  +
Sbjct: 69  KIKSPIQQHISGNKGLFMVQNVEKNKTYNIIQWKDLSKDYVPPEDPKARRNSRKGSVSKS 128

Query: 122 EXXXXXXXXXXGIKLKNCDSATE-EDFQNFMKEYNAENIRDFDDEERLKFLESYYWKTLN 180
                       +KLKN +S+   +DF+ F  EY  + + DF + ERLKFLE YYWKTLN
Sbjct: 129 ----------TKLKLKNFESSFNIDDFEQFRTEYTID-LSDFQNTERLKFLEEYYWKTLN 177

Query: 181 FTTPLYGADSSGSIFPSDLEEWNVAKLPNVLSHIDQDIPGVNQAYLYAGLWKASFTWHLE 240
           FTTP+YGAD+ GSIFP  L  WNVAKLPN+L H++  +PGVN +YLYAGLWKASF+WHLE
Sbjct: 178 FTTPMYGADTPGSIFPEGLNVWNVAKLPNILDHMETKVPGVNDSYLYAGLWKASFSWHLE 237

Query: 241 DQDLYSINYIHFGAPKQWYSIPQEDHEKFYEFMKEKFPEEASKCKEFLRHKMFLVSPKVL 300
           DQDLYSINYIHFGAPKQWYSIPQED  KFY+FM+E+FPEEA  C EFLRHKMFL SPK+L
Sbjct: 238 DQDLYSINYIHFGAPKQWYSIPQEDRFKFYKFMQEQFPEEAKNCPEFLRHKMFLASPKLL 297

Query: 301 KENNIKCNKVTHYEHEFIITYPYGYHAGFNYGYNLAESVNFALEDWLEIGKKAGKCRCIS 360
           +EN I+CN++ H+E EF+ITYPYGYHAGFNYGYNLAESVNFALE+WL IGKKAGKC CIS
Sbjct: 298 QENGIRCNEIVHHEGEFMITYPYGYHAGFNYGYNLAESVNFALEEWLPIGKKAGKCHCIS 357

Query: 361 DSVEVDVDKLAENW 374
           DSVE+DV KLA++W
Sbjct: 358 DSVEIDVKKLAKSW 371

 Score =  190 bits (483), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 158/449 (35%), Positives = 200/449 (44%), Gaps = 103/449 (22%)

Query: 522 SPLRSNSPGTNLF--FNQSIQRMSSPILSKMIDLSNIVEPTLDDPTLKFKRKTNLPSQLI 579
           S LRS SP    F  F      +SSP+LS+M D SNIVEPTL+DPTLK KR ++   Q +
Sbjct: 406 SSLRSTSPDVGHFSNFKSKSSGVSSPLLSRMKDYSNIVEPTLEDPTLKLKRISSFQEQPL 465

Query: 580 GNSNISSPLLXXXXXXXXXXXXXXXXXXGTPLSNLSFGPMRSGLGSNPVXXXXXXXXXXX 639
                   LL                     L                            
Sbjct: 466 NK------LLKRETSQTAMLTDHEDNIVAMSL---------------------------- 491

Query: 640 XXXTSMANSRPSSPRL--HHINIPNEANSK--MKSGSNDTVNAASNFVTSGSNVQQGMSV 695
              TSMANS  SSPRL    +N  NE ++   +   +N+T+        SG N       
Sbjct: 492 ---TSMANSAASSPRLPLSRLNSSNELSNAQPLLDMTNNTLAFPRPNGPSGLN------- 541

Query: 696 VSPKPVPYYGNQFERTFXXXXXXXXXXXXXXXXXFIKRLKSPNIVTLNISREGSKSPVSL 755
               P+ Y  N   +                    IKR+KSPNIVTLNISRE S+SP++L
Sbjct: 542 ----PLLYISN---KNISGISHSAPHSPVNPNISLIKRVKSPNIVTLNISRESSRSPIAL 594

Query: 756 QNEVRSPLGLNTTLSYPIPTEKQLSNLNPVNNSNYQAASPALMDDKNNIN------PNQN 809
             E R       + S P          + V+N +     P  + D N+I       PN  
Sbjct: 595 NYEARQQHSQQHSFSTP----------STVSNLSTSVLGP--LSDTNDIKTPHPERPNHK 642

Query: 810 MNSLLDMGLSAFQNSPSNG-LRQISSETYESSPLMSLAAAANKDIELTNSMMRPSRSKTK 868
             + +    S  + S SN  L +++S   E S       + N D++              
Sbjct: 643 TANRILKKESPVETSKSNLILSKVASTRQEDS-----FTSRNDDLD-------------- 683

Query: 869 LPTDKARSKSKSVEAQGPKFEKGEVILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGE 928
                   K +       KF   E++LS   KIY+C+EC+R+FSSGHHLTRHKKSVHSGE
Sbjct: 684 --------KEQGSSPLNSKFAPEEIVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGE 735

Query: 929 KPHSCPKCGKRFKRRDHVLQHLNKKIPCI 957
           KPHSCPKCGKRFKRRDHVLQHLNKKIPCI
Sbjct: 736 KPHSCPKCGKRFKRRDHVLQHLNKKIPCI 764

>Scas_681.19
          Length = 864

 Score =  518 bits (1335), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 226/385 (58%), Positives = 296/385 (76%), Gaps = 2/385 (0%)

Query: 3   VVDGVPVFRPAWEEFKDFMGYMEKIRPHGMASGIVKVIPPREWLDRAGREPREDLLREVR 62
           + DG+P+F+P ++EFKDF  +ME I   GM SGIVKVIPP EWL      P  + L+ ++
Sbjct: 12  IEDGIPIFKPTFQEFKDFYKFMEAINKFGMQSGIVKVIPPTEWLKLLDNPPSVEALQGIK 71

Query: 63  IRNPIQQHVSGSKGVYMISNVEKNKTYNMIQWKDLSYDFRVPDDPSSLKNKSEESIQDNE 122
           I+NPI+Q +SG+ G++M +N+E++KTY++IQWK+LS D+ +P DP S     +    + +
Sbjct: 72  IKNPIEQEISGTHGLFMSNNIERSKTYHIIQWKELSKDYTLPQDPHSRDKNKDPDTNNGK 131

Query: 123 XXXXXXXXXXGIKLKNCDSATEEDFQNFMKEYNA--ENIRDFDDEERLKFLESYYWKTLN 180
                         K   S ++EDF+NF K +N   E ++ F+D+ERL FLE+YYWKTLN
Sbjct: 132 TIEMPSSTSSATHRKRQHSFSKEDFKNFQKNFNESDEILKQFNDKERLNFLENYYWKTLN 191

Query: 181 FTTPLYGADSSGSIFPSDLEEWNVAKLPNVLSHIDQDIPGVNQAYLYAGLWKASFTWHLE 240
           FT P+YGAD+SGSIF  +L  WNV+KLPN+L ++D++IPGVN ++LYAGLWKASF WHLE
Sbjct: 192 FTMPMYGADTSGSIFNENLNVWNVSKLPNLLDYLDKEIPGVNDSFLYAGLWKASFPWHLE 251

Query: 241 DQDLYSINYIHFGAPKQWYSIPQEDHEKFYEFMKEKFPEEASKCKEFLRHKMFLVSPKVL 300
           DQDLYSIN+IHFGAPKQWYSIPQEDH+ FY FM+E+FPEEA KC EFLRHK F+ SPK+L
Sbjct: 252 DQDLYSINFIHFGAPKQWYSIPQEDHQLFYNFMREQFPEEAKKCPEFLRHKTFMASPKLL 311

Query: 301 KENNIKCNKVTHYEHEFIITYPYGYHAGFNYGYNLAESVNFALEDWLEIGKKAGKCRCIS 360
            EN I+CNK+ HY++EF+IT+PYGYHAGFNYGYNLAESVNFALE+WLEIG++A KC C++
Sbjct: 312 SENGIRCNKIVHYQNEFMITFPYGYHAGFNYGYNLAESVNFALEEWLEIGERANKCLCVN 371

Query: 361 DSVEVDVDKLAENWSNFKKKREIED 385
           DSVE+DV KLA NW  FK K  +++
Sbjct: 372 DSVEIDVRKLASNWYIFKNKPNLKN 396

 Score =  231 bits (588), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 185/505 (36%), Positives = 247/505 (48%), Gaps = 110/505 (21%)

Query: 490 KLRGFDELLNRSPQNSPRMETSLKNDPFFA-----RDSPLRSNSPGTNLFFNQS------ 538
           ++R F ELLN S Q    ++   +  P        +D  LRS SP  + FF  +      
Sbjct: 401 RVRSFTELLNHSSQELQNIQKKQQVQPIRTFTESNKDVSLRSTSPTPSQFFTTNETNKPV 460

Query: 539 IQRMSSPILSKMIDLSNIVEPTLDDPTLKFKRKTNLPSQLIGNSNISSPLLXXXXXXXXX 598
           I R+SSP LS+M+DLSNIVEPTL+DPTLKFKRK N PS  +  +N   P+          
Sbjct: 461 ISRVSSPFLSRMMDLSNIVEPTLEDPTLKFKRKLNAPS--VSQNNTLPPISMPPLFQSPL 518

Query: 599 XXXXXXXXXGTPLSNLSFGPMRSGLGSNPVXXXXXXXXXXXXXXTSMANSRPSSPRLHHI 658
                       L+N                               MANS  SSPRL   
Sbjct: 519 LEDNEDNMIALSLAN-------------------------------MANSGTSSPRL--- 544

Query: 659 NIPNEANSKMKSGSNDTVNAASNFVTSGSNVQQGMSVVSPKPV----PYYGNQ------F 708
            I    NS +     D +N++S   ++G++  +  S+++PKP     PY  +       +
Sbjct: 545 -IIPALNSSI-----DPINSSS---SNGND--RISSILAPKPSLSSSPYVTSNNNNPMTY 593

Query: 709 ERTFXXXXXXXXXXXX------XXXXXFIKRLKSPNIVTLNISREGSKSPV-SLQNEVRS 761
             TF                       FIKR+KSPNIVTLNISRE S+SP+ +   + RS
Sbjct: 594 NSTFSNHNNNIQNNVVPLSPGGRSNLSFIKRIKSPNIVTLNISRETSRSPILTSVPDFRS 653

Query: 762 PLGLNTTLSYPIPTEKQLSNL---NPVNNSNYQAASPALMDDKNNINPNQNMNSLLDMGL 818
                 TL Y    +  L+ +   NP+ N           DD NN       N++ +  L
Sbjct: 654 NNNNTGTLPYSAIPQSSLNQMELNNPLGN-----------DDTNN-------NTVTNSEL 695

Query: 819 SAFQNSPSNGLRQISSETYESSPLMSLAAAANKDIELTNSMMRPSRSKTKLPTDKARSKS 878
           S   N P    +++++ T  +   M L               +PS     L  + + + +
Sbjct: 696 SIL-NQPPQKKQRLTNGTRSNQRKMELGVE------------QPSGDGV-LIGNSSSNNN 741

Query: 879 KSVEAQGPKFEKGEVILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGK 938
            +  AQ PKF   E+I+S++GK+YVC ECKRQF+SGHHLTRHKKSVHSGEKPHSCPKCGK
Sbjct: 742 NNTNAQAPKFTSDEIIMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGK 801

Query: 939 RFKRRDHVLQHLNKKIPCIPGVGSS 963
           +FKRRDHVLQHLNKKIPC+P  GSS
Sbjct: 802 KFKRRDHVLQHLNKKIPCVPEEGSS 826

>KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces
           cerevisiae YER169w RPH1, start by similarity
          Length = 821

 Score =  500 bits (1288), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 213/368 (57%), Positives = 287/368 (77%), Gaps = 7/368 (1%)

Query: 7   VPVFRPAWEEFKDFMGYMEKIRPHGMASGIVKVIPPREWLDRAGREPREDLLREVRIRNP 66
           VPVF+P +E F+DF  +M ++  +GM SGI+K++PP +W+D+    P  + L++++I+ P
Sbjct: 12  VPVFKPDYETFRDFYKFMCEVNKYGMKSGIIKIVPPEQWVDKVAFPPSAETLQKIKIKTP 71

Query: 67  IQQHVSGSKGVYMISNVEKNKTYNMIQWKDLSYDFRVPDDPSSLKNKSEESIQDNEXXXX 126
           IQQH+SGSKGV+++ NVEK K+YN+IQWK LS+D+++P+   S KN+    I+ ++    
Sbjct: 72  IQQHISGSKGVFVVQNVEKPKSYNVIQWKHLSHDYKLPEGRHSAKNEDSSGIEPHQQSNK 131

Query: 127 XXXXXXGIKLKNCDSATEEDFQNFMKEYNAENIRDFDDEERLKFLESYYWKTLNFTTPLY 186
                  ++ K  DS T +DF+ F + +N +++  FDDE+R++FLESYYWKTLNFT P+Y
Sbjct: 132 -------VRSKCLDSFTLDDFEKFRENFNCDHLEQFDDEQRVEFLESYYWKTLNFTEPMY 184

Query: 187 GADSSGSIFPSDLEEWNVAKLPNVLSHIDQDIPGVNQAYLYAGLWKASFTWHLEDQDLYS 246
           GADS GS+F   ++EWN++ LP++L ++D+ +PGVN++YLYAGLWKASF WHLEDQDLYS
Sbjct: 185 GADSLGSLFEDSVKEWNISSLPSILEYLDEKVPGVNESYLYAGLWKASFAWHLEDQDLYS 244

Query: 247 INYIHFGAPKQWYSIPQEDHEKFYEFMKEKFPEEASKCKEFLRHKMFLVSPKVLKENNIK 306
           INYIHFGAPKQWYSIPQED EKFY FMKE+FPEE+  C EFLRHKMFLVSPK+L+ N I+
Sbjct: 245 INYIHFGAPKQWYSIPQEDSEKFYNFMKEQFPEESKNCSEFLRHKMFLVSPKLLQSNGIR 304

Query: 307 CNKVTHYEHEFIITYPYGYHAGFNYGYNLAESVNFALEDWLEIGKKAGKCRCISDSVEVD 366
           CN + H + EFI+TYP+GYHAGFNYGYNLAESVNFAL  WL+IG KA KC CI D+V ++
Sbjct: 305 CNHIVHRQQEFIVTYPFGYHAGFNYGYNLAESVNFALPSWLDIGAKAKKCLCIDDAVGIN 364

Query: 367 VDKLAENW 374
           V KL  N+
Sbjct: 365 VQKLRSNY 372

 Score =  157 bits (398), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 96/231 (41%), Positives = 121/231 (52%), Gaps = 60/231 (25%)

Query: 730 FIKRLKSPNIVTLNISREGSKSPVSLQNEVRSPLGLNTTLSYPIPTEKQLSNLNPVNNSN 789
           FIKR++SPN VTLNISRE S+SPVSL     +P  +   + +P                 
Sbjct: 639 FIKRIQSPNRVTLNISRESSRSPVSLSGMYGNPNAMMVPIPHP----------------- 681

Query: 790 YQAASPALMDDKNNINPNQNMNSLLDMGLSAFQNSPSNGLRQISSETYESSPLMSLAAAA 849
                                          +Q+S ++ L Q+S  T E SP ++   + 
Sbjct: 682 -------------------------------YQSSQTSTLNQVS--TAERSPAVTPPTSP 708

Query: 850 NKDIELTNSMMRPSRSKTKLPTDKA--RSKSKSVEAQGPKFEKGEVILSDSGKIYVCQEC 907
           +K+        +P+R K               S  AQ    ++  + L D  K+YVCQEC
Sbjct: 709 SKN--------KPARKKAPKQPKAKIDPESPTSALAQSKINDEEIMFLDDGSKVYVCQEC 760

Query: 908 KRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIPCIP 958
            RQFSSGHHLTRHKKSVHSGEKPHSCPKCGK+FKRRDHVLQHLNKKIPC+P
Sbjct: 761 ARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPCVP 811

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 34/36 (94%)

Query: 536 NQSIQRMSSPILSKMIDLSNIVEPTLDDPTLKFKRK 571
           N SI R+SSP+LS+M+DLS+IVEPTL+DPTLKFK+K
Sbjct: 483 NTSISRVSSPLLSRMMDLSHIVEPTLEDPTLKFKKK 518

>Scas_76.1
          Length = 228

 Score =  253 bits (647), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 121/226 (53%), Positives = 159/226 (70%), Gaps = 21/226 (9%)

Query: 80  ISNVEKNKTYNMIQWKDLSYDFRVPD-----DPS-----------SLKNKSEESIQDNEX 123
           + NVEKNK YN+IQWKDLS+D++ P+     DPS           S+  +  E   ++E 
Sbjct: 1   VQNVEKNKIYNIIQWKDLSHDYKPPEGSSSTDPSTKGMNTRSRNASVGEEDAEHETNSEH 60

Query: 124 XXXXXXXX-----XGIKLKNCDSATEEDFQNFMKEYNAENIRDFDDEERLKFLESYYWKT 178
                          IKL+N ++ T EDF+ F+  YN EN+    +  RL+FLESYYW+T
Sbjct: 61  VTQKKKSQSPMKSSKIKLRNHENFTLEDFEEFLPSYNCENLSQLTEPSRLEFLESYYWRT 120

Query: 179 LNFTTPLYGADSSGSIFPSDLEEWNVAKLPNVLSHIDQDIPGVNQAYLYAGLWKASFTWH 238
           LNFTTP+YGAD+ GS+F   L+ WNV++LPN+L H+D+ +PGVN +YLYAGLWKASF WH
Sbjct: 121 LNFTTPMYGADTLGSLFNDKLDTWNVSRLPNLLDHMDRRLPGVNDSYLYAGLWKASFAWH 180

Query: 239 LEDQDLYSINYIHFGAPKQWYSIPQEDHEKFYEFMKEKFPEEASKC 284
           LEDQDLYSINY+HFGAPKQWYSIPQ+D  KFY+FM+++FPE+A+K 
Sbjct: 181 LEDQDLYSINYLHFGAPKQWYSIPQQDSHKFYKFMQDQFPEDAAKL 226

>YDR096W (GIS1) [946] chr4 (637133..639817) DNA damage-responsive
           repressor of PHR1, has two tandem C2H2-type zinc finger
           domains [2685 bp, 894 aa]
          Length = 894

 Score =  261 bits (668), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 134/364 (36%), Positives = 201/364 (55%), Gaps = 51/364 (14%)

Query: 1   MEVVDGVPVFRPAWEEFKDFMGYMEKIRPHGMASGIVKVIPPREWLDRAGREPREDLLRE 60
           +EV+DGVPVF+P+  EF +F  ++++I   G+ +GIVKVIPP+EWL+     P  + L+ 
Sbjct: 6   VEVIDGVPVFKPSMMEFANFQYFIDEITKFGIENGIVKVIPPKEWLELLEGSPPAESLKT 65

Query: 61  VRIRNPIQQHVS----GSKGVYMISNVEKNKTYNMIQWKDL--SYDFRVPDDPSSLKNKS 114
           +++ +PIQQ          GV+ I N   NK+YN+ QWK+L  S D R+          S
Sbjct: 66  IQLDSPIQQQAKRWDKHENGVFSIENEYDNKSYNLTQWKNLAESLDSRI----------S 115

Query: 115 EESIQDNEXXXXXXXXXXGIKLKNCDSATEEDFQNFMKEYNAENIRDFDDEERLKFLESY 174
           +    D                +NC   +++D                 D  +L+ LES 
Sbjct: 116 QGDFNDKTLK------------ENCRVDSQQDCY---------------DLAQLQILESD 148

Query: 175 YWKTLNFTTPLYGADSSGSIFPSDLEEWNVAKLPNVLSHIDQDIPGVNQAYLYAGLWKAS 234
           +WKT+ F+ P Y  D + SIFP DL  WN+  LP+ ++  ++         L  G  K  
Sbjct: 149 FWKTIAFSKPFYAVDENSSIFPYDLTLWNLNNLPDSINSSNRR--------LLTGQSKCI 200

Query: 235 FTWHLEDQDLYSINYIHFGAPKQWYSIPQEDHEKFYEFMKEKFPEEASKCKEFLRHKMFL 294
           F WHL++Q+  SINY+HFGAPKQWYSIP  + ++F + + ++       C  F+RH+  +
Sbjct: 201 FPWHLDEQNKCSINYLHFGAPKQWYSIPSANTDQFLKILSKEPSSNKENCPAFIRHQNII 260

Query: 295 VSPKVLKENNIKCNKVTHYEHEFIITYPYGYHAGFNYGYNLAESVNFALEDWLEIGKKAG 354
            SP  L++NNIK N+V  ++HEFIIT+PY  ++GFNYGYN  ES+ F L+    + K+  
Sbjct: 261 TSPDFLRKNNIKFNRVVQFQHEFIITFPYCMYSGFNYGYNFGESIEFILDQQAVVRKQPL 320

Query: 355 KCRC 358
           KC C
Sbjct: 321 KCGC 324

 Score =  172 bits (435), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 130/231 (56%), Gaps = 29/231 (12%)

Query: 731 IKRLKSPNIVTLNISREGSKSPVS-LQNEVRSPLGLNTTLSYPIPTEKQLSNLNPVNNSN 789
           I  LK  N+VTLNISRE SKSP+S   N+ RSPLG++  L Y        S +N  +N  
Sbjct: 676 IPFLKRNNVVTLNISREASKSPISSFVNDYRSPLGVSNPLMYS-------STINDYSNGT 728

Query: 790 YQAASPALMDDKNNINPNQNMNSLLDMG--LSAFQNSPS--NGLRQISSETYESSPLMSL 845
                  +  + NNINP       LD G   S     P   NG    + ++         
Sbjct: 729 ------GIRQNSNNINP-------LDAGPSFSPLHKKPKILNGNDNSNLDSNN----FDY 771

Query: 846 AAAANKDIELTNSMMRPSRSKTKLPTDKARSKSKSVEAQGPKFEKGEVILSDSGKIYVCQ 905
           +   NK     + +   + +     T    +   + +A   KF + EVI+SD GKIY+C+
Sbjct: 772 SFTGNKQESNPSILNNNTNNNDNYRTSSMNNNGNNYQAHSSKFGENEVIMSDHGKIYICR 831

Query: 906 ECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIPC 956
           EC RQFSSGHHLTRHKKSVHSGEKPHSCP+CGKRFKRRDHVLQHLNKKIPC
Sbjct: 832 ECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKKIPC 882

 Score = 82.8 bits (203), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 76/126 (60%), Gaps = 17/126 (13%)

Query: 465 SNPATNIKMESNKTK----IEANVPGVAKKLRGFDELLNRSPQNSPRMETSLKNDPFFA- 519
           S P +N+  +SN+++    I  N   + +K+R FDELLN S Q    +E +   +P F+ 
Sbjct: 333 SGPFSNLSYDSNESEQRGSITDNDNDLFQKVRSFDELLNHSSQELQNLEDN--KNPLFSN 390

Query: 520 ------RDSPLRSNSP-GTNLFFNQ---SIQRMSSPILSKMIDLSNIVEPTLDDPTLKFK 569
                 + S LRS +P G N F N    +I R+SSP+LS+M+DLSNIVEPTLDDP  KFK
Sbjct: 391 INMNRPQSSSLRSTTPNGVNQFLNMNQTTISRISSPLLSRMMDLSNIVEPTLDDPGSKFK 450

Query: 570 RKTNLP 575
           RK   P
Sbjct: 451 RKVLTP 456

>ABR167C [760] [Homologous to ScYJR119C - SH] (714425..716755) [2331
           bp, 776 aa]
          Length = 776

 Score =  124 bits (312), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 91/295 (30%), Positives = 133/295 (45%), Gaps = 54/295 (18%)

Query: 146 DFQNFMKEYNAENIRDFDDEERLKFLESYYWKTL----NFTTPLYGAD----SSGSIFPS 197
           +F++   EY+A++  +    + +  LE  +W  +    N  T  YGAD      G +   
Sbjct: 306 EFKSQCAEYDAKHFPEGKPLDNIGLLEDMFWDLVHDVENRATVKYGADIHNEGPGVVTAF 365

Query: 198 DLEEW-----------------------NVAKLP----NVLSHIDQDIPGVNQAYLYAGL 230
              EW                       N+  LP    ++L    + I G+   +LY G 
Sbjct: 366 PTLEWVPPHITKGTPEYDAFLQYVEHPMNLLNLPMARGSLLPVFGRSISGMTVPWLYIGS 425

Query: 231 WKASFTWHLEDQDLYSINYIHFGAPKQWYSIPQEDHEKFYEFMKEKFPEEASKCKEFLRH 290
             ++F WHLEDQ   S NY H G PK WYSIP++    F + MK   P+   K  + +  
Sbjct: 426 TFSTFCWHLEDQYTLSANYQHEGDPKVWYSIPEQSATAFNKLMKNIAPDLFEKQPDLMHQ 485

Query: 291 KMFLVSP--KVLKENNIKCNKVTHYEHEFIITYPYGYHAGFNYGYNLAESVNFALEDWLE 348
            + L+SP  +  +  NI C K   Y  E+IITYP  YHAGFN GYN  E+VNF L+ W+ 
Sbjct: 486 LVTLISPYDEKFEAANIACYKAVQYPGEYIITYPKCYHAGFNTGYNFNEAVNFTLDLWVP 545

Query: 349 IGKKA-------GKCRCISDSVEVDVDKLAENWSNFKKKREIEDPETEDSPQKKR 396
            G  A       GK RC+ D  E+ ++ L +          +E P+T      +R
Sbjct: 546 YGLSASEDYRLTGK-RCVFDMWELMLNVLLQY---------LERPQTHQEALIRR 590

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 28/43 (65%), Gaps = 2/43 (4%)

Query: 3  VVDGVPVFRPAWEEFKDFMGYMEK--IRPHGMASGIVKVIPPR 43
          ++  VPV  P  +EF+D +GY+ K  ++  G   G+VK++PPR
Sbjct: 5  MLQNVPVLHPTEDEFRDPIGYLSKAAVQRLGHVYGMVKLVPPR 47

>Kwal_55.21855
          Length = 521

 Score =  122 bits (306), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 91/293 (31%), Positives = 135/293 (46%), Gaps = 52/293 (17%)

Query: 147 FQNFMKEYNAENIRDFDDEERLKFLESYYWK---TLNFTTPL-YGAD------------S 190
           FQ   ++Y+     + D  + LK +E  +W+    ++ + P+ YGAD             
Sbjct: 53  FQEMCRDYDRGLWPNGDKLKDLKKIEDLFWERVYQIDKSDPIRYGADIHNVGPGEMTGFP 112

Query: 191 SGSIFPSDLEE---------------WNVAKLPN----VLSHIDQDIPGVNQAYLYAGLW 231
           + S  PS + E                N+  LP+    +LS   + I G+   ++Y G  
Sbjct: 113 TNSYIPSPIREDEEKLQQYQKYVEHPMNLVNLPSAKGSLLSVFGKKISGMTVPWIYIGST 172

Query: 232 KASFTWHLEDQDLYSINYIHFGAPKQWYSIPQEDHEKFYEFMKEKFPEEASKCKEFLRHK 291
            ++F WHLEDQ   S N+ H G PK WYSIP    +KF   M++  P+   K  + L   
Sbjct: 173 FSTFCWHLEDQYTLSANFQHEGDPKVWYSIPGSSCDKFNTLMRQMAPDLFQKQPDLLHQL 232

Query: 292 MFLVSP--KVLKENNIKCNKVTHYEHEFIITYPYGYHAGFNYGYNLAESVNFALEDWLEI 349
           + L++P     K+  I C K   Y  E+IIT+P  YH+GFN GYN  E+VNF L+ WL  
Sbjct: 233 VTLIAPYDSAFKDAKISCYKAIQYPGEYIITFPKCYHSGFNTGYNFNEAVNFTLDLWLPY 292

Query: 350 GKKA------GKCRCISDSVEVDVDKLAENWSNFKKKREIEDPETEDSPQKKR 396
           G +A       K RC+ D  E+ +  L E          +EDP   D    +R
Sbjct: 293 GIEATHDYIESKKRCVFDMWELMLTVLVEY---------LEDPTLFDEALIRR 336

>KLLA0D10758g 917125..919677 similar to sp|P47156 Saccharomyces
           cerevisiae YJR119c, start by similarity
          Length = 850

 Score =  121 bits (303), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 65/155 (41%), Positives = 86/155 (55%), Gaps = 6/155 (3%)

Query: 202 WNVAKLP----NVLSHIDQDIPGVNQAYLYAGLWKASFTWHLEDQDLYSINYIHFGAPKQ 257
           WN+  LP    ++LS I++ I G+   ++Y G   ++F WHLEDQ   S NY H G+ K 
Sbjct: 450 WNLINLPRARGSLLSIINRKISGMTIPWIYVGSTFSTFCWHLEDQYTLSANYQHIGSQKI 509

Query: 258 WYSIPQEDHEKFYEFMKEKFPEEASKCKEFLRHKMFLVSP--KVLKENNIKCNKVTHYEH 315
           WYSIP+     F E MK   P+   +  + L   + LVSP  K   E  I C K      
Sbjct: 510 WYSIPERSTSAFDEMMKNISPDLFERQPDLLHQLITLVSPYSKRFVEAGIDCYKAIQNPG 569

Query: 316 EFIITYPYGYHAGFNYGYNLAESVNFALEDWLEIG 350
           E+I+TYP  YHAGFN G+N  E+VNF L+ WL  G
Sbjct: 570 EYIVTYPKCYHAGFNSGFNFNEAVNFTLDLWLPYG 604

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (65%), Gaps = 2/41 (4%)

Query: 7  VPVFRPAWEEFKDFMGYME--KIRPHGMASGIVKVIPPREW 45
          +P  RP+ E+F D +G++   +++  GM  G++K+IPP  +
Sbjct: 4  IPTLRPSEEQFLDPIGFLSSNEVKKLGMKYGMIKLIPPESF 44

>Sklu_2303.6 YJR119C, Contig c2303 8969-11356
          Length = 795

 Score =  119 bits (298), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 71/187 (37%), Positives = 99/187 (52%), Gaps = 14/187 (7%)

Query: 203 NVAKLP----NVLSHIDQDIPGVNQAYLYAGLWKASFTWHLEDQDLYSINYIHFGAPKQW 258
           N+  LP    ++L    + I G+   ++Y G   ++F WHLEDQ   S NY H G PK W
Sbjct: 411 NLLNLPQAKGSLLPVFGKKISGMTVPWIYIGSTFSTFCWHLEDQYTLSANYQHEGDPKVW 470

Query: 259 YSIPQEDHEKFYEFMKEKFPEEASKCKEFLRHKMFLVSP--KVLKENNIKCNKVTHYEHE 316
           YSIP+   +KF   MK+  P+   K  + L   + L+SP  K  ++  I C K      E
Sbjct: 471 YSIPEHSCDKFNRLMKDIAPDLFEKQPDLLHQLITLISPYDKRFQQAKISCYKALQKPGE 530

Query: 317 FIITYPYGYHAGFNYGYNLAESVNFALEDWLEIG-------KKAGKCRCISDSVEVDVDK 369
           +IIT+P  YHAGFN GYN  E+VNF L+ WL  G       K  GK +C+ D  E+ ++ 
Sbjct: 531 YIITFPKCYHAGFNTGYNFNEAVNFTLDTWLPYGIEACQDYKDTGK-QCVFDMWELMLNV 589

Query: 370 LAENWSN 376
           L +   N
Sbjct: 590 LIQYLEN 596

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 30/47 (63%), Gaps = 2/47 (4%)

Query: 1  MEVVDGVPVFRPAWEEFKDFMGYMEK--IRPHGMASGIVKVIPPREW 45
          M  ++ VPV  P  +EF+D + Y+ +  ++  G   G++K++PPRE+
Sbjct: 1  MTSLEEVPVLYPTLQEFEDPISYLSQPQVQRQGHICGMIKLVPPREF 47

>CAGL0H00528g 52511..54733 similar to sp|P47156 Saccharomyces
           cerevisiae YJR119c, hypothetical start
          Length = 740

 Score =  116 bits (290), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 68/189 (35%), Positives = 107/189 (56%), Gaps = 17/189 (8%)

Query: 182 TTPLYGAD------SSGSIFPSDLEEW-----NVAKLP----NVLSHIDQDIPGVNQAYL 226
           TT  YGAD      +  + FP++ + +     N+  LP    ++L  ++++I G+   ++
Sbjct: 358 TTVPYGADIHSEDPAELTGFPTNDKTYSTHPMNLLNLPQASSSLLPFLNRNISGMTIPWI 417

Query: 227 YAGLWKASFTWHLEDQDLYSINYIHFGAPKQWYSIPQEDHEKFYEFMKEKFPEEASKCKE 286
           Y G   ++F WHLEDQ   S NY H G+PK WYSIP    + F++ + +  P+   K  +
Sbjct: 418 YVGSKFSTFCWHLEDQYTLSANYQHEGSPKVWYSIPDNSCDNFHKLLHDLTPDLFEKQPD 477

Query: 287 FLRHKMFLVSPK--VLKENNIKCNKVTHYEHEFIITYPYGYHAGFNYGYNLAESVNFALE 344
            L   + L+SP   + K+ N+K  K   + +E+I+T+P  YHAGFN GYN+ E+VNF  E
Sbjct: 478 LLHQLVSLISPYDPLFKKYNVKWYKAVQHPNEYIVTFPKCYHAGFNTGYNINEAVNFTSE 537

Query: 345 DWLEIGKKA 353
            WL  G +A
Sbjct: 538 SWLPYGLEA 546

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 2/38 (5%)

Query: 7  VPVFRPAWEEFKDFMGYMEK--IRPHGMASGIVKVIPP 42
          VPV  P  EEF D + Y+ +  +R  G   G+V+++PP
Sbjct: 6  VPVVYPTEEEFADPIDYLNQPALRRLGKVYGMVRIVPP 43

>Scas_691.27
          Length = 735

 Score =  108 bits (271), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 83/265 (31%), Positives = 123/265 (46%), Gaps = 37/265 (13%)

Query: 147 FQNFMKEYNAENIRDFDDEERLKFLESYYWKTLN--------FTTPLYGADSSGSI---- 194
            QNF+ E   +  +  D       LE  +W+ +N         +  +YGAD   S     
Sbjct: 316 LQNFINECEEDTSKSIDQ------LEKEFWEKVNDNSISNNPSSLIMYGADIHNSEQISG 369

Query: 195 FP---SDLEE---------WNVAKLPNVLSHI-----DQDIPGVNQAYLYAGLWKASFTW 237
           FP     LE+          N+  LPN L  +     ++ I G+   ++Y G   ++F W
Sbjct: 370 FPLSNHALEKGSSKYVSHPMNLVNLPNALGSLLPLLSNKTISGMTIPWIYVGSTFSTFCW 429

Query: 238 HLEDQDLYSINYIHFGAPKQWYSIPQEDHEKFYEFMKEKFPEEASKCKEFLRHKMFLVSP 297
           H+EDQ   S NY H GA K WYSIP    E F + +    P+   K ++ +   + LVSP
Sbjct: 430 HMEDQYTLSANYQHEGASKIWYSIPASSCEPFQKLLHSMTPDLFIKQQDLIHQLVSLVSP 489

Query: 298 KVLKENNIKCNKVTHYEHEFIITYPYGYHAGFNYGYNLAESVNFALEDWLEIGKKA-GKC 356
             L + +I C K     +E+IIT+P  +H+GFN GYNL E+VNF    WL  G +A    
Sbjct: 490 YDLPK-SINCYKAIQNPNEYIITFPKCFHSGFNTGYNLNEAVNFTTPFWLPFGVEAVDDY 548

Query: 357 RCISDSVEVDVDKLAENWSNFKKKR 381
           +        DV++L  N   +  K+
Sbjct: 549 KLTQRKCAFDVNELLLNLIKYMNKK 573

>YJR119C (YJR119C) [3011] chr10 complement(644219..646405) Protein
           containing a PHD-finger and jumonji (jmjN) and jumonji
           (jmjC) domains, has low similarity to a region of
           selected mouse cDNA on the Y homolog (human SMCY), which
           is a male-specific protein that elicits transplant
           rejection in female recipients [2187 bp, 728 aa]
          Length = 728

 Score =  107 bits (266), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 95/180 (52%), Gaps = 12/180 (6%)

Query: 203 NVAKLP----NVLSHIDQDIPGVNQAYLYAGLWKASFTWHLEDQDLYSINYIHFGAPKQW 258
           N+  LP    ++L    ++I G+   ++Y G   ++F WH+EDQ   S NY H G PK W
Sbjct: 388 NLTNLPMAHNSLLPLFKRNISGMTIPWIYIGSLFSTFCWHMEDQYTLSANYQHEGDPKVW 447

Query: 259 YSIPQEDHEKFYEFMKEKFPEEASKCKEFLRHKMFLVSPKV--LKENNIKCNKVTHYEHE 316
           YSIP+    KF + + +  P+   K  + L   + L+SP     K++ I   K     +E
Sbjct: 448 YSIPESGCTKFNDLLNDMSPDLFIKQPDLLHQLVTLISPYDPNFKKSGIPVYKAVQKPNE 507

Query: 317 FIITYPYGYHAGFNYGYNLAESVNFALEDWLEIG------KKAGKCRCISDSVEVDVDKL 370
           +IIT+P  YHAGFN GYN  E+VNF ++ WL  G       K  +  C+ D  ++ ++ L
Sbjct: 508 YIITFPKCYHAGFNTGYNFNEAVNFTIDFWLPYGFGAITDYKLTQKACVFDMFDLMINVL 567

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 25/41 (60%), Gaps = 2/41 (4%)

Query: 4  VDGVPVFRPAWEEFKDFMGYME--KIRPHGMASGIVKVIPP 42
          ++ +P   P  +EFK+ + Y+    I+  G+  G+VKV+PP
Sbjct: 1  MEEIPALYPTEQEFKNPIDYLSNPHIKRLGVRYGMVKVVPP 41

>CAGL0G08107g 768772..770649 weakly similar to tr|Q03833
           Saccharomyces cerevisiae YDR096w GIS1 DNA
           damage-responsive repressor of PHR1, hypothetical start
          Length = 625

 Score = 88.6 bits (218), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 41/79 (51%), Positives = 52/79 (65%), Gaps = 1/79 (1%)

Query: 878 SKSVEAQGPKFEKGEVILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCG 937
           SK+VE+ G  F   ++  SD  K + C+ C   F S +HL RH+ SVHS EKP++CP C 
Sbjct: 539 SKNVESLGQIFN-SKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICS 597

Query: 938 KRFKRRDHVLQHLNKKIPC 956
           K FKR+DHV QHL KK PC
Sbjct: 598 KGFKRKDHVSQHLKKKTPC 616

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 45/100 (45%)

Query: 237 WHLEDQDLYSINYIHFGAPKQWYSIPQEDHEKFYEFMKEKFPEEASKCKEFLRHKMFLVS 296
           W ++  + Y + +  FG P QWY +   + +    ++K+  P+ +  C  F  HK +   
Sbjct: 194 WRIDTVNQYHLIFNLFGTPIQWYIVEGCNRDSLISYLKKLEPKGSETCNAFYIHKKYCFG 253

Query: 297 PKVLKENNIKCNKVTHYEHEFIITYPYGYHAGFNYGYNLA 336
           P  L+  NI    +     +  I+ P      F+YGY++ 
Sbjct: 254 PDFLERANIPYKTMVQESGKLFISKPGTCFFVFHYGYSIV 293

>Scas_709.32
          Length = 822

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 52/113 (46%), Gaps = 12/113 (10%)

Query: 850 NKDIELTNSMMRPSRSKTKLPTDKARSKSKSVEAQGPKFEKGEVI------------LSD 897
           N  I   N++  P ++K +  +    S      +Q P    G+               SD
Sbjct: 701 NTKITQNNNVTAPPKNKNRRKSAIVTSSQLKGNSQSPPLLNGQKATTTTAKRSVSYNFSD 760

Query: 898 SGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
             K + C+ C + F    HL RH +SVHS E+P +CP C K+F R D++ QH+
Sbjct: 761 ENKTFKCETCGKAFRRSEHLKRHIRSVHSSERPFACPTCDKKFSRSDNLAQHI 813

>Scas_602.9
          Length = 547

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 37/57 (64%)

Query: 894 ILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           +L D+ K + C  C+R+F    HL RH +S+H GEKP++C  C K F R D++ QH+
Sbjct: 487 LLPDATKQFACDYCERRFKRQEHLKRHVRSLHIGEKPYACHICNKNFSRSDNLTQHI 543

>CAGL0E04884g complement(469295..473764) weakly similar to sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1489

 Score = 66.6 bits (161), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (71%), Gaps = 1/53 (1%)

Query: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNK 952
           +++VCQ C R F+   HLTRH++S H+ EKP+ C  C +RF RRD +L+H +K
Sbjct: 28  RLFVCQTCTRAFARQEHLTRHERS-HTKEKPYCCGICDRRFTRRDLLLRHAHK 79

>CAGL0L06072g complement(679924..680826) some similarities with
           sp|P39959 Saccharomyces cerevisiae YER130c or sp|P33749
           Saccharomyces cerevisiae YKL062w MSN4 transcriptional
           activator, hypothetical start
          Length = 300

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (62%)

Query: 894 ILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 949
           +L D  KI+ C  C+R+F    HL RH  S+H GE+P+SC  C K F R D++ QH
Sbjct: 210 LLFDDAKIFKCDMCERRFKRQEHLKRHVSSLHMGERPYSCDICLKSFSRSDNLNQH 265

>Scas_707.31
          Length = 289

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 53/107 (49%), Gaps = 7/107 (6%)

Query: 845 LAAAANKDIELTNSMMRPSRSKTKLPTDKARSKSK-SVEAQGPKFEKGEVILSDSGKIYV 903
           + A ++ D  L+N  ++PS +   +P      K +  V  + P       IL D  K Y 
Sbjct: 171 VTAPSSVDSVLSNDWLKPSTNLATMPVGFYYEKDQPKVRGRKPS------ILPDDSKQYF 224

Query: 904 CQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           C  CK++F    HL RH +++H   +P  C  C KRF R D++ QH+
Sbjct: 225 CHLCKKRFKRHEHLKRHFRTIHLRVRPFECSVCHKRFSRNDNLNQHV 271

>Sklu_2181.1 YER130C, Contig c2181 4015-5247
          Length = 410

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 36/54 (66%)

Query: 897 DSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           D+ K + C+ C R+F    HL RH +S+H GEKP+ C  CGK+F R D++ QH+
Sbjct: 349 DASKQFGCEFCDRRFKRQEHLKRHVRSLHMGEKPYGCEICGKKFSRSDNLNQHI 402

>AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C
           (NRG2) - SH] complement(769926..770348) [423 bp, 140 aa]
          Length = 140

 Score = 60.5 bits (145), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 3/50 (6%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH 949
           ++CQ C + F++  HL RH + +H+GEK H+C  P CG+RF R D+ LQH
Sbjct: 80  HLCQTCGKGFTTSGHLARHNR-IHTGEKNHACHFPGCGQRFSRHDNCLQH 128

>Sklu_2443.22 , Contig c2443 45390-46027
          Length = 213

 Score = 62.4 bits (150), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 54/98 (55%), Gaps = 1/98 (1%)

Query: 855 LTNSMMRPSRSKTKLPTDKARSKSKSVEAQGPKFEKGEVILSDSGKIYVCQECKRQFSSG 914
           +T + + PS S + L +++    S +++   P   K   I +D  + ++C  C R F+  
Sbjct: 1   MTTASITPSNSGSALNSNEVTPTSSAIQGIMPIPRKSRTIKTDKPRPFLCPICTRGFARQ 60

Query: 915 HHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNK 952
            HL RH++S H+ EKP  C  CG+ F RRD VL+H  K
Sbjct: 61  EHLKRHQRS-HTNEKPFLCAFCGRCFARRDLVLRHQQK 97

>Kwal_47.17241
          Length = 403

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 34/54 (62%)

Query: 897 DSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           D+ K + C  C R+F    HL RH +S+H GEKP  C  CGK+F R D++ QH+
Sbjct: 341 DASKQFACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHICGKKFSRSDNLNQHI 394

>ACL057W [992] [Homologous to ScYER130C - SH]
           complement(264934..266496) [1563 bp, 520 aa]
          Length = 520

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 37/54 (68%)

Query: 897 DSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           D+ K + C+ C+R+F    HL RH +S+H GEKP+ C  CGK+F R D++ QH+
Sbjct: 455 DATKPFGCEYCERRFKRQEHLKRHIRSLHMGEKPYGCDICGKKFSRSDNLNQHI 508

>Scas_649.28
          Length = 730

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 68/148 (45%), Gaps = 5/148 (3%)

Query: 806 PNQNMNSLLDMGLSAFQNSPSNGLRQISSETYESSPLMSLAAAANKDIELTNSMMRPSRS 865
           PN   NS  +  +S   +SP +     SS +  +SP+ ++          ++  + P R 
Sbjct: 576 PNMTENSTQNYDISL--SSPIDLQNAFSSLSSMASPIPNILPTTASSATGSSKQINPRRR 633

Query: 866 KTKLPTDKARSKSKSVEAQGPKFEKGEVI---LSDSGKIYVCQECKRQFSSGHHLTRHKK 922
           K+ +      + S +  A   +     V    L D  K + C EC + F    HL RH +
Sbjct: 634 KSSISPTSPHNNSNNSTAHTSRRASVSVTPGSLDDKNKPFKCSECIKAFRRSEHLKRHIR 693

Query: 923 SVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           SVHS E+P +C  C K+F R D++ QHL
Sbjct: 694 SVHSSERPFACMFCEKKFSRSDNLSQHL 721

>KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 474

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 35/54 (64%)

Query: 897 DSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           D+ K + C+ C R+F    HL RH +S+H  EKP+ C  CGK+F R D++ QHL
Sbjct: 413 DASKPFGCEYCDRRFKRQEHLKRHIRSLHICEKPYGCHLCGKKFSRSDNLSQHL 466

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 17/28 (60%)

Query: 929 KPHSCPKCGKRFKRRDHVLQHLNKKIPC 956
           KP  C  C +RFKR++H+ +H+     C
Sbjct: 416 KPFGCEYCDRRFKRQEHLKRHIRSLHIC 443

>AGR172W [4483] [Homologous to ScYDR216W (ADR1) - SH]
           complement(1071491..1074664) [3174 bp, 1057 aa]
          Length = 1057

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 36/53 (67%), Gaps = 1/53 (1%)

Query: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNK 952
           +++VC  C R F+   HL RHK+S H+ EKP+ C  C +RF RRD +L+H +K
Sbjct: 47  RLFVCHTCTRAFARQEHLIRHKRS-HTNEKPYICGICDRRFSRRDLLLRHAHK 98

>Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement
          Length = 157

 Score = 58.9 bits (141), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 3/50 (6%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKRFKRRDHVLQH 949
           YVC+ C R F++  HL RH + +H+GEK H CP   CG+RF R D+ +QH
Sbjct: 100 YVCKICSRGFTTSGHLARHNR-IHTGEKNHVCPFEGCGQRFSRHDNCVQH 148

>YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger
           transcriptional activator for genes regulated through
           Snf1p, has strong similarity to Msn2p, has two tandem
           C2H2-type zinc fingers [1893 bp, 630 aa]
          Length = 630

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 51/98 (52%), Gaps = 5/98 (5%)

Query: 857 NSMMRPSRSKTKLPTDKARSKSKSVEAQGPKFEKGEVILS----DSGKIYVCQECKRQFS 912
           N+  R S S T  PT    + +  V  Q P+  K    +     D  K + C++C++ F 
Sbjct: 525 NTRRRKSSSVTLSPTISHNNNNGKVPVQ-PRKRKSITTIDPNNYDKNKPFKCKDCEKAFR 583

Query: 913 SGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
              HL RH +SVHS E+P +C  C K+F R D++ QHL
Sbjct: 584 RSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHL 621

>YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein with
           similarity to Adr1p and Yml081p, has two tandem zinc
           finger domains [4143 bp, 1380 aa]
          Length = 1380

 Score = 63.2 bits (152), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 41/73 (56%), Gaps = 1/73 (1%)

Query: 889 EKGEVILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQ 948
           +K  +I +D  + ++C  C R F    HL RH+ S H+ EKP+ C  CG+ F RRD VL+
Sbjct: 138 KKSRIIKTDKPRPFLCPTCTRGFVRQEHLKRHQHS-HTREKPYLCIFCGRCFARRDLVLR 196

Query: 949 HLNKKIPCIPGVG 961
           H  K    + G G
Sbjct: 197 HQQKLHAALVGTG 209

>Kwal_26.8351
          Length = 698

 Score = 62.8 bits (151), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 37/65 (56%)

Query: 886 PKFEKGEVILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDH 945
           P+  K    + +  K + CQEC + F    HL RH +SVHS E+P  C  C K+F R D+
Sbjct: 625 PRNSKSSSPVEEEEKPFKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDN 684

Query: 946 VLQHL 950
           + QHL
Sbjct: 685 LSQHL 689

>CAGL0K02145g 190055..191008 some similarities with sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 317

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 36/57 (63%)

Query: 894 ILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           ++ D  K + C+ C R+F    HL RH +S+H GEKP+ C  C K+F R D++ QH+
Sbjct: 256 LVPDLSKQFGCEFCDRRFKRQEHLKRHIRSLHMGEKPYECHICNKKFSRSDNLNQHI 312

>CAGL0M13189g complement(1294293..1295918) weakly similar to
           sp|P33749 Saccharomyces cerevisiae YKL062w MSN4
           transcriptional activator, hypothetical start
          Length = 541

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 34/58 (58%)

Query: 893 VILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           V L D  K + C +C + F    HL RH +SVHS E+P  C  C K+F R D++ QHL
Sbjct: 475 VELPDGAKPFQCADCDKAFRRSEHLKRHVRSVHSTERPFPCMFCEKKFSRSDNLSQHL 532

>KLLA0F13046g 1201353..1205492 some similarities with sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1379

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 46/86 (53%), Gaps = 1/86 (1%)

Query: 867 TKLPTDKARSKSKSVEAQGPKFEKGEVILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHS 926
           + LP     + +K  +          V  S   +++VC+ C R F+   HLTRH++S H+
Sbjct: 90  SSLPAKITNNTNKKFDMLPDHLRLNGVTPSGKPRLFVCKVCTRAFARQEHLTRHERS-HT 148

Query: 927 GEKPHSCPKCGKRFKRRDHVLQHLNK 952
            EKP+ C  C +RF RRD +++H  K
Sbjct: 149 KEKPYVCGICERRFTRRDLLIRHCQK 174

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 7/54 (12%)

Query: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 953
           K YVC  C+R+F+    L RH + +H G        CG   +R    ++  +KK
Sbjct: 151 KPYVCGICERRFTRRDLLIRHCQKLHGG-------NCGDYIRRTSRKVRRDSKK 197

>Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement
          Length = 548

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 35/55 (63%), Gaps = 3/55 (5%)

Query: 897 DSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH 949
           DS + YVC  C R F    H TRH ++ H+GEKPH+C  P CGKRF R D + +H
Sbjct: 29  DSPRPYVCPICSRAFHRLEHQTRHIRT-HTGEKPHACEFPGCGKRFSRSDELTRH 82

>Scas_703.23
          Length = 1341

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 889 EKGEVILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQ 948
           +K  VI +D  + ++C  C R F    HL RH++S H+ EKP  C  CG+ F RRD VL+
Sbjct: 59  KKSRVIKTDKPRPFLCPTCTRGFVRQEHLKRHQRS-HTNEKPFLCVFCGRCFARRDLVLR 117

Query: 949 HLNKKIPCIPG 959
           H +K    + G
Sbjct: 118 HQHKLHAALIG 128

>ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C
           (MSN2) - SH] (548266..549981) [1716 bp, 571 aa]
          Length = 571

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 34/56 (60%)

Query: 895 LSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           L +  K + CQEC + F    HL RH +SVHS ++P  C  C K+F R D++ QHL
Sbjct: 497 LEEEEKPFKCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTYCDKKFSRSDNLSQHL 552

>Scas_721.92
          Length = 1152

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 3/57 (5%)

Query: 898 SGK--IYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNK 952
           SGK  ++VC  C R F+   HL RH +S H+ EKP+ C  C K+F RRD +L+H  K
Sbjct: 72  SGKPRLFVCDVCSRAFARQEHLDRHARS-HTNEKPYQCGICTKKFTRRDLLLRHAQK 127

>AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -
           SH] (935544..939119) [3576 bp, 1191 aa]
          Length = 1191

 Score = 60.1 bits (144), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 43/79 (54%), Gaps = 1/79 (1%)

Query: 874 ARSKSKSVEAQGPKFEKGEVILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSC 933
           AR   +  +   P  +K   I +D  + ++C  C R F+   HL RH++S H+ EKP  C
Sbjct: 52  ARGGGREDDGIVPIPKKSRTIKTDKPRPFLCPVCTRGFARQEHLKRHQRS-HTNEKPFLC 110

Query: 934 PKCGKRFKRRDHVLQHLNK 952
             CG+ F RRD VL+H  K
Sbjct: 111 AFCGRCFARRDLVLRHQQK 129

>Kwal_47.16621
          Length = 1178

 Score = 60.1 bits (144), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 41/73 (56%), Gaps = 1/73 (1%)

Query: 880 SVEAQGPKFEKGEVILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKR 939
           S  A  P  +K   I +D  + ++C  C R F+   HL RH+++ H+ EKP  C  CG+ 
Sbjct: 56  STPATMPIPKKSRTIKTDRPRPFLCSICTRGFARQEHLKRHQRA-HTNEKPFLCAFCGRC 114

Query: 940 FKRRDHVLQHLNK 952
           F RRD VL+H  K
Sbjct: 115 FARRDLVLRHQQK 127

>YDR043C (NRG1) [896] chr4 complement(542670..543365)
           Transcriptional repressor involved in glucose repression
           of STA1 and MUC1, suppressor of snf mutations, has two
           tandem C2H2-type zinc fingers [696 bp, 231 aa]
          Length = 231

 Score = 57.4 bits (137), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 3/50 (6%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKRFKRRDHVLQH 949
           Y+C+ C R F++  HL RH + +H+GEK H CP   C +RF R D+ LQH
Sbjct: 174 YICKICARGFTTSGHLARHNR-IHTGEKNHCCPYKGCTQRFSRHDNCLQH 222

>YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger
           transcription factor involved in regulation of ADH2 and
           peroxisomal genes [3972 bp, 1323 aa]
          Length = 1323

 Score = 59.7 bits (143), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 76/138 (55%), Gaps = 8/138 (5%)

Query: 819 SAFQNSPSNGLRQISSETYESSPLMSLAAAANKDIELTNSMMRPSRSKTKLPTDKARSKS 878
           S F N  +N  ++I  ET + SP++ ++++A+++   T S+++ +    K+ T      S
Sbjct: 20  SCFSNGFNNEKQEIEMET-DDSPILLMSSSASRENSNTFSVIQRT-PDGKIITTNNNMNS 77

Query: 879 KSVEAQGPKFEKGEVI--LSDSGKI--YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCP 934
           K +  Q  K  +   +   + SGK+  +VC+ C R F+   HL RH +S H+ EKP+ C 
Sbjct: 78  K-INKQLDKLPENLRLNGRTPSGKLRSFVCEVCTRAFARQEHLKRHYRS-HTNEKPYPCG 135

Query: 935 KCGKRFKRRDHVLQHLNK 952
            C + F RRD +++H  K
Sbjct: 136 LCNRCFTRRDLLIRHAQK 153

>Kwal_56.24206
          Length = 1502

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 85/217 (39%), Gaps = 52/217 (23%)

Query: 191 SGSIFPSDLEEWNVAKLP----NVLSHIDQDIPGVNQAYLYAGLWKASFTWHLEDQDLYS 246
           SG   P  L  WN+  +     ++L ++D D        L  G+  +   W +ED  L S
Sbjct: 498 SGDSLPGALSPWNLNNVATSENSMLRYLDADFGNHLDTKLDIGMLFSVKGWSIEDNFLAS 557

Query: 247 INYIHFGAPKQWYSIPQEDHEKFYEFMK--EKFPEEAS-------KCKEFLR---HKMFL 294
           I+Y H G+ K WY IP +D EKF   ++  E  P++         + K+F +   ++ FL
Sbjct: 558 IHYHHVGSSKLWYVIPPQDMEKFERLIEFYESQPQDVESSYPNGVETKQFEKSEFYQSFL 617

Query: 295 ------------------------------------VSPKVLKENNIKCNKVTHYEHEFI 318
                                                 P+ LK++ I   KV      FI
Sbjct: 618 DTTPSRPTSMRPHRVNTHTLNKNFQSSNSTLANDWNFHPETLKDHGITVYKVVQDPRSFI 677

Query: 319 ITYPYGYHAGFNYGYNLAESVNFALEDWLEIGKKAGK 355
             +P  Y +  + G++++E   FA   WL I  +  K
Sbjct: 678 FRFPKSYSSNISSGFSVSEFALFAPTSWLGIAIEGEK 714

>KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1332

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 40/67 (59%), Gaps = 1/67 (1%)

Query: 886 PKFEKGEVILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDH 945
           P  +K  +I +D  + ++C  C R F+   HL RH++S H+ EKP  C  CG+ F RRD 
Sbjct: 67  PIPKKSRLIKTDRPRPFLCPICTRGFARQEHLRRHERS-HTNEKPFLCAFCGRCFARRDL 125

Query: 946 VLQHLNK 952
           VL+H  K
Sbjct: 126 VLRHQQK 132

>YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein
           with two tandem zinc finger domains [1332 bp, 443 aa]
          Length = 443

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 35/57 (61%)

Query: 894 ILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           ++ D+ K + C+ C R+F    HL RH +S+H  EKP +C  C K F R D++ QH+
Sbjct: 381 LIPDASKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHV 437

>YML081W (YML081W) [3888] chr13 (104777..108532) Protein with
           similarity to Zms1p and Adr1p, has two tandem C2H2-type
           zinc fingers [3756 bp, 1251 aa]
          Length = 1251

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 38/64 (59%), Gaps = 1/64 (1%)

Query: 889 EKGEVILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQ 948
           +K   I +D  + ++C  C R F    HL RH+++ H+ EKP  C  CG+ F RRD VL+
Sbjct: 48  KKSRTIKTDKPRPFLCHICTRGFVRQEHLKRHQRA-HTNEKPFLCVFCGRCFARRDLVLR 106

Query: 949 HLNK 952
           H +K
Sbjct: 107 HQHK 110

>KLLA0F26961g 2486804..2488888 some similarities with sp|P33748
           Saccharomyces cerevisiae YMR037c MSN2 stress responsive
           regulatory protein, hypothetical start
          Length = 694

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 31/51 (60%)

Query: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           K + C +C + F    HL RH +SVHS E+P  C  C K+F R D++ QHL
Sbjct: 619 KPFKCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQFCDKKFSRSDNLSQHL 669

>CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces
           cerevisiae YJR127c ZMS1 or sp|Q04545 Saccharomyces
           cerevisiae YML081w, hypothetical start
          Length = 1020

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 37/64 (57%), Gaps = 1/64 (1%)

Query: 889 EKGEVILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQ 948
           +K   + +D  + ++C  C R F    HL RH+ S H+ EKP  C  CGK F R+D VL+
Sbjct: 14  KKSRAVKTDKPRPFLCPICSRGFVRQEHLKRHQNS-HTHEKPFLCLICGKCFARKDLVLR 72

Query: 949 HLNK 952
           HL K
Sbjct: 73  HLQK 76

>Kwal_27.10925
          Length = 264

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 3/50 (6%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPK--CGKRFKRRDHVLQH 949
           YVC+ C + F++  HL RH + +H+GEK H CP   CG+RF R D+ +QH
Sbjct: 201 YVCKICVKGFTTSGHLARHNR-IHTGEKNHVCPHEGCGQRFSRHDNCVQH 249

>CAGL0K12078g complement(1168989..1170380) weakly similar to
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 463

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 55/101 (54%), Gaps = 8/101 (7%)

Query: 856 TNSMMRPSRSKTKLPTDKAR--SKSKSVEAQGPKFEKGEVILSDSGKI---YVCQECKRQ 910
           + S+  PS++K      K +   +S+  + Q  K     +  SD  ++   Y+C+ C + 
Sbjct: 351 SKSLTVPSKTKISASPQKHKKHGQSRKSKLQQKKHSISSLCNSDDIELRRKYLCKVCGKG 410

Query: 911 FSSGHHLTRHKKSVHSGEKPHSCP--KCGKRFKRRDHVLQH 949
           F++  HL RH + +H+GEK H CP   CG+RF R D+ LQH
Sbjct: 411 FTTSGHLARHNR-IHTGEKRHVCPYEGCGQRFNRHDNCLQH 450

>YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-finger
           transcriptional activator for genes involved in the
           multistress response, has two tandem C2H2-type zinc
           fingers [2115 bp, 704 aa]
          Length = 704

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 31/51 (60%)

Query: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           K + C  C + F    HL RH +SVHS E+P +C  C K+F R D++ QH+
Sbjct: 645 KPFHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHI 695

>AFL127C [3068] [Homologous to ScYMR176W (ECM5) - SH]
           (193474..198039) [4566 bp, 1521 aa]
          Length = 1521

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/203 (22%), Positives = 75/203 (36%), Gaps = 54/203 (26%)

Query: 199 LEEWNVAKLP----NVLSHIDQDIPGVNQAYLYAGLWKASFTWHLEDQDLYSINYIHFGA 254
           L+ WN+  +P    ++LS++D D   + +  ++ G+  ++  W L DQ L +I Y H G 
Sbjct: 541 LDPWNINNVPLAANSLLSYLDIDYGCLTRPKMHVGMTFSTRGWSLGDQYLPTIEYNHLGC 600

Query: 255 PKQWYSIPQEDHEKFYEFMKE--------------------------------------- 275
              WY I  E  E F + ++E                                       
Sbjct: 601 SLLWYFIAPESQEAFEKLVEEINLGKRDHPTDELDVDPEFKKSEFYNSYLETNMRNRLND 660

Query: 276 -----------KFPEEASKCKEFLRHKMFLVSPKVLKENNIKCNKVTHYEHEFIITYPYG 324
                       F + A   K +L      + P+ L++  IK          FII YP  
Sbjct: 661 THKLRSKNGSHMFGQAARGPKSYLLPNDIQIHPEELQKRGIKFYNAIQEAKTFIIKYPRA 720

Query: 325 YHAGFNYGYNLAESVNFALEDWL 347
           Y+     G++++ES   A E WL
Sbjct: 721 YNTSIAAGFHVSESCYLAPESWL 743

>CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1321

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 40/73 (54%), Gaps = 1/73 (1%)

Query: 885 GPKFEKGEVILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRD 944
            P  +K   I +D  + ++C  C R F    HL RH+++ H+ EKP  C  CG+ F RRD
Sbjct: 16  APIPKKSRTIKTDKPRPHLCPICTRGFVRLEHLKRHQRA-HTNEKPFLCVFCGRCFARRD 74

Query: 945 HVLQHLNKKIPCI 957
            VL+H  K  P +
Sbjct: 75  LVLRHQYKLHPTL 87

>CAGL0F05995g complement(598819..600612) some similarities with
           sp|P33748 Saccharomyces cerevisiae YMR037c MSN2,
           hypothetical start
          Length = 597

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 32/54 (59%)

Query: 897 DSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           D  K + C  C + F    HL RH +SVHS ++P SC  C K+F R D++ QH+
Sbjct: 530 DIDKPFGCHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHLCEKKFSRSDNLSQHI 583

>KLLA0F18524g complement(1701498..1702571) some similarities with
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1
           transcriptional repressor for glucose repression of STA1
           gene expression, hypothetical start
          Length = 357

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 3/50 (6%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH 949
           Y+C+ C R F++  HL RH + +H+GEK H C  P C +RF R D+ +QH
Sbjct: 284 YICKICSRGFTTSGHLARHNR-IHTGEKRHQCQFPGCNQRFSRHDNYIQH 332

>KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA
           Kluyveromyces lactis Regulatory protein MIG1, start by
           similarity
          Length = 474

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (61%), Gaps = 3/55 (5%)

Query: 897 DSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH 949
           D  + YVC  C+R F    H TRH ++ H+GE+PH+C  P C KRF R D + +H
Sbjct: 21  DGPRPYVCPICQRGFHRLEHQTRHIRT-HTGERPHACDFPGCSKRFSRSDELTRH 74

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 4/35 (11%)

Query: 920 HKKSVHS----GEKPHSCPKCGKRFKRRDHVLQHL 950
           HKKS++     G +P+ CP C + F R +H  +H+
Sbjct: 11  HKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHI 45

>CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces
           cerevisiae YGL035c MIG1 transcriptional repressor,
           hypothetical start
          Length = 424

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (61%), Gaps = 3/55 (5%)

Query: 897 DSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH 949
           D+ + +VC  C R F    H TRH ++ H+GEKPH+C  P C KRF R D + +H
Sbjct: 38  DAPRPHVCPICGRAFHRLEHQTRHMRT-HTGEKPHACDFPGCVKRFSRSDELTRH 91

 Score = 33.5 bits (75), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 15/22 (68%)

Query: 929 KPHSCPKCGKRFKRRDHVLQHL 950
           +PH CP CG+ F R +H  +H+
Sbjct: 41  RPHVCPICGRAFHRLEHQTRHM 62

>Scas_718.44
          Length = 266

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 3/50 (6%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKRFKRRDHVLQH 949
           +VC+ C   F++  HL+RH + +H+GEK HSCP   C ++F R D+ LQH
Sbjct: 210 HVCKICSTGFTTSGHLSRHNR-IHTGEKNHSCPFEGCNQKFSRHDNCLQH 258

>AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W
           (MIG2) - NSH] (1287076..1288245) [1170 bp, 389 aa]
          Length = 389

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (63%), Gaps = 3/55 (5%)

Query: 897 DSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH 949
           D+ + YVC  C R F    H TRH ++ H+GEKPH+C    CGKRF R+D + +H
Sbjct: 17  DAPRPYVCPICARAFHRLEHQTRHIRT-HTGEKPHACDFAGCGKRFSRQDELTRH 70

>YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finger
           transcriptional repressor involved in
           glucose-repression, has two tandem C2H2-type zinc
           fingers, has similarity to mammalian Sp1, Krox/Egr, and
           Wilms tumor proteins [1515 bp, 504 aa]
          Length = 504

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 896 SDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH 949
           S++ + + C  C R F    H TRH + +H+GEKPH+C  P C KRF R D + +H
Sbjct: 32  SEAPRPHACPICHRAFHRLEHQTRHMR-IHTGEKPHACDFPGCVKRFSRSDELTRH 86

>Kwal_14.2278
          Length = 463

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 33/55 (60%), Gaps = 3/55 (5%)

Query: 897 DSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH 949
           +S + Y+C  C R F    H TRH ++ H+GEKPH+C    C KRF R D + +H
Sbjct: 18  ESPRPYICPICSRAFHRLEHQTRHIRT-HTGEKPHACDFAGCTKRFSRSDELTRH 71

>CAGL0L07480g complement(822240..823184) some similarities with
           sp|P38082 Saccharomyces cerevisiae YBR066c NRG2 or
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 314

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 3/50 (6%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPK--CGKRFKRRDHVLQH 949
           ++CQ C   F++  HL+RH K +H+GEK H CP   C + F R D+ LQH
Sbjct: 252 HICQICLTGFTTSGHLSRHAK-IHTGEKSHVCPHEGCNQSFSRHDNCLQH 300

>Scas_575.3
          Length = 455

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 34/55 (61%), Gaps = 3/55 (5%)

Query: 897 DSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH 949
           D+ + +VC  C+R F    H TRH ++ H+GEKPH C  P C K+F R D + +H
Sbjct: 63  DAPRPHVCPICQRAFHRLEHQTRHMRT-HTGEKPHECDFPGCVKKFSRSDELTRH 116

>YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent
           transcriptional activator with four tandem C2H2-type
           zinc fingers [2745 bp, 914 aa]
          Length = 914

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 35/51 (68%), Gaps = 1/51 (1%)

Query: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           K +VC  C ++F+ G +L  H++ +H+GEKP+SC  C K+F R+ ++  HL
Sbjct: 619 KPFVCDYCGKRFTQGGNLRTHER-LHTGEKPYSCDICDKKFSRKGNLAAHL 668

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 949
           K + C  C R FS   HL  H +S H G KP  C  CGKRF +  ++  H
Sbjct: 591 KKHECPYCHRLFSQATHLEVHVRS-HIGYKPFVCDYCGKRFTQGGNLRTH 639

>Scas_569.2
          Length = 293

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 3/50 (6%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH 949
           Y+C+ C + F++  HL RH + +H+GEK H C  P C  +F R D+ +QH
Sbjct: 228 YICKVCSKGFTTSGHLARHNR-IHTGEKKHHCSYPGCYLKFSRHDNCVQH 276

>ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH]
           complement(835313..837622) [2310 bp, 769 aa]
          Length = 769

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 37/58 (63%), Gaps = 5/58 (8%)

Query: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRD----HVLQHLNKK 953
           K + C+ C ++F+ G +L  H + +H+GE+P+ C KCGKRF R+     H+L H N K
Sbjct: 513 KPFQCEYCGKRFTQGGNLRTHVR-LHTGERPYECDKCGKRFSRKGNLAAHMLTHENYK 569

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 29/58 (50%), Gaps = 5/58 (8%)

Query: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKR----RDHVLQHLNKK 953
           K + C  C + F+   HL  H +S H G KP  C  CGKRF +    R HV  H  ++
Sbjct: 485 KQHKCPYCHKCFTQSTHLEVHVRS-HIGYKPFQCEYCGKRFTQGGNLRTHVRLHTGER 541

>YMR176W (ECM5) [4131] chr13 (611739..615974) Protein involved in
           cell wall structure or biosynthesis [4236 bp, 1411 aa]
          Length = 1411

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 45/214 (21%), Positives = 78/214 (36%), Gaps = 57/214 (26%)

Query: 199 LEEWNVAKLP----NVLSHIDQDIPGVNQAYLYAGLWKASFTWHLEDQDLYSINYIHFGA 254
           L++WN+  +P    ++L H+D D+    +     G+  +   W + D  L SI++ H G+
Sbjct: 479 LDQWNLDNIPLNELSLLQHLDLDMANFTRTTYDIGMLFSCQGWSVSDHFLPSIDFNHLGS 538

Query: 255 PKQWYSIPQEDHEKFYEFM------------KEKFPEEASKCKEFLR---HKMFL----- 294
            K  YSI  +D EKF   +            + ++     + K F+    +K FL     
Sbjct: 539 TKLVYSIAPKDMEKFEALIARGKSEWDTIQSRPRYSTSDDELKSFIETDFYKSFLDAEQS 598

Query: 295 ---------------------------------VSPKVLKENNIKCNKVTHYEHEFIITY 321
                                              P  +  N IK  K T  +  +I  +
Sbjct: 599 ADYSNTGDNSKNSFPEDKIAGNTLHDGSQSDFIFEPNFILANGIKLYKTTQEQGSYIFKF 658

Query: 322 PYGYHAGFNYGYNLAESVNFALEDWLEIGKKAGK 355
           P  +      G+ L+++  FA   WL    +A K
Sbjct: 659 PKAFTCSIGSGFYLSQNAKFAPSSWLRFSSEAAK 692

>Kwal_47.17888
          Length = 786

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 34/50 (68%), Gaps = 1/50 (2%)

Query: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 949
           K + C+ C ++F+ G +L  H + +H+GEKP+ C KCG+RF R+ ++  H
Sbjct: 529 KPFQCEYCGKRFTQGGNLRTHVR-LHTGEKPYECEKCGRRFSRKGNLAAH 577

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 29/58 (50%), Gaps = 5/58 (8%)

Query: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKR----RDHVLQHLNKK 953
           K + C  C + F+   HL  H +S H G KP  C  CGKRF +    R HV  H  +K
Sbjct: 501 KQHECPYCHKCFTQSTHLEVHVRS-HIGYKPFQCEYCGKRFTQGGNLRTHVRLHTGEK 557

 Score = 34.3 bits (77), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 36/79 (45%), Gaps = 8/79 (10%)

Query: 881 VEAQGPKFEKG-----EVILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCP- 934
            E  G +F +G      V L    K Y C++C R+FS   +L  H+ + H   KP  C  
Sbjct: 533 CEYCGKRFTQGGNLRTHVRLHTGEKPYECEKCGRRFSRKGNLAAHRLT-HENLKPFHCKL 591

Query: 935 -KCGKRFKRRDHVLQHLNK 952
             C K F +  ++  H N+
Sbjct: 592 DGCNKSFTQLGNMKAHQNR 610

>Scas_717.17
          Length = 525

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 901 IYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 953
           +Y+C  C + F     L RH  S HS E+ + CP C  R KRRD++LQH+  K
Sbjct: 387 VYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMKLK 438

>KLLA0B07909g 697885..700653 some similarities with sp|P53243
           Saccharomyces cerevisiae YGR067c singleton, hypothetical
           start
          Length = 922

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 898 SGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           S + Y+C  C + FS   H  RH++S H+G KP SC  C   F RRD + +H+
Sbjct: 4   SQRKYICSFCAKPFSRSEHKARHERS-HTGSKPFSCSICSHSFVRRDLLQRHI 55

>AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)
           [2517 bp, 838 aa]
          Length = 838

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 898 SGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           S + Y+C  C + FS   H TRH++S H+G KP SC  C   F RRD + +H+
Sbjct: 4   SQRKYICSFCAQAFSRSEHKTRHERS-HTGVKPFSCKVCNHSFVRRDLLQRHI 55

>YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protein
           involved in transcriptional regulation of methionine
           metabolism, has two tandem C2H2-type zinc fingers [534
           bp, 177 aa]
          Length = 177

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 897 DSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLN 951
           +  ++Y C +C+ +FS    L RH+K VHS   PH C  CGK F R+D + +H N
Sbjct: 90  EGAQLYSCAKCQLKFSRSSDLRRHEK-VHSLVLPHICSNCGKGFARKDALKRHSN 143

>CAGL0K09372g complement(924818..926008) similar to sp|P53035
           Saccharomyces cerevisiae YGL209w MIG2 C2H2 zinc-finger
           protein, start by similarity
          Length = 396

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 3/50 (6%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH 949
           + C+ C R F    H  RH ++ H+GEKPH C  P CGK F R D + +H
Sbjct: 17  FKCEHCSRGFHRLEHKKRHMRT-HTGEKPHGCSFPGCGKSFSRSDELKRH 65

>Scas_712.42*
          Length = 290

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQHL 950
           + C+ C R F    H  RH ++ H+GEKPH C  P CGK F R D + +HL
Sbjct: 18  FRCETCARGFHRLEHKKRHMRT-HTGEKPHHCAFPGCGKGFSRSDELKRHL 67

>YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor of
           snf mutations, predicted transcription factor with two
           tandem C2H2-type zinc fingers, involved in glucose
           repression of MUC1 transcription [663 bp, 220 aa]
          Length = 220

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 3/50 (6%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPK--CGKRFKRRDHVLQH 949
           + C+ C   F++  HL+RH + +H+GEK H CP   CG+RF R D+  QH
Sbjct: 153 HFCKICSTGFTTSGHLSRHNR-IHTGEKNHICPHEGCGQRFSRHDNCNQH 201

>Scas_378.1
          Length = 208

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 897 DSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 953
           D+  +Y C  C + F     L RH  + HS ++ +SCPKC  + KR+D++LQHL  K
Sbjct: 79  DTPSVYQCHMCVKSFRRHSWLKRHLLA-HSSQRHYSCPKCVSKHKRKDNLLQHLKLK 134

>Scas_697.35
          Length = 839

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 33/51 (64%), Gaps = 1/51 (1%)

Query: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           K Y C  C ++F+ G +L  H++ +H+GEKP+ C  C K+F R+ ++  HL
Sbjct: 541 KPYQCGYCGKRFTQGGNLRTHQR-LHTGEKPYECELCDKKFSRKGNLAAHL 590

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 895 LSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 949
           L +  K + C  C R F+   HL  H +S H G KP+ C  CGKRF +  ++  H
Sbjct: 508 LHEGSKQHKCPYCHRLFAQSTHLEVHIRS-HLGYKPYQCGYCGKRFTQGGNLRTH 561

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 17/29 (58%)

Query: 922 KSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           K++H G K H CP C + F +  H+  H+
Sbjct: 506 KTLHEGSKQHKCPYCHRLFAQSTHLEVHI 534

>Scas_719.68
          Length = 1350

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 37/67 (55%), Gaps = 5/67 (7%)

Query: 886 PKFEKGEVILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDH 945
           P  +K   I +D  + ++C  C R      HL RH++S H+ EKP  C  CG+ F RRD 
Sbjct: 25  PIPKKSRTIKTDKPRPFLCPICTR----TEHLKRHQRS-HTREKPFVCVFCGRCFARRDL 79

Query: 946 VLQHLNK 952
           VL++  K
Sbjct: 80  VLRYQTK 86

>KLLA0F23782g 2219920..2222268 some similarities with sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 782

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 34/50 (68%), Gaps = 1/50 (2%)

Query: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 949
           K + C+ C ++F+ G +L  H + +H+GEKP+ C +CG++F R+ ++  H
Sbjct: 549 KPFSCEFCGKRFTQGGNLRTHIR-LHTGEKPYECERCGRKFSRKGNLAAH 597

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 30/58 (51%), Gaps = 5/58 (8%)

Query: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKR----RDHVLQHLNKK 953
           K + C  C + F+   HL  H +S H G KP SC  CGKRF +    R H+  H  +K
Sbjct: 521 KQFQCPYCHKYFTQSTHLEVHVRS-HIGYKPFSCEFCGKRFTQGGNLRTHIRLHTGEK 577

 Score = 37.0 bits (84), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 36/80 (45%), Gaps = 8/80 (10%)

Query: 880 SVEAQGPKFEKG-----EVILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCP 934
           S E  G +F +G      + L    K Y C+ C R+FS   +L  HK + H   KP  C 
Sbjct: 552 SCEFCGKRFTQGGNLRTHIRLHTGEKPYECERCGRKFSRKGNLAAHKLT-HDNLKPFECK 610

Query: 935 --KCGKRFKRRDHVLQHLNK 952
              C K F +  ++  H N+
Sbjct: 611 LDDCNKNFTQLGNMKAHQNR 630

>YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein
           with two tandem zinc finger domains [2385 bp, 794 aa]
          Length = 794

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           K Y+C  C + FS   H  RH++S H+G KP  C  C   F RRD + +H+
Sbjct: 6   KKYICSFCLKPFSRSEHKIRHERS-HAGVKPFQCQVCKHSFVRRDLLQRHI 55

>Scas_683.25
          Length = 879

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           K ++C  C + FS   H  RH++S H+G KP+ C  C   F R D  L+H+
Sbjct: 13  KRFICSFCAKGFSRAEHKIRHERS-HTGLKPYKCKVCTHCFVRSDLALRHI 62

>CAGL0K04631g complement(440721..443762) some similarities with
           sp|P53243 Saccharomyces cerevisiae YGR067c, hypothetical
           start
          Length = 1013

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           K + C  C + FS   H TRH++S H+G KP  C  C   F RRD + +H+
Sbjct: 10  KRHFCSFCNKAFSRSEHKTRHERS-HAGVKPFECQVCSHSFVRRDLLQRHI 59

>YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein
           involved in glucose repression of SUC2, contains two
           tandem zinc-fingers [1149 bp, 382 aa]
          Length = 382

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQHL 950
           + C  C R F    H  RH ++ H+GEKPH C  P CGK F R D + +H+
Sbjct: 17  FRCDTCHRGFHRLEHKKRHLRT-HTGEKPHHCAFPGCGKSFSRSDELKRHM 66

>YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative
           transcription factor that contains two tandem C2H2-type
           zinc fingers [1176 bp, 391 aa]
          Length = 391

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 36/75 (48%), Gaps = 9/75 (12%)

Query: 878 SKSVEAQGPKFEKGEVILSDSGKIYVCQE---CKRQFSSGHHLTRHKKSVHSGEKPHSCP 934
           + SV A  PK  K     S   K + C     C   F+   HL RH +  H+GEKP  CP
Sbjct: 22  TNSVAASTPKRSK-----SARRKTFKCTGYDGCTMSFTRAEHLARHIRK-HTGEKPFQCP 75

Query: 935 KCGKRFKRRDHVLQH 949
            C K F R D++ QH
Sbjct: 76  ACLKFFSRVDNLKQH 90

>Scas_693.31
          Length = 635

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 35/60 (58%), Gaps = 6/60 (10%)

Query: 902 YVCQ--ECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIPCIPG 959
           Y C    C + F   H L RHKK VHS EK ++CP CGK+F R D ++ H ++ I C  G
Sbjct: 519 YACDFPNCDKAFVRNHDLVRHKK-VHS-EKSYACP-CGKKFNREDALIVHRSRMI-CAGG 574

>Kwal_47.19045
          Length = 266

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 36/67 (53%), Gaps = 4/67 (5%)

Query: 891 GEVILSDSG-KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVL 947
           G   L + G + + C  C + F    H  RH ++ H+GEKPHSC  P C KRF R D + 
Sbjct: 2   GIAALQEGGHRPFKCDMCGKGFHRLEHKRRHIRT-HTGEKPHSCNFPGCVKRFSRSDELK 60

Query: 948 QHLNKKI 954
           +H+   +
Sbjct: 61  RHVRTHM 67

>KLLA0B00605g complement(46736..47455) some similarities with
           sp|P39943 Saccharomyces cerevisiae YER028c, hypothetical
           start
          Length = 239

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 32/51 (62%), Gaps = 3/51 (5%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQHL 950
           Y+C+ C  +F    H TRH ++ H+GEKP +C  P C KRF R D + +H+
Sbjct: 12  YLCEICGNRFHRLEHKTRHIRT-HTGEKPFACTVPGCPKRFSRNDELKRHI 61

>Kwal_26.8021
          Length = 507

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 953
           Y C  C + F       RH  S HS  KP+SCP C  R KRRD++ QH+  K
Sbjct: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTK 439

>AGL207W [4105] [Homologous to NOHBY] complement(310750..311583)
           [834 bp, 277 aa]
          Length = 277

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 32/50 (64%), Gaps = 3/50 (6%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKRFKRRDHVLQH 949
           YVC EC + F+    L  H+ ++H+G++P +CP   CGK F  R ++L+H
Sbjct: 183 YVCTECGKGFARASSLRTHR-NIHTGDRPFTCPFKNCGKSFNARSNMLRH 231

>CAGL0L03916g complement(448955..450883) weakly similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 642

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 949
           K + C+ C ++F+   +L  H++ +H+GE+P  C KC K F RR ++  H
Sbjct: 506 KPFECEFCGKRFTQAGNLRTHRR-LHTGERPFKCDKCDKTFARRGNLTAH 554

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 25/48 (52%), Gaps = 1/48 (2%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 949
           Y C  C + FS   HL  H K+ H G KP  C  CGKRF +  ++  H
Sbjct: 480 YQCAYCSKMFSQSTHLDVHIKA-HMGYKPFECEFCGKRFTQAGNLRTH 526

>ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH]
           complement(349070..350713) [1644 bp, 547 aa]
          Length = 547

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 54/119 (45%), Gaps = 17/119 (14%)

Query: 842 LMSLAAAANKDIELTNSMMRPSRSKTKLPTDKARSKSKSVEAQGPKFEKGEVILSDSG-- 899
           L+ LAA     + + NS    S S T L      +++ S        ++GE  L+ SG  
Sbjct: 360 LLELAA-----LHIPNSSSANSLSPTSLGPSTGPAETSSPADHSAPLDEGETALNLSGNT 414

Query: 900 ---------KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 949
                     IY C  C ++F+  ++L  H ++ H+ E+P SC  CGK F R+    +H
Sbjct: 415 RRKSLQKNPAIYSCNLCDKKFTRPYNLKSHLRT-HTDERPFSCSVCGKAFARQHDRKRH 472

>YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription factor
           that represses a variety of genes, including ANB1, FUS1,
           and ergosterol biosynthetic genes ERG2, ERG6, and ERG9,
           and activates other genes, including CYC1, LEU2, and
           SUC2, contains two tandem C2H2-type zinc fingers [1473
           bp, 490 aa]
          Length = 490

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 896 SDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 953
           SD   I+ CQ C++ F     L RH  S HS ++   CP C  R KR+D++LQH+  K
Sbjct: 340 SDHKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 396

>AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH]
           (574723..575913) [1191 bp, 396 aa]
          Length = 396

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 901 IYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 953
           I+ C  C++ F     L RH  S HS  KP+SCP C  R KR+D++ QHL  K
Sbjct: 184 IHKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKLK 235

>KLLA0B03454g complement(314015..315433) some similarities with
           sp|P39933 Saccharomyces cerevisiae YPR186c TFC2 TFIIIA
           (transcription initiation factor), hypothetical start
          Length = 472

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 899 GKIYVC--QECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
            K+Y C  Q C + F+    LT H+ +VH G KP  C  CGK F ++ H+ +H+
Sbjct: 103 SKVYFCDYQGCNKSFTRPSLLTEHQLTVHHGIKPFKCDTCGKEFAKKSHLNRHM 156

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 949
           K + C  C ++F+   HL RH  S H+ +KP +C  CGK    R  + +H
Sbjct: 135 KPFKCDTCGKEFAKKSHLNRHMFS-HTDDKPFTCSICGKGVTTRQQLKRH 183

>YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcription
           factor that controls cell cycle-specific transcription
           of HO, has three tandem C2H2-type zinc fingers [2130 bp,
           709 aa]
          Length = 709

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 33/60 (55%), Gaps = 6/60 (10%)

Query: 902 YVCQE--CKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIPCIPG 959
           Y C    C + F   H L RHKKS    EK ++CP CGK+F R D ++ H ++ I C  G
Sbjct: 580 YSCDHPGCDKAFVRNHDLIRHKKSHQ--EKAYACP-CGKKFNREDALVVHRSRMI-CSGG 635

>CAGL0M06831g 695162..697099 weakly similar to sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1, hypothetical
           start
          Length = 645

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 949
           YVC+ C + FS  ++L  H ++ H+ EKP+ C  CGK F R+    +H
Sbjct: 521 YVCEVCGKVFSRPYNLKSHLRT-HTDEKPYQCSICGKAFARQHDKKRH 567

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 10/60 (16%)

Query: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCP---------KCGKRFKRRDHVLQHL 950
           K Y C  C + F+  H   RH + +H+G+K + C           CGK+F R D + +H 
Sbjct: 547 KPYQCSICGKAFARQHDKKRH-EDLHTGKKRYVCGGKLKDGTFWGCGKKFARSDALGRHF 605

>CAGL0C02519g 253051..254007 weakly similar to sp|P39943
           Saccharomyces cerevisiae YER028c, hypothetical start
          Length = 318

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH 949
           + C+ C R F    H  RH ++ H+GEKPH C  P C K F R D + +H
Sbjct: 20  FRCEICSRGFHRLEHKKRHFRT-HTGEKPHKCKFPSCPKSFSRADELKRH 68

>YDR253C (MET32) [1086] chr4 complement(963982..964557) Zinc-finger
           protein involved in transcriptional regulation of
           methionine metabolism, has two tandem C2H2-type zinc
           fingers [576 bp, 191 aa]
          Length = 191

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 949
           K + C +C  +FS    L RH+K+ H    P+ CP+CGK F R+D + +H
Sbjct: 96  KRFKCAKCSLEFSRSSDLRRHEKT-HFAILPNICPQCGKGFARKDALKRH 144

>AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C
           (ACE2) - SH] complement(325717..328251) [2535 bp, 844
           aa]
          Length = 844

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 30/53 (56%), Gaps = 4/53 (7%)

Query: 907 CKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIPCIPG 959
           C + F   H L RHKK+    EK  +CP CGK+F R D +L H  + I C+ G
Sbjct: 711 CTKAFVRNHDLIRHKKT--HAEKTFTCP-CGKKFSREDALLTHRTRMI-CVGG 759

>Scas_636.14d
          Length = 275

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIPC 956
           + C  C++ + +     +H K VH  E+ H C  C + FKR+DH+++H     PC
Sbjct: 215 FPCPHCQKTYRTEAQQKKHLKDVHV-ERKHMCLFCSRWFKRKDHMIKHQEGGSPC 268

>Scas_687.33
          Length = 288

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQHL 950
           + C  C R F    H  RH ++ H+GEKPH C    CGK F R D + +H+
Sbjct: 17  FRCPICSRGFHRLEHKKRHVRT-HTGEKPHPCTFAHCGKSFSRGDELKRHI 66

>Kwal_27.11460
          Length = 531

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 895 LSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 949
           L  +  +Y C+ C ++F+  ++L  H ++ H+ E+P SC  CGK F R+    +H
Sbjct: 406 LQKNASVYACELCDKKFTRPYNLKSHLRT-HTDERPFSCAICGKAFARQHDRKRH 459

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 10/58 (17%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPK---------CGKRFKRRDHVLQHL 950
           + C  C + F+  H   RH+  +H+G+K ++C           CGK+F R D + +H 
Sbjct: 441 FSCAICGKAFARQHDRKRHE-DLHTGQKRYTCHGKLKDGTEWGCGKKFARSDALGRHF 497

>Scas_720.33
          Length = 316

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 900 KIYVCQ---ECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 949
           K + CQ   +C   F+   HL RH +  H+GEKP  C  C + F R D++ QH
Sbjct: 13  KTFACQGYKDCHMTFTREEHLARHIRK-HTGEKPFQCYICFRFFSRMDNLKQH 64

>Kwal_56.23925
          Length = 745

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 33/58 (56%), Gaps = 6/58 (10%)

Query: 902 YVC--QECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIPCI 957
           Y C  + C + F   H L RHKK+    EK + CP CGK+F R D +L H ++ I C+
Sbjct: 615 YFCDFEGCHKAFVRNHDLIRHKKT--HAEKCYVCP-CGKKFVREDALLVHRSRMI-CV 668

>CAGL0E01331g 124362..126431 weakly similar to sp|P08153
           Saccharomyces cerevisiae YDR146c transcription factor,
           hypothetical start
          Length = 689

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 32/60 (53%), Gaps = 6/60 (10%)

Query: 902 YVCQ--ECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIPCIPG 959
           Y C    C + F   H L RHKK+    EK ++CP CGK F R D +  H ++ I CI G
Sbjct: 586 YRCDYDGCDKAFVRNHDLVRHKKTHQ--EKSYACP-CGKMFNREDALAVHRSRMI-CIGG 641

>Scas_627.17d
          Length = 275

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIPC 956
           + C  C++ + +     +H K VH  E+ H C  C + FKR+DH+++H     PC
Sbjct: 215 FPCPHCQKTYLTEAQQKKHLKDVHV-ERKHMCLFCSRWFKRKDHMIKHQEGGSPC 268

>YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein that
           contains two tandem C2H2-type zinc finger domains, has
           strong similarity to Mig2p, a Tup1p-dependent and
           glucose-dependent transcriptional repressor [1185 bp,
           394 aa]
          Length = 394

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKRFKRRDHVLQHL 950
           + C+ C R F    H  RH ++ H+GEKPH C    C K F R D + +HL
Sbjct: 17  FRCEICSRGFHRLEHKKRHGRT-HTGEKPHKCTVQGCPKSFSRSDELKRHL 66

>Scas_568.5
          Length = 199

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 953
           K Y C +C+  F     L RH+K+ H    PH C +CGK F R+D + +H N +
Sbjct: 116 KRYPCSKCELIFLRSSDLRRHEKA-HLLVLPHICSQCGKGFARKDALKRHFNTQ 168

>KLLA0E18645g complement(1648263..1649558) some similarities with
           sp|P54785 Saccharomyces cerevisiae YMR070w HMS1
           high-copy suppressor of MOT1-SPT3 synthetic lethality
           singleton, hypothetical start
          Length = 431

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 897 DSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 953
           +S   Y C  C++QF     L RH  S HS  K   CP C    KR+D++LQHL  K
Sbjct: 301 ESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLKLK 356

>AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH]
           complement(310950..312935) [1986 bp, 661 aa]
          Length = 661

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 31/49 (63%), Gaps = 1/49 (2%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           + C  C++QFS+   L  H ++ H+GEKP SC  CGKRF    ++ +H+
Sbjct: 572 FHCHYCRKQFSTSSSLRVHIRT-HTGEKPLSCTVCGKRFNESSNLSKHM 619

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 5/54 (9%)

Query: 904 CQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKR----RDHVLQHLNKK 953
           C  C + FS+   L +H ++ HSGE+P  C  C K+F      R H+  H  +K
Sbjct: 546 CPHCPKTFSTDDILAQHIRT-HSGERPFHCHYCRKQFSTSSSLRVHIRTHTGEK 598

>KLLA0D16456g complement(1387846..1390410) weakly similar to
           sp|P21192 Saccharomyces cerevisiae YLR131c ACE2
           metallothionein expression activator, hypothetical start
          Length = 854

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 907 CKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 953
           C++ F   H L RHKKS    EK +SC  CGK+F   D +++H  +K
Sbjct: 730 CQKAFVRNHDLLRHKKS--HLEKGYSCAGCGKKFHSEDSLVKHQERK 774

>KLLA0E08679g 777005..778795 some similarities with sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1 calcineurin
           responsive zinc-finger, hypothetical start
          Length = 596

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 26/42 (61%), Gaps = 1/42 (2%)

Query: 901 IYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKR 942
           +Y C  C ++F+  ++L  H +S H+ E+P+ C  CGK F R
Sbjct: 468 VYACDICDKKFTRPYNLKSHLRS-HTDERPYVCSVCGKAFAR 508

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 12/67 (17%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCP---------KCGKRFKRRDHVLQHLNK 952
           YVC  C + F+  H   RH+  +H+G++ + C           CGK+F R D + +H   
Sbjct: 497 YVCSVCGKAFARMHDKNRHED-LHTGKRRYVCGGILKNGNSWGCGKKFARSDALGRHFKT 555

Query: 953 KI--PCI 957
           ++   CI
Sbjct: 556 ELGKKCI 562

>CAGL0K03003g 276756..278699 weakly similar to sp|P54785
           Saccharomyces cerevisiae YMR070w MOT3, hypothetical
           start
          Length = 647

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 36/75 (48%), Gaps = 7/75 (9%)

Query: 884 QGPKFEKGEVILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRR 943
           QG K E   +        + C  C + F     L RH  S HS ++   CP C  R KRR
Sbjct: 521 QGEKIEVSSLAFP-----HRCHLCPKLFKRKSWLKRHLLS-HSQQRHFLCPWCNSRHKRR 574

Query: 944 DHVLQHLN-KKIPCI 957
           D++LQH+  K +P +
Sbjct: 575 DNLLQHMKLKHVPNL 589

>KLLA0F11682g complement(1068992..1070116) some similarities with
           sgd|S0006219 Saccharomyces cerevisiae YPR015c,
           hypothetical start
          Length = 374

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 35/58 (60%), Gaps = 5/58 (8%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH--LNKKIP 955
           Y C EC + F+    L+ H  ++H+G+KP+ C  P C K+F  + ++L+H  L+ K P
Sbjct: 304 YRCAECGKAFARPSSLSTHM-NIHTGDKPYKCLYPNCYKQFNAKSNMLRHYKLHLKTP 360

>YJL056C (ZAP1) [2855] chr10 complement(330347..332989)
           Zinc-responsive transcriptional activator, regulates
           genes involved in zinc uptake, has eight C2H2-type zinc
           fingers [2643 bp, 880 aa]
          Length = 880

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 27/41 (65%), Gaps = 1/41 (2%)

Query: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRF 940
           K Y C+ CKR FSS   L +H ++ HSGEKP+ C  C K+F
Sbjct: 766 KPYKCKTCKRCFSSEETLVQHTRT-HSGEKPYKCHICNKKF 805

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 43/85 (50%), Gaps = 8/85 (9%)

Query: 873 KARSKSKSVEAQGPK--FEKGEVIL----SDSG-KIYVCQECKRQFSSGHHLTRHKKSVH 925
           K  SK K  + +  K  F   E ++    + SG K Y C  C ++F+    L  H ++ H
Sbjct: 760 KVHSKYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRT-H 818

Query: 926 SGEKPHSCPKCGKRFKRRDHVLQHL 950
           +GEKP  C  CGKRF    ++ +H+
Sbjct: 819 TGEKPLQCKICGKRFNESSNLSKHI 843

 Score = 34.3 bits (77), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 3/59 (5%)

Query: 893 VILSDSGKIYVC--QECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 949
           V L+     Y C   +C R F     L RH K VHS  KP+ C  C + F   + ++QH
Sbjct: 729 VHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLK-VHSKYKPYKCKTCKRCFSSEETLVQH 786

>CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces
           cerevisiae YJL056c ZAP1 metalloregulatory protein,
           hypothetical start
          Length = 713

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 1/41 (2%)

Query: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRF 940
           K Y C +C++ FS+   L +HK+ VHSGEKP+ C  C KRF
Sbjct: 595 KPYQCPQCQKCFSTEDTLNQHKR-VHSGEKPYECHICHKRF 634

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 31/60 (51%), Gaps = 3/60 (5%)

Query: 892 EVILSDSGKIYVCQ--ECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 949
           E+ L+     Y C+   C + FS    L RH K VHS  KP+ CP+C K F   D + QH
Sbjct: 557 EMHLTKGKSQYTCEWEGCNKTFSQRQKLVRHLK-VHSKYKPYQCPQCQKCFSTEDTLNQH 615

 Score = 33.9 bits (76), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           K Y C  C ++F+  + L  H ++ H+GEKP  C  CG+ F    ++ +H+
Sbjct: 623 KPYECHICHKRFAISNSLKIHIRT-HTGEKPLKCKVCGRCFNESSNLSKHM 672

>Scas_717.60d
          Length = 167

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 42/88 (47%), Gaps = 1/88 (1%)

Query: 862 PSRSKTKLPTDKARSKSKSVEAQGPKFEKGEVILSDSGKIYVCQECKRQFSSGHHLTRHK 921
           P  +K     ++ R++ +S   +G   +    IL+ S +++ C+EC + F +   L +H 
Sbjct: 60  PGLTKIIQVVEQNRNEVESFTDEGQSADSSCEILT-SNELFNCKECSKAFVTSQKLKKHT 118

Query: 922 KSVHSGEKPHSCPKCGKRFKRRDHVLQH 949
           K  HS         CGK FKR+D    H
Sbjct: 119 KDAHSKRMFPCEYNCGKAFKRKDQRKSH 146

>Scas_711.56
          Length = 832

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 27/41 (65%), Gaps = 1/41 (2%)

Query: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRF 940
           K + C  CK+ FS+   L +H+++ HSGEKP  C  CGKRF
Sbjct: 724 KPFQCSICKKHFSNEETLKQHERT-HSGEKPFKCDICGKRF 763

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 24/50 (48%), Gaps = 3/50 (6%)

Query: 902 YVCQ--ECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 949
           Y C    C + FS    L RH + VHSG KP  C  C K F   + + QH
Sbjct: 696 YECHWANCHKIFSQRQRLVRHMR-VHSGYKPFQCSICKKHFSNEETLKQH 744

 Score = 33.9 bits (76), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           K + C  C ++F+    L  H ++ H+GEKP  C  CGK F    ++ +H+
Sbjct: 752 KPFKCDICGKRFAISSSLKIHIRT-HTGEKPLHCKICGKAFNESSNLSKHM 801

>KLLA0C16203g complement(1414169..1418533) weakly similar to
           sp|Q03214 Saccharomyces cerevisiae YMR176w ECM5 involved
           in cell wall biogenesis and architecture singleton,
           start by similarity
          Length = 1454

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/199 (19%), Positives = 77/199 (38%), Gaps = 50/199 (25%)

Query: 199 LEEWNVAKL----PNVLSHIDQDIPGVNQAYLYAGLWKASFTWHLEDQDLYSINYIHFGA 254
           ++ WN+  +     ++L + D D   +    +  G+  ++  W LED+ L  +++ + G+
Sbjct: 535 IDAWNLNTINLSEKSLLQYQDLDFGNLAGGKIDVGMMLSTSGWALEDEFLPLLDFSYLGS 594

Query: 255 PKQWYSIPQE-----------------------------DHEKFYEFMKEKFPEEASKCK 285
            K WY +P +                             + + F  F +  F ++    +
Sbjct: 595 SKVWYFVPPQYRNSLEALFDDIRNKKEVKSSDQFEADFTESDFFQSFQETNFLDQHKTSR 654

Query: 286 EFLRHKMFL-----------------VSPKVLKENNIKCNKVTHYEHEFIITYPYGYHAG 328
           +   + MFL                 +S   L  ++I+  KV      FI+ YP  Y   
Sbjct: 655 KRSINHMFLKNLVQDKHNSYTPNDFQISTSELSASHIRYFKVIQDPKTFIMKYPQVYSTS 714

Query: 329 FNYGYNLAESVNFALEDWL 347
            + G+ ++E   FA E+W+
Sbjct: 715 ISSGFQISEKSLFAPEEWV 733

>CAGL0E06116g complement(604708..606549) some similarities with
           tr|Q12132 Saccharomyces cerevisiae YPL230w USV1,
           hypothetical start
          Length = 613

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 907 CKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 949
           C+  FS   HL RH +  H+GEKP  C  C K F R D++ QH
Sbjct: 33  CEMSFSRAEHLARHIRR-HTGEKPFKCDICLKYFSRIDNLKQH 74

>CAGL0M01870g complement(219813..220760) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 315

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 31/50 (62%), Gaps = 3/50 (6%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKRFKRRDHVLQH 949
           ++C+ C ++F     L+ H  ++H+GEKP+ CP   C K F  + ++L+H
Sbjct: 173 FICKVCLKKFKRPSSLSTHM-NIHTGEKPYPCPFDNCTKSFNAKSNMLRH 221

>Scas_720.39
          Length = 1455

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 51/104 (49%), Gaps = 11/104 (10%)

Query: 179 LNFTTPLYGADSSGSIFPSDLEE----WNVAKLP----NVLSHIDQDIPGVNQAYLYAGL 230
           L+  + +Y A++    F  +++E    W +  +P    ++L ++D D+    +     G+
Sbjct: 475 LDLPSTIYPAETK---FKLNIQEYNNPWRLENIPLSEDSLLRYLDLDLGCNTRTKFDIGM 531

Query: 231 WKASFTWHLEDQDLYSINYIHFGAPKQWYSIPQEDHEKFYEFMK 274
           + +   W + D  L SI+Y H G+ K WY +  +D EK    MK
Sbjct: 532 FLSVAGWSVTDNFLPSIDYHHMGSSKLWYVVSPKDLEKLEALMK 575

 Score = 33.9 bits (76), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 27/55 (49%)

Query: 294 LVSPKVLKENNIKCNKVTHYEHEFIITYPYGYHAGFNYGYNLAESVNFALEDWLE 348
           L +   LK+N I+   V+     +I TYP  Y +    G  L++   FA + WL+
Sbjct: 644 LFTTAFLKKNGIEVRTVSQDSGSYIFTYPKTYTSYIGAGVYLSQHATFAPKSWLK 698

>KLLA0C16005g 1397274..1398269 some similarities with sgd|S0006151
           Saccharomyces cerevisiae YPL230w USV1, hypothetical
           start
          Length = 331

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 4/54 (7%)

Query: 900 KIYVCQ---ECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           K + CQ   +C+ +F+   HL RH +  H+GE+P  C  C + F R D++ QH+
Sbjct: 18  KSFKCQGFGDCRMEFTRQEHLARHIRK-HTGEQPFQCHLCLRFFSRLDNLKQHV 70

>YLR131C (ACE2) [3541] chr12 complement(404511..406823)
           Metallothionein expression activator with similarity to
           Swi5p, has three tandem C2H2-type zinc fingers [2313 bp,
           770 aa]
          Length = 770

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 33/60 (55%), Gaps = 6/60 (10%)

Query: 902 YVCQ--ECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIPCIPG 959
           Y C    C + F   H L RHK S H+ +K + CP CGKRF R D ++ H ++ I C  G
Sbjct: 633 YSCDFPGCTKAFVRNHDLIRHKIS-HNAKK-YICP-CGKRFNREDALMVHRSRMI-CTGG 688

>Kwal_23.5400
          Length = 429

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 41/82 (50%), Gaps = 1/82 (1%)

Query: 870 PTDKARSKSKSVEAQGPKFEKGEVILSDSGKIYVCQE-CKRQFSSGHHLTRHKKSVHSGE 928
           P +   ++S+SVE+ G          S   K +   E C + FS    LT H++ VH G 
Sbjct: 19  PINVPLTRSESVESMGSISSVDSSSSSRVKKWFCEYEGCSKAFSRPSQLTEHQEVVHQGI 78

Query: 929 KPHSCPKCGKRFKRRDHVLQHL 950
           KP  C  C ++F R+ H+ +H+
Sbjct: 79  KPFQCTVCARQFSRKTHLERHM 100

 Score = 37.0 bits (84), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 1/56 (1%)

Query: 894 ILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 949
           ++    K + C  C RQFS   HL RH  S HS +KP  C  CGK    +  + +H
Sbjct: 73  VVHQGIKPFQCTVCARQFSRKTHLERHMFS-HSEDKPFKCSYCGKGVTTKQQLRRH 127

>Sklu_1527.1 YPL038W, Contig c1527 389-1006
          Length = 205

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 37/77 (48%), Gaps = 3/77 (3%)

Query: 873 KARSKSKSVEAQGPKFEKGEVILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHS 932
           K R KS S   +    E  + +  D  K Y C +C+  F     L RH+++ H    P+ 
Sbjct: 98  KKRHKSTSSSTEADSVEDVQQLNED--KKYQCDKCELVFRRSSDLRRHERA-HLPILPNI 154

Query: 933 CPKCGKRFKRRDHVLQH 949
           C  CGK F R+D + +H
Sbjct: 155 CSLCGKGFARKDALKRH 171

>YMR182C (RGM1) [4137] chr13 complement(624531..625166)
           Transcriptional repressor, has strong similarity to
           mammalian EGR (early growth response) factor, contains
           two tandem C2H2-type zinc fingers [636 bp, 211 aa]
          Length = 211

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 1/69 (1%)

Query: 881 VEAQGPKFEKGEVILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRF 940
           +  + PK  K    +  + +     +C   F+   HL RH +  H+GEKP  C  C K F
Sbjct: 1   MRGKQPKRNKDNASVKRNYRCVGYPDCNMSFNRTEHLARHIRK-HTGEKPFQCNICLKFF 59

Query: 941 KRRDHVLQH 949
            R D++ QH
Sbjct: 60  SRIDNLRQH 68

>Kwal_27.11824
          Length = 199

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 44/91 (48%), Gaps = 3/91 (3%)

Query: 863 SRSKTKLPTDKARSKSKSVEAQGPKFEKGEVILSD--SGKIYVCQECKRQFSSGHHLTRH 920
           S S+++    K R +S+S +       KG   + D    K + C +C+  F     L RH
Sbjct: 78  SSSQSEKTETKKRRRSESADHSAKDDAKGNASVEDDAGAKKFPCAKCELVFRRSSDLRRH 137

Query: 921 KKSVHSGEKPHSCPKCGKRFKRRDHVLQHLN 951
           +++ H    P+ C  CGK F R+D + +H +
Sbjct: 138 ERA-HLPILPNICSLCGKGFARKDALKRHFD 167

>CAGL0B02651g complement(253495..254064) weakly similar to sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 transcriptional
           regulator of sulfur amino acid metabolism, hypothetical
           start
          Length = 189

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 42/81 (51%), Gaps = 1/81 (1%)

Query: 872 DKARSKSKSVEAQGPKFEKGEVILSDSG-KIYVCQECKRQFSSGHHLTRHKKSVHSGEKP 930
           +K+  K+ S+E     ++ G+     S  KIY C  C   +     L +H+++ H  ++ 
Sbjct: 89  EKSGIKTASIEPPNYLYDNGKHTRRRSNQKIYPCNICGISYDKLTDLRKHERASHEPKQE 148

Query: 931 HSCPKCGKRFKRRDHVLQHLN 951
           + C  CGK+F R+D + +H +
Sbjct: 149 NVCMNCGKKFARKDALKRHFD 169

>Sklu_2389.2 YJL056C, Contig c2389 3525-5828
          Length = 767

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 907 CKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           C + F+    L RH K VHSG KP  CP C K+F   D + QH+
Sbjct: 635 CSKSFTQRQKLLRHLK-VHSGYKPFKCPHCTKKFSTEDILQQHI 677

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 894 ILSDSG-KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           I + SG + + C  C +QF++   L  H ++ H+GEKP  C  CGKRF    ++ +H+
Sbjct: 677 IRTHSGERPFKCTYCTKQFATSSSLRIHIRT-HTGEKPLKCKICGKRFNESSNLSKHM 733

 Score = 34.3 bits (77), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 5/58 (8%)

Query: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKR----RDHVLQHLNKK 953
           K + C  C ++FS+   L +H ++ HSGE+P  C  C K+F      R H+  H  +K
Sbjct: 656 KPFKCPHCTKKFSTEDILQQHIRT-HSGERPFKCTYCTKQFATSSSLRIHIRTHTGEK 712

>CAGL0I02838g complement(248704..250671) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 655

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 39/86 (45%), Gaps = 23/86 (26%)

Query: 875 RSKSKSVEAQGPKFEKGEVILSDSGKI----------------------YVCQECKRQFS 912
           +++ K V  + P  E G++++S+  +I                      + CQ C R F+
Sbjct: 565 QARKKGVTEKVPTTEDGKLVISNDSEIIPSSVDLFGGVEKPKSATVSKQFECQYCHRCFA 624

Query: 913 SGHHLTRHKKSVHSGEKPHSCPKCGK 938
              HL  H +S H G+KP+ C  CGK
Sbjct: 625 QVTHLDVHIRS-HLGKKPYQCEYCGK 649

>Scas_695.2
          Length = 571

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 5/63 (7%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFK----RRDHVLQHLNKKIPCI 957
           Y C+ C + F+  ++L  H ++ H+ E P  C  CGK F     R+ H   H  KK    
Sbjct: 452 YACELCDKTFTRPYNLKSHLRT-HTNEXPFVCNICGKAFARQHDRKRHEDLHTGKKRYVC 510

Query: 958 PGV 960
            GV
Sbjct: 511 GGV 513

>Scas_713.11
          Length = 465

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 61/145 (42%), Gaps = 35/145 (24%)

Query: 830 RQISSETYESSPLMSLAAAANKDIELTNSMMRPSRSKTKLPTDKARSKSKSVEAQGPKFE 889
           R ++ +  +  PL  +    N++++ +  M+     K   PT  ++SK K         +
Sbjct: 309 RSLTPQQQKREPLQ-ITVDTNQELKTSTEMI----DKVNYPTKHSKSKGK---------Q 354

Query: 890 KGEVILSDS---GKIYVCQE--------CKRQFSSGHHLTRHKKSVHSGEK-PHSCPKC- 936
           K  V+L +S     IY C          C  QFS  + L RH+ ++H+ +K    C +C 
Sbjct: 355 KKPVVLPNSKFENDIYTCMMLDLITDAPCSAQFSRSYDLVRHQNTIHAKQKIVFHCLQCI 414

Query: 937 --------GKRFKRRDHVLQHLNKK 953
                    K F R D + +HL  K
Sbjct: 415 KLFGERGFSKTFSRLDALSRHLKSK 439

>KLLA0F20636g complement(1914452..1915309) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 285

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 3/54 (5%)

Query: 899 GKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKRFKRRDHVLQHL 950
           GK  +C +C +QF+    L  H   VHSG+KP  C    C K+F  + ++++HL
Sbjct: 229 GKADICAQCGKQFTRPSALRTHML-VHSGDKPFECTWEGCNKKFNVKSNLIRHL 281

>Kwal_14.2206
          Length = 254

 Score = 39.3 bits (90), Expect = 0.010,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 30/48 (62%), Gaps = 3/48 (6%)

Query: 904 CQECKRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH 949
           C+ C + FS    L+ H   +H+G +P++C  P CGKRF  + ++++H
Sbjct: 196 CRICGKTFSRPSGLSTHAL-IHTGHQPYACDAPNCGKRFNVKSNLMRH 242

>KLLA0A04609g complement(411494..412765) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 423

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 904 CQECKRQFSSGHHLTRHKKSVHSGEKPHSCPK--CGKRFKRRDHVLQHLNK 952
           C  C R  S    L  H  S+H+G+KP+ CPK  C KRF  + ++L+H  +
Sbjct: 343 CHICGRICSRPSTLQTHL-SIHTGDKPYKCPKRNCHKRFNVKSNMLRHYKR 392

>CAGL0M04323g complement(474158..476269) similar to sp|P21192
           Saccharomyces cerevisiae YLR131c ACE2 or sp|P08153
           Saccharomyces cerevisiae YDR146c SWI5, hypothetical
           start
          Length = 703

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 6/55 (10%)

Query: 900 KIYVC--QECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNK 952
           K Y C  + C + F   H L RHKK   + +K  SCP CGK+F     +++H N+
Sbjct: 551 KPYKCDFEGCTKAFVRNHDLARHKK---THDKHFSCP-CGKKFSSEQSMMKHKNR 601

>AGL246W [4066] [Homologous to ScYDR253C (MET32) - SH; ScYPL038W
           (MET31) - SH] complement(240857..241540) [684 bp, 227
           aa]
          Length = 227

 Score = 38.5 bits (88), Expect = 0.014,   Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 897 DSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           + GK + C +C+  F     L RH+K VH    P+ C  CGK F R+D + +H 
Sbjct: 142 NDGKRFHCTKCELVFRRSGDLRRHEK-VHLPILPNICSLCGKGFARKDALKRHF 194

>AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH]
           complement(117043..118473) [1431 bp, 476 aa]
          Length = 476

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 949
           + Y C++C R F+   HL RH  S HS  KP SC  CGK    R  + +H
Sbjct: 148 RAYQCEQCGRGFTKKSHLERHLFS-HSETKPFSCTVCGKGVTTRQQLRRH 196

 Score = 37.0 bits (84), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 900 KIYVC--QECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           K + C  + C + F+    LT H+++ H G + + C +CG+ F ++ H+ +HL
Sbjct: 117 KTHYCDYEGCYKAFTRPSLLTEHQQTAHQGIRAYQCEQCGRGFTKKSHLERHL 169

>KLLA0F01463g 140343..142688 some similarities with sp|P47043
           Saccharomyces cerevisiae YJL056c ZAP1 metalloregulatory
           protein involved in zinc-responsive transcriptional
           regulation, hypothetical start
          Length = 781

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           + C  C + +S+   L  H ++ H+GEKP SCP C KRF    ++ +H+
Sbjct: 720 FKCHLCPKSYSTSSSLRIHIRT-HTGEKPLSCPICNKRFNESSNLAKHI 767

 Score = 37.7 bits (86), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 27/51 (52%), Gaps = 3/51 (5%)

Query: 902 YVCQ--ECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           Y C+   C + F     L RH K VHS  KP  C +CGK F  +D + QHL
Sbjct: 662 YKCEWEGCNKVFVQKQKLIRHLK-VHSKYKPFRCAECGKCFNTQDILTQHL 711

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 5/58 (8%)

Query: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKR----RDHVLQHLNKK 953
           K + C EC + F++   LT+H + VHSGE+P  C  C K +      R H+  H  +K
Sbjct: 690 KPFRCAECGKCFNTQDILTQHLR-VHSGERPFKCHLCPKSYSTSSSLRIHIRTHTGEK 746

>CAGL0G10021g complement(959154..960338) similar to sp|P39933
           Saccharomyces cerevisiae YPR186c TFC2, hypothetical
           start
          Length = 394

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 900 KIYVCQ--ECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           K Y+C+   C + F+    LT H+ +VH G KP  C +C   F ++ H+ +HL
Sbjct: 34  KTYLCEYDNCDKAFTRPSLLTEHQNTVHLGRKPWKCNQCESSFTKKIHLERHL 86

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 1/46 (2%)

Query: 904 CQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 949
           C +C+  F+   HL RH  + H+ E+P  C  CGK    R  + +H
Sbjct: 69  CNQCESSFTKKIHLERHLYT-HTDERPFYCSFCGKGLITRQQLKRH 113

>YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-dependent
           transcription factor, regulates gene expression
           downstream of calcineurin in response to multiple
           environmental signals, has two C2H2-type zinc finger
           domains [2037 bp, 678 aa]
          Length = 678

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 10/58 (17%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCP---------KCGKRFKRRDHVLQHL 950
           ++C  C + F+  H   RH + +H+G+K + C           CGK+F R D + +H 
Sbjct: 597 FICSICGKAFARQHDRKRH-EDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHF 653

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 949
           + C  C ++F+  ++L  H ++ H+ E+P  C  CGK F R+    +H
Sbjct: 569 FACDVCGKKFTRPYNLKSHLRT-HTNERPFICSICGKAFARQHDRKRH 615

>Scas_718.67
          Length = 473

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 86/193 (44%), Gaps = 33/193 (17%)

Query: 784 PVNNSNYQAASPALMDDKNNINPNQNMNSLLDMGLSAFQNSPSNGLRQI----SSETYES 839
           P++ S+++++   L+D++N  +      S++   L++  +SP   L+ +    SS +  +
Sbjct: 266 PLSESDFKSS--QLVDNENTYH----HQSMIPTPLTSENSSPRESLKPVITLPSSSSTSN 319

Query: 840 SPLMSLAAAANKDIELTNSMMRPSRSKTKLPTDKARSKSKSVEAQGPKFEKGEVIL-SDS 898
            P+ +L     KD     +M      + +   ++ R  S S++      E  + I  S +
Sbjct: 320 KPISNLKLNIPKDF----TMKSNEEKRKESLIEELRKSSYSIKKPASIEESLKAITESST 375

Query: 899 GKIYVC--------QECKRQFSSGHHLTRHKKSVHSGEKP-HSCPKC---------GKRF 940
            + Y C        + C  QFS  + LTRH+ ++H+ +K    C +C          K F
Sbjct: 376 DETYTCRIINLTTNEPCCAQFSRSYDLTRHQNTIHASKKTVFRCSECIKSLGNEGYDKTF 435

Query: 941 KRRDHVLQHLNKK 953
            R D + +H+  K
Sbjct: 436 SRLDALTRHIKSK 448

>Kwal_27.10467
          Length = 302

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 40/82 (48%), Gaps = 13/82 (15%)

Query: 872 DKARS--KSKSVEAQGPKFEKGEVILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEK 929
           D ARS  K+ S E Q P+          +   Y C +C + F+    L  H  + H+G+K
Sbjct: 174 DLARSARKASSEELQPPRLR--------NQPRYTCTKCGKVFNRPSSLATHNNT-HTGDK 224

Query: 930 PHSCP--KCGKRFKRRDHVLQH 949
           P+ CP   C K+F  R ++ +H
Sbjct: 225 PYCCPFDNCDKQFNARSNMTRH 246

>Scas_631.7
          Length = 433

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 949
           K + C++C +QFS   HL RH  S HS  KP  C  CGK    R  + +H
Sbjct: 86  KPFKCEQCDKQFSRKTHLERHLIS-HSDSKPFCCLHCGKGVTTRQQLKRH 134

 Score = 37.4 bits (85), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 900 KIYVCQE--CKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           K Y C    C + F+    L+ H+ + H G KP  C +C K+F R+ H+ +HL
Sbjct: 55  KNYFCDYSGCTKAFTRPSLLSEHQLTFHQGIKPFKCEQCDKQFSRKTHLERHL 107

>Scas_721.56
          Length = 199

 Score = 37.7 bits (86), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           + C +C+  F     L RH+K+ H    P+ C +CGK F R+D + ++ 
Sbjct: 115 FQCNKCELYFIRSSDLRRHEKT-HLSILPNICSQCGKGFARKDALKRYF 162

>CAGL0L12562g complement(1350878..1351549) similar to sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 or tr|Q03081
           Saccharomyces cerevisiae YPL038w MET31, hypothetical
           start
          Length = 223

 Score = 37.7 bits (86), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 949
           + C +C  +F+    L RH+++ H    P+ C +CGK F R+D + +H
Sbjct: 142 HYCSQCSLKFNRSSDLRRHERA-HLLVLPYICTQCGKGFARKDALKRH 188

>Kwal_14.2543
          Length = 711

 Score = 38.5 bits (88), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           K Y C  C + F++   L  H ++ H+GEKP  C  CGKRF    ++ +H+
Sbjct: 632 KPYKCSHCGKGFATSSSLRIHIRT-HTGEKPLECKVCGKRFNESSNLSKHM 681

 Score = 37.4 bits (85), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 5/54 (9%)

Query: 904 CQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKR----RDHVLQHLNKK 953
           C  C + FS+   L +H ++ HSGEKP+ C  CGK F      R H+  H  +K
Sbjct: 608 CVHCLKTFSTQDILQQHMRT-HSGEKPYKCSHCGKGFATSSSLRIHIRTHTGEK 660

 Score = 30.8 bits (68), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 3/51 (5%)

Query: 902 YVC--QECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           YVC  + C R  +    L RH + VH+  KP  C  C K F  +D + QH+
Sbjct: 576 YVCGWENCGRVITQRQKLLRHLR-VHTRYKPCKCVHCLKTFSTQDILQQHM 625

>AFL136W [3059] [Homologous to ScYPL230W - SH; ScYMR182C (RGM1) -
           SH] complement(178780..180009) [1230 bp, 409 aa]
          Length = 409

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 907 CKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 949
           C R F+   HL RH +   +GEKP  C  C + F R D++ QH
Sbjct: 28  CDRSFTRAEHLARHIRK-QTGEKPSQCEVCNRFFSRIDNLKQH 69

>YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA
           polymerase III transcription initiation factor TFIIIA,
           has nine C2H2-type zinc fingers [1290 bp, 429 aa]
          Length = 429

 Score = 37.7 bits (86), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 900 KIYVCQE--CKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           K Y C    C + F+    LT H+ SVH G +   C KC K F ++ H+ +HL
Sbjct: 47  KTYFCDYDGCDKAFTRPSILTEHQLSVHQGLRAFQCDKCAKSFVKKSHLERHL 99

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 1/50 (2%)

Query: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 949
           + + C +C + F    HL RH  + HS  KP  C  CGK    R  + +H
Sbjct: 78  RAFQCDKCAKSFVKKSHLERHLYT-HSDTKPFQCSYCGKGVTTRQQLKRH 126

>Scas_627.6
          Length = 1207

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 48/98 (48%), Gaps = 14/98 (14%)

Query: 862 PSRSKTKLPTDKARSKSKSVEAQGPKFEKGEVILSDSGKIYVCQ--ECKRQFSSGHHLTR 919
           PS++  +   +K  +++    A  P  +  ++ +++    Y+C   +C + F+   HL+R
Sbjct: 5   PSKNIIRATLNKTDNETSQRRASAPVQKSAKLAVTER---YICPHPDCNKSFTRQEHLSR 61

Query: 920 HKKSVHSGEKPHSCP--------KCGKRFKRRDHVLQH 949
           HK + H  ++   CP         C K F R+D +++H
Sbjct: 62  HKLN-HWPKEIFVCPFIFPNTNITCNKTFVRKDLLIRH 98

>Kwal_47.16577
          Length = 881

 Score = 37.7 bits (86), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 4/50 (8%)

Query: 907 CKRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQHLNKKI 954
           C + FS   HL RHK + HS EK + C  P CG+ F R D   +H  + +
Sbjct: 20  CSKSFSRSDHLGRHKAN-HSSEK-YKCEWPACGREFSRLDVKKKHFGRHL 67

>Kwal_47.18337
          Length = 536

 Score = 37.7 bits (86), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 41/96 (42%), Gaps = 14/96 (14%)

Query: 880 SVEAQGPKFEKGEVILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCP----- 934
           S E+ G K E  E       K +VC  C  +F    +LTRH K  H+ EK + CP     
Sbjct: 135 SPESNGSKTEDEEKDAHKGQKRFVCHYCNAEFYIRGYLTRHIKK-HAVEKAYYCPFFNAD 193

Query: 935 -----KCGKR--FKRRDHVLQHL-NKKIPCIPGVGS 962
                +C     F RRD    HL ++   C  GV S
Sbjct: 194 APKDARCHTTGGFSRRDTYKTHLRSRHFVCPKGVRS 229

>CAGL0E04312g 412563..414629 some similarities with sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1 or sp|P38704
           Saccharomyces cerevisiae YHR006w SPT2, hypothetical
           start
          Length = 688

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 31/71 (43%), Gaps = 13/71 (18%)

Query: 895 LSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCP----------KCGKR--FKR 942
           L D  K +VC  C  +F    +LTRH K  H+ EK + CP          +C     F R
Sbjct: 191 LDDDEKEFVCHYCDAKFRIRGYLTRHIKK-HAIEKAYHCPFYNGQEVPSKRCHNSGGFSR 249

Query: 943 RDHVLQHLNKK 953
           RD    H+  +
Sbjct: 250 RDTYKTHMKAR 260

>CAGL0L00583g 69547..70713 similar to tr|Q12132 Saccharomyces
           cerevisiae YPL230w USV1, hypothetical start
          Length = 388

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 1/39 (2%)

Query: 911 FSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 949
           F+   H  RH +  H+GEKP  C  C K F R D++ QH
Sbjct: 3   FTRAEHHARHIRK-HTGEKPFQCDICMKFFSRIDNLKQH 40

>CAGL0E03762g complement(351003..352757) weakly similar to sp|P33400
           Saccharomyces cerevisiae YHL027w RIM101 meiotic
           regulatory protein, hypothetical start
          Length = 584

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 3/49 (6%)

Query: 904 CQ--ECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           CQ   C  +     H+T H + VH   KP +C  C KRFKR   + +HL
Sbjct: 191 CQWDNCTSKTEKRDHMTSHLR-VHVPLKPFACSTCSKRFKRPQDLKKHL 238

>Scas_718.36d
          Length = 330

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 3/50 (6%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKRFKRRDHVLQH 949
           Y C  C + F     L  H  ++ SG +P+ CP   C K F  + ++L+H
Sbjct: 239 YFCDVCGKGFRRPSSLRTHS-NIRSGNRPYKCPYSNCTKSFNAKSNMLRH 287

>Sklu_2436.9 YDR463W, Contig c2436 18516-20069
          Length = 517

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 42/99 (42%), Gaps = 18/99 (18%)

Query: 869 LPTDKARSKSKSVEAQGPKFEKGEVILSDS--GKIYVCQECKRQFSSGHHLTRHKKSVHS 926
           LP   +       ++Q PK   GE I  +   GK YVC  C  +F    +LTRH K  H+
Sbjct: 130 LPISPSSGSESKHDSQNPK--DGEEIDDEEQRGK-YVCHYCDAEFRIRGYLTRHIKK-HA 185

Query: 927 GEKPHSCP----------KCGKR--FKRRDHVLQHLNKK 953
            EK + CP          +C     F RRD    HL  +
Sbjct: 186 VEKAYHCPFFNSKLPPESRCHTTGGFSRRDTYKTHLKSR 224

>Sklu_2126.5 YHL027W, Contig c2126 7763-9109
          Length = 448

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 907 CKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           C  +     H+T H + VH   KP  C  CGK+FKR   + +HL
Sbjct: 95  CNTKTVKRDHITSHLR-VHVPLKPFGCSTCGKKFKRPQDLKKHL 137

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 33/78 (42%), Gaps = 9/78 (11%)

Query: 897 DSGKIYVCQ--ECKRQFSSGHHLTRHKKSVHSGEKPH-----SC--PKCGKRFKRRDHVL 947
           DS ++ VCQ   C + F     L  H  + H G K       +C    C  +  +RDH+ 
Sbjct: 47  DSSEMLVCQWQGCSQVFPQPELLYHHLCNDHVGRKSQKNLQLNCNWGNCNTKTVKRDHIT 106

Query: 948 QHLNKKIPCIPGVGSSAG 965
            HL   +P  P   S+ G
Sbjct: 107 SHLRVHVPLKPFGCSTCG 124

>KLLA0D11902g 1015273..1016142 some similarities with sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 transcriptional
           regulator of sulfur amino acid metabolism, hypothetical
           start
          Length = 289

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 953
           K + C++C   F     L RH++  H    P+ C  CGK F R+D + +H + +
Sbjct: 202 KRFPCEKCHMVFRRSSDLRRHERQ-HLPILPNICTLCGKGFARKDALKRHFDTQ 254

>CAGL0K01727g complement(152569..154068) similar to sp|Q03465
           Saccharomyces cerevisiae YDL020c, start by similarity
          Length = 499

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 54/132 (40%), Gaps = 32/132 (24%)

Query: 853 IELTNSMMRP----SRSKTKLPTDKARSKSKSVEAQGPKF---------EKGEVILSDSG 899
           +E T+S+ +     SRS    PT  AR  S S   Q PK                 + + 
Sbjct: 344 VEKTSSVTKAGSNHSRSTLARPTAHARKLSSS-RKQAPKVYNPKTTTKSTHTHSKNNATH 402

Query: 900 KIYVCQ--------ECKRQFSSGHHLTRHKKSVHSGEKP-HSCPKC---------GKRFK 941
           + +VC+         C  QFS  + LTRH+ ++H+ ++    C +C          K F 
Sbjct: 403 EAFVCELVNSVTNEVCGAQFSRTYDLTRHQNTIHAKKRSIFRCSECIRALGDEGFQKTFS 462

Query: 942 RRDHVLQHLNKK 953
           R D + +H+  K
Sbjct: 463 RLDALTRHIKAK 474

>YDL020C (RPN4) [840] chr4 complement(415110..416705) Subunit of the
           regulatory particle of the proteasome, also binds DNA to
           act as a positive regulator of expression of many
           proteasome subunit genes, functions in RNA polymerase II
           transcription elongation [1596 bp, 531 aa]
          Length = 531

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 32/72 (44%), Gaps = 18/72 (25%)

Query: 900 KIYVCQ--------ECKRQFSSGHHLTRHKKSVHSGEK-PHSCPKC---------GKRFK 941
           +I+ CQ         C  QFS  + LTRH+ ++H+  K    C +C          K F 
Sbjct: 435 EIFTCQIMNLITNEPCGAQFSRSYDLTRHQNTIHAKRKIVFRCSECIKILGSEGYQKTFS 494

Query: 942 RRDHVLQHLNKK 953
           R D + +H+  K
Sbjct: 495 RLDALTRHIKSK 506

>Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement
          Length = 291

 Score = 34.3 bits (77), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 31/61 (50%), Gaps = 5/61 (8%)

Query: 902 YVCQE--CKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH--LNKKIPCI 957
           +VC+E  C + F    HL  HK S HS  KP +CP C K F     + +H   +K +P  
Sbjct: 38  FVCEEPGCGKGFLRASHLKVHKWS-HSQVKPLACPVCSKGFTTNQQLSRHKKTHKDLPSP 96

Query: 958 P 958
           P
Sbjct: 97  P 97

>Scas_604.4
          Length = 585

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 22/35 (62%), Gaps = 1/35 (2%)

Query: 916 HLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           H+T H + VH   KP +C KC K+FKR   + +HL
Sbjct: 233 HITSHLR-VHVPLKPFACKKCTKKFKRPQDLKKHL 266

>Sklu_2244.3 , Contig c2244 4100-4915 reverse complement
          Length = 271

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 3/50 (6%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH 949
           Y C +CK++F     L  H   +H G  P  C  P C K+F  + ++L+H
Sbjct: 216 YCCPKCKKEFKRPSGLRTH-MVIHYGRNPFFCKWPNCSKKFNVKSNLLRH 264

>CAGL0H07557g 738086..739516 some similarities with sp|P32805
           Saccharomyces cerevisiae YGL254w FZF1, hypothetical
           start
          Length = 476

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 3/52 (5%)

Query: 902 YVCQE--CKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLN 951
           YVC E  C ++F    HL  HK + H+  KP  C  C +RF     + +H N
Sbjct: 87  YVCDEPNCGKRFLRPCHLRVHKWT-HAQVKPLKCSYCERRFITNQQLKRHTN 137

>KLLA0F10109g complement(939195..941066) weakly similar to sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1 pre-tRNA splicing
           protein, transcription factor, start by similarity
          Length = 623

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 42/101 (41%), Gaps = 31/101 (30%)

Query: 865 SKTKLPTDKARSKSKSVEAQGPKFEKGEVILSDSGKIYVCQECKRQFSSGHHLTRHKKSV 924
           S++++PTDK+              EK E  +      +VC  C  +F    +LTRH K  
Sbjct: 223 SESQVPTDKSD-------------EKKETDMK-----FVCHYCDAEFKMRGYLTRHIKK- 263

Query: 925 HSGEKPHSCP----------KCGKR--FKRRDHVLQHLNKK 953
           H+ EK + CP          +C     F RRD    HL  +
Sbjct: 264 HAIEKAYHCPFWDASLPSEKRCHSTGGFSRRDSYKTHLRSR 304

>KLLA0E00726g 80516..82069 gi|5531271|emb|CAB50896.1 Kluyveromyces
           lactis RIM101 homologue, start by similarity
          Length = 517

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 3/49 (6%)

Query: 904 CQ--ECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           CQ  +C+ +     H+T H + VH   KP +C  C K+FKR   + +HL
Sbjct: 149 CQWGDCQTKTVKRDHITSHLR-VHVQLKPFACSTCNKKFKRPQDLKKHL 196

>Scas_641.24
          Length = 532

 Score = 34.3 bits (77), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 38/84 (45%), Gaps = 16/84 (19%)

Query: 882 EAQGPKFEKGEVILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCP------- 934
           ++Q P  E+ E   +D G  ++C  C  +F    +LTRH K  H+ EK + CP       
Sbjct: 166 DSQTPTKEEDEE--TDDGP-FICHYCDAKFRIRGYLTRHIKK-HAVEKAYHCPFFNSDIL 221

Query: 935 ---KCGKR--FKRRDHVLQHLNKK 953
              +C     F RRD    HL  +
Sbjct: 222 SESRCHNTGGFSRRDTYKTHLKAR 245

>Scas_660.12
          Length = 367

 Score = 34.3 bits (77), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 30/69 (43%), Gaps = 13/69 (18%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCP----------KCGKR--FKRRDHVLQH 949
           YVC  C+ +F    +LTRH K  H+ EK + CP          +C     F RRD    H
Sbjct: 96  YVCHYCQAKFRIKGYLTRHIKK-HAVEKAYHCPFFSTESPPELRCHNSGGFSRRDTYKTH 154

Query: 950 LNKKIPCIP 958
           L  +    P
Sbjct: 155 LKARHILFP 163

>CAGL0C03355g 337923..338852 similar to sp|P53743 Saccharomyces
           cerevisiae YNR054c, hypothetical start
          Length = 309

 Score = 33.9 bits (76), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 47/99 (47%), Gaps = 17/99 (17%)

Query: 37  VKVIPPREWLDRAGREPREDLLREVRIRNPIQQHVSGSKGVYMISNVEKNKTY-NMIQWK 95
           VK +P  +W D   +  RE+ +R+ ++   I Q  S       I NVE++K   NM + K
Sbjct: 207 VKYLPGFKWADLTEQIARENDVRQAKLELEISQ--SNKLNAEYIRNVEQSKMLQNMRKRK 264

Query: 96  D---LSYDFRV-----------PDDPSSLKNKSEESIQD 120
           D      D R             D PSS+KNKSE S++D
Sbjct: 265 DHEDRDQDARRQFKQHKVSTNRADAPSSIKNKSETSVKD 303

>YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor
           involved in sulfite metabolism, has five C2H2-type zinc
           fingers [900 bp, 299 aa]
          Length = 299

 Score = 33.9 bits (76), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 3/54 (5%)

Query: 900 KIYVCQE--CKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLN 951
           K Y C E  C ++F    HL  HK + HS  KP +C  C KRF     + +HLN
Sbjct: 40  KPYHCDEPGCGKKFIRPCHLRVHKWT-HSQIKPKACTLCQKRFVTNQQLRRHLN 92

>CAGL0I02816g complement(247817..248692) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 291

 Score = 33.5 bits (75), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 3/55 (5%)

Query: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKRFKRRDHVLQHLNK 952
           K Y C  CK++FS   +L  HK + H   +P  C    C K F +  ++  H NK
Sbjct: 9   KPYECDICKKRFSRKGNLAAHKMT-HGKIRPFICKLDNCNKSFSQLGNMKSHQNK 62

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 16/24 (66%)

Query: 926 SGEKPHSCPKCGKRFKRRDHVLQH 949
           +GEKP+ C  C KRF R+ ++  H
Sbjct: 6   TGEKPYECDICKKRFSRKGNLAAH 29

>YDR463W (STP1) [1281] chr4 (1386804..1388363) Transcription factor
           involved in regulating transcription of amino acid
           permease genes and involved in pre-tRNA splicing of
           specific tRNA species, has three C2H2-type zinc fingers
           [1560 bp, 519 aa]
          Length = 519

 Score = 33.5 bits (75), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 33/77 (42%), Gaps = 13/77 (16%)

Query: 889 EKGEVILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCP----------KCGK 938
           E    +L++  + ++C  C   F    +LTRH K  H+ EK + CP          +C  
Sbjct: 147 EHSTKVLNNGEEEFICHYCDATFRIRGYLTRHIKK-HAIEKAYHCPFFNSATPPDLRCHN 205

Query: 939 R--FKRRDHVLQHLNKK 953
              F RRD    HL  +
Sbjct: 206 SGGFSRRDTYKTHLKAR 222

>AFR461C [3653] [Homologous to ScYDR463W (STP1) - SH]
           (1269565..1271199) [1635 bp, 544 aa]
          Length = 544

 Score = 33.5 bits (75), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 28/64 (43%), Gaps = 13/64 (20%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCP----------KCGKR--FKRRDHVLQH 949
           +VC  C  +F    +LTRH K  H+ EK + CP          +C     F RRD    H
Sbjct: 152 FVCHYCDAEFRIRGYLTRHIKK-HAVEKAYHCPFFNSHVPPETRCHTTGGFSRRDTYKTH 210

Query: 950 LNKK 953
           L  +
Sbjct: 211 LRSR 214

>YHR006W (STP2) [2292] chr8 (117808..119433) Transcription factor
           involved in regulating transcription of amino acid
           permease genes, functions redundantly with Stp1p, which
           is involved in tRNA splicing and branched-chain amino
           acid uptake [1626 bp, 541 aa]
          Length = 541

 Score = 33.5 bits (75), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 34/86 (39%), Gaps = 19/86 (22%)

Query: 880 SVEAQGPKFEKGEVILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCP----- 934
           S E QG   E  E +       Y+C  C  +F    +LTRH K  H+  K + CP     
Sbjct: 188 SDEVQGIADESSETL------PYICHYCDARFRIRGYLTRHIKK-HAKRKAYHCPFFDNS 240

Query: 935 -----KCGKR--FKRRDHVLQHLNKK 953
                +C     F RRD    HL  +
Sbjct: 241 ISQELRCHTSGGFSRRDTYKTHLKSR 266

>CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces
           cerevisiae YPR022c, hypothetical start
          Length = 1162

 Score = 33.5 bits (75), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 35/85 (41%), Gaps = 18/85 (21%)

Query: 874 ARSKSKSVEAQGPKFEKGEVILSDSGKIYVCQE--CKRQFSSGHHLTRHKKSVHSGE--- 928
            R +SK+V           V+  D    Y C    C + FS   HL+RHK +    E   
Sbjct: 26  VRKRSKTVSM---------VVGEDGQYRYKCPHPTCDKSFSRQEHLSRHKLNHWPKEIFK 76

Query: 929 ----KPHSCPKCGKRFKRRDHVLQH 949
                P S   CGK F RRD + +H
Sbjct: 77  CHYVSPLSGQPCGKTFVRRDLLNRH 101

>YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predicted
           transcription factor with two tandem C2H2-type zinc
           fingers, contains Q/N-rich regions which may mediate
           prion-like aggregation [3402 bp, 1133 aa]
          Length = 1133

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 7/51 (13%)

Query: 906 ECKRQFSSGHHLTRHKKS-------VHSGEKPHSCPKCGKRFKRRDHVLQH 949
           EC + FS   HL+RHK +       V S   P +   C K F R+D +++H
Sbjct: 37  ECNKTFSRQEHLSRHKLNHWPKEIYVCSYVLPTTNAPCNKTFVRKDLLIRH 87

>KLLA0A10373g complement(907244..907864) some similarities with
           ca|CA1157|CaPZF1 Candida albicans TFIIIA (transcription
           initiation factor) (by homology), hypothetical start
          Length = 206

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 5/55 (9%)

Query: 900 KIYVC--QECKRQFSSGHHLTRHKKSVHSGEKPHSCPK--CGKRFKRRDHVLQHL 950
           K YVC  + C +++S    L +H +S H+ EKP  CP+  C K F R  H+  H+
Sbjct: 6   KRYVCPIESCGKKYSRPCLLRQHVRS-HTNEKPFHCPEPGCDKAFLRPSHLRVHM 59

>YHL027W (RIM101) [2259] chr8 (51109..52986) Transcription factor
           involved in induction of IME1, IME2, DIT1, and DIT2
           transcription, has three C2H2-type zinc fingers [1878
           bp, 625 aa]
          Length = 625

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 1/45 (2%)

Query: 906 ECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           +C  +     H+T H + VH   KP  C  C K+FKR   + +HL
Sbjct: 188 DCTTKTEKRDHITSHLR-VHVPLKPFGCSTCSKKFKRPQDLKKHL 231

>Kwal_33.14227
          Length = 551

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 63/148 (42%), Gaps = 31/148 (20%)

Query: 836 TYESSPLMSLAAAANKDIELTNSMMRPSRSKTKLPTDK------ARSKSKSVEAQGPKFE 889
           T  SS L+S  +      +LT+S    S++ T LP         +R KS +   Q P  +
Sbjct: 381 TAPSSNLVSRESTPADGAKLTSSRT-ASQTSTPLPVPNRKKKYPSRRKSSNATPQVPTIK 439

Query: 890 KGEV---ILSDSG---KIYVCQ--------ECKRQFSSGHHLTRHKKSVH-SGEKPHSCP 934
           K        + SG   +++ CQ         C ++FS  + L RH+K++H S +K   C 
Sbjct: 440 KRTSPVPFTTASGNLQEVHTCQLMNPITSEPCSKKFSRPYDLIRHQKTIHASKKKVFRCV 499

Query: 935 KC---------GKRFKRRDHVLQHLNKK 953
            C          K F R D + +H+  K
Sbjct: 500 FCIQQQGAEGYQKTFSRGDALSRHIKVK 527

>Kwal_27.11573
          Length = 956

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 53/111 (47%), Gaps = 9/111 (8%)

Query: 764 GLNTTLSYPIPTEKQLSNLNPVNNSNYQAAS-PALMDDKNNINPNQNMNSLLDMGLSAFQ 822
           GL+T   YP+  E+QL     V+   + A+   A   +K  +     +N LL+M     +
Sbjct: 645 GLSTKSLYPLVHEQQLLEQEQVDQQPFSASELSAAAGEKEEL----TLNELLNMSELDDE 700

Query: 823 NSPSN-GLRQISSETYESSPLMSLAAAANKDIELT--NSMMRPSRSKTKLP 870
           + P N G  Q +SE YE  P + L+A  NK +++   +  M P  S  K P
Sbjct: 701 DGPENTGSTQPTSEWYE-KPKVPLSAFRNKGVDVAHDDEYMLPVFSARKCP 750

>AFR190C [3382] [Homologous to ScYHL027W (RIM101) - SH]
           (783110..784408) [1299 bp, 432 aa]
          Length = 432

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 907 CKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 950
           C  +     H+T H + VH   KP SC  C ++FKR   + +HL
Sbjct: 113 CTTKTVKRDHITSHLR-VHVPLKPFSCSTCSRKFKRPQDLKKHL 155

>KLLA0C00286g 19668..21206 similar to ca|CA3134|IPF11499.repeat2
           Candida albicans unknown function, start by similarity
          Length = 512

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 28/44 (63%), Gaps = 6/44 (13%)

Query: 458 DNTFGDN----SNPATNIKMESNKTK--IEANVPGVAKKLRGFD 495
           +  FGDN    ++PA +++   N+TK   E+ +PG  +KL+GF+
Sbjct: 469 EQLFGDNDLDVTHPAHDLRWRENETKSEFESRLPGALEKLKGFN 512

>ADL042W [1699] [Homologous to ScYPR015C - SH]
           complement(615818..616663) [846 bp, 281 aa]
          Length = 281

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 903 VCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPK--CGKRFKRRDHVLQHLNK 952
           VC+ C + F     L  H   VH+ +KP++C    C KRF  + ++L+H+ K
Sbjct: 226 VCEICGKDFKRPSALRTHM-VVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRK 276

>ADL040W [1701] [Homologous to ScYPR013C - SH]
           complement(618855..619847) [993 bp, 330 aa]
          Length = 330

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 3/50 (6%)

Query: 904 CQECKRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQHLN 951
           C  C R+ +    L  H   +H+GE P  C  P C KRF  R ++ +H+N
Sbjct: 260 CLVCGRRCTRPSTLKTHML-IHTGELPFQCSWPGCSKRFNVRSNMNRHVN 308

>Kwal_55.20634
          Length = 419

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 36/82 (43%), Gaps = 14/82 (17%)

Query: 882 EAQGPKFEKGEVILSDSGKIYV-----------CQ--ECKRQFSSGHHLTRHKKSVHSGE 928
           EA G KF + E++       +V           C+  +C  +     H+T H + VH   
Sbjct: 61  EACGQKFAQPELLYHHLCHDHVGRKSQKNLQLNCRWGKCTAKTVKRDHITSHLR-VHVPL 119

Query: 929 KPHSCPKCGKRFKRRDHVLQHL 950
           KP +C  C K FKR   + +HL
Sbjct: 120 KPFACSTCTKTFKRPQDLKKHL 141

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 32/77 (41%), Gaps = 9/77 (11%)

Query: 897 DSGKIYVC--QECKRQFSSGHHLTRHKKSVHSGEKPH-----SC--PKCGKRFKRRDHVL 947
           DS  +  C  + C ++F+    L  H    H G K       +C   KC  +  +RDH+ 
Sbjct: 51  DSNIVLTCDWEACGQKFAQPELLYHHLCHDHVGRKSQKNLQLNCRWGKCTAKTVKRDHIT 110

Query: 948 QHLNKKIPCIPGVGSSA 964
            HL   +P  P   S+ 
Sbjct: 111 SHLRVHVPLKPFACSTC 127

>Scas_670.2
          Length = 435

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 47/102 (46%), Gaps = 15/102 (14%)

Query: 859 MMRPSRSKTKLPT---DKARSKSKSVEAQGPKFEKGEVILSDSGKIYVCQECKRQ----- 910
           +M P   K K PT   + +  KS+SV    P      +I        V  + KR+     
Sbjct: 200 IMSPPIPKLKTPTIATNNSNVKSRSVTPAVPAPTNATLI----NDPLVSAKTKRRKKQCP 255

Query: 911 FSSGHH--LTRHKKS-VHSGEKPHSCPKCGKRFKRRDHVLQH 949
             SG++  LT HK + +   ++PH CP C + F R + +++H
Sbjct: 256 ICSGYYANLTTHKATHLVPEDRPHKCPICQRGFGRNNDLIRH 297

>Kwal_26.9300
          Length = 304

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 16/24 (66%)

Query: 929 KPHSCPKCGKRFKRRDHVLQHLNK 952
           KPH CP CG+ F R + +L+H  +
Sbjct: 171 KPHKCPVCGRGFTRHNDLLRHRKR 194

>Sklu_2359.5 YPR022C, Contig c2359 10655-12818
          Length = 722

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 9/57 (15%)

Query: 902 YVCQE--CKRQFSSGHHLTRHKKSVHSGE-------KPHSCPKCGKRFKRRDHVLQH 949
           YVC    C + F+   HL+RHK +    E        P     C + F RRD +++H
Sbjct: 16  YVCPHPNCSKSFTRQEHLSRHKLNHWPKEIFRCHYVYPEDGVACNRTFVRRDLLVRH 72

>Scas_712.2
          Length = 327

 Score = 30.8 bits (68), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 3/52 (5%)

Query: 902 YVC--QECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLN 951
           Y+C  + C ++F    HL  HK + HS  KP  C  C K F     + +HLN
Sbjct: 43  YICDVEGCGKRFMRPCHLKVHKWT-HSKVKPLKCAFCEKGFITNQQLKRHLN 93

>YLR375W (YLR375W) [3755] chr12 (871696..872727) Protein with strong
           similarity to Stp1p, which is involved in tRNA splicing
           and branched-chain amino acid uptake [1032 bp, 343 aa]
          Length = 343

 Score = 30.8 bits (68), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 4/47 (8%)

Query: 904 CQECKRQFSSGHHLTRHKKSVHSGE-KPHSCPKCGKRFKRRDHVLQH 949
           C  C+  +++   LT HK +  + E +PH CP C + F R + +L+H
Sbjct: 144 CPICRNFYAN---LTTHKATHLTPEDRPHKCPICHRGFARNNDLLRH 187

>Scas_591.8
          Length = 680

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 1/44 (2%)

Query: 251 HFGAPKQWYSIPQEDHEKFYEFMKEKFPEEASKCKEFLR-HKMF 293
           HFG  +   S    D  KF+EF KE   E A K  EF +  KM+
Sbjct: 630 HFGIDRFGVSGKGPDAFKFFEFTKEGVTERARKAMEFYKGRKMY 673

>CAGL0K06413g 627811..628890 some similarities with sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1, hypothetical
           start
          Length = 359

 Score = 30.0 bits (66), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 32/74 (43%), Gaps = 14/74 (18%)

Query: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCP----------KCGKR--FKRRDHVLQH 949
           +VC  C  +F    +LTRH K  H+ +K + CP          +C     F RRD    H
Sbjct: 41  FVCHYCDARFKIRGYLTRHIKK-HALQKAYYCPYYNEKAPPDLRCHNNGGFSRRDTYKAH 99

Query: 950 LNKKIPCIP-GVGS 962
           +  +    P GV S
Sbjct: 100 MKTRHIMYPSGVKS 113

>Scas_683.30
          Length = 478

 Score = 30.0 bits (66), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 6/73 (8%)

Query: 878 SKSVEAQGPKFEKGEVILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGE-KPHSCPKC 936
           + + +  G    KG V  +   K   C  C   +++   L+ HK +  + E +PH CP C
Sbjct: 265 TNATDKTGSGNNKGSVTKTRRKK--QCPTCLNYYAN---LSTHKSTHLTPEDRPHKCPIC 319

Query: 937 GKRFKRRDHVLQH 949
            + F R + +++H
Sbjct: 320 ERGFARNNDLIRH 332

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.130    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 32,531,213
Number of extensions: 1507670
Number of successful extensions: 6033
Number of sequences better than 10.0: 275
Number of HSP's gapped: 5976
Number of HSP's successfully gapped: 347
Length of query: 965
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 854
Effective length of database: 12,753,511
Effective search space: 10891498394
Effective search space used: 10891498394
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 66 (30.0 bits)