Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L11858g53152327910.0
YER168C (CCA1)54651317240.0
Scas_681.2054351817100.0
Sklu_1964.251951015050.0
Kwal_56.2346151951214000.0
KLLA0C17688g48951311181e-148
AGR118W53350910291e-134
Kwal_23.4111110893721.1
YGR128C (UTP8)71362692.8
Kwal_14.109794228657.8
CAGL0K03839g30481639.0
YLR197W (SIK1)504117649.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L11858g
         (523 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L11858g complement(1270455..1272050) similar to tr|Q9P4S5 S...  1079   0.0  
YER168C (CCA1) [1596] chr5 complement(521024..522664) tRNA nucle...   668   0.0  
Scas_681.20                                                           663   0.0  
Sklu_1964.2 YER168C, Contig c1964 2064-3623 reverse complement        584   0.0  
Kwal_56.23461                                                         543   0.0  
KLLA0C17688g complement(1565906..1567375) gi|9836828|gb|AAG00316...   435   e-148
AGR118W [4429] [Homologous to ScYER168C (CCA1) - SH] complement(...   400   e-134
Kwal_23.4111                                                           32   1.1  
YGR128C (UTP8) [2085] chr7 complement(747953..750094) Protein co...    31   2.8  
Kwal_14.1097                                                           30   7.8  
CAGL0K03839g 358323..359237 similar to sp|Q04223 Saccharomyces c...    29   9.0  
YLR197W (SIK1) [3600] chr12 (546099..547613) Nucleolar protein c...    29   9.1  

>CAGL0L11858g complement(1270455..1272050) similar to tr|Q9P4S5
           Saccharomyces cerevisiae YER168c tRNA
           nucleotidyltransferase, hypothetical start
          Length = 531

 Score = 1079 bits (2791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/523 (100%), Positives = 523/523 (100%)

Query: 1   MFKAIRRVFTMIPRIQLTEKETRICNLLKDYTAHYNSLHYGQEPLTLRITGGWVRDKLLG 60
           MFKAIRRVFTMIPRIQLTEKETRICNLLKDYTAHYNSLHYGQEPLTLRITGGWVRDKLLG
Sbjct: 1   MFKAIRRVFTMIPRIQLTEKETRICNLLKDYTAHYNSLHYGQEPLTLRITGGWVRDKLLG 60

Query: 61  QGSHDLDIAINIMSGEEFATGLNGYLLEHFDKYGVKPHSIHKIDKNPEKSKHLETATTKL 120
           QGSHDLDIAINIMSGEEFATGLNGYLLEHFDKYGVKPHSIHKIDKNPEKSKHLETATTKL
Sbjct: 61  QGSHDLDIAINIMSGEEFATGLNGYLLEHFDKYGVKPHSIHKIDKNPEKSKHLETATTKL 120

Query: 121 FDVEVDFVNLRSEEYTEDSRIPTTQFGTPEEDALRRDATLNALFYNIQQDAVEDFTKRGW 180
           FDVEVDFVNLRSEEYTEDSRIPTTQFGTPEEDALRRDATLNALFYNIQQDAVEDFTKRGW
Sbjct: 121 FDVEVDFVNLRSEEYTEDSRIPTTQFGTPEEDALRRDATLNALFYNIQQDAVEDFTKRGW 180

Query: 181 QDLQDGVLRTPLPARQTFLDDPLRVLRLIRFASRFNFNIEAGVLKEMHDPEINEAFNNKI 240
           QDLQDGVLRTPLPARQTFLDDPLRVLRLIRFASRFNFNIEAGVLKEMHDPEINEAFNNKI
Sbjct: 181 QDLQDGVLRTPLPARQTFLDDPLRVLRLIRFASRFNFNIEAGVLKEMHDPEINEAFNNKI 240

Query: 241 SRERIGVEMEKILVGPNPILGLKLIQRTHLENVIFLWHGDQSVIEYNRKNWPQTKDVEDI 300
           SRERIGVEMEKILVGPNPILGLKLIQRTHLENVIFLWHGDQSVIEYNRKNWPQTKDVEDI
Sbjct: 241 SRERIGVEMEKILVGPNPILGLKLIQRTHLENVIFLWHGDQSVIEYNRKNWPQTKDVEDI 300

Query: 301 YKKGIFNHHLKNFIHHYKDFLSRYLKLRQAIETKDKSFQQNFLLASILIPMADLKIIALP 360
           YKKGIFNHHLKNFIHHYKDFLSRYLKLRQAIETKDKSFQQNFLLASILIPMADLKIIALP
Sbjct: 301 YKKGIFNHHLKNFIHHYKDFLSRYLKLRQAIETKDKSFQQNFLLASILIPMADLKIIALP 360

Query: 361 KKKLNNTLPVSESIVREGLKFNKASSIVVARCVENIAAYNSMVEKYLQSGDLKRSEVGTF 420
           KKKLNNTLPVSESIVREGLKFNKASSIVVARCVENIAAYNSMVEKYLQSGDLKRSEVGTF
Sbjct: 361 KKKLNNTLPVSESIVREGLKFNKASSIVVARCVENIAAYNSMVEKYLQSGDLKRSEVGTF 420

Query: 421 LRELRGDWEIVHYVSLMDQYLKYISRKDNVVNIIDKYDRFWNYIQEQNLQDSDKMVPIID 480
           LRELRGDWEIVHYVSLMDQYLKYISRKDNVVNIIDKYDRFWNYIQEQNLQDSDKMVPIID
Sbjct: 421 LRELRGDWEIVHYVSLMDQYLKYISRKDNVVNIIDKYDRFWNYIQEQNLQDSDKMVPIID 480

Query: 481 GKRMVKILETKPGPWLGKINDEVILWQFDHPQGTEQELISFIK 523
           GKRMVKILETKPGPWLGKINDEVILWQFDHPQGTEQELISFIK
Sbjct: 481 GKRMVKILETKPGPWLGKINDEVILWQFDHPQGTEQELISFIK 523

>YER168C (CCA1) [1596] chr5 complement(521024..522664) tRNA
           nucleotidyltransferase (tRNA CCA-pyrophosphorylase),
           carries out addition of CCA to 3' end without a
           template, involved in Los1p-independent tRNA nuclear
           export [1641 bp, 546 aa]
          Length = 546

 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/513 (62%), Positives = 395/513 (76%), Gaps = 3/513 (0%)

Query: 13  PRIQLTEKETRICNLLKDYTAHYNS-LHYGQEPLTLRITGGWVRDKLLGQGSHDLDIAIN 71
           P+I LT+ E  ICNLL DYT  YN   H   EPLTLRITGGWVRDKLLGQGSHDLDIAIN
Sbjct: 28  PKITLTKVEQNICNLLNDYTDLYNQKYHNKPEPLTLRITGGWVRDKLLGQGSHDLDIAIN 87

Query: 72  IMSGEEFATGLNGYLLEHFDKYGVKPHSIHKIDKNPEKSKHLETATTKLFDVEVDFVNLR 131
           +MSGE+FATGLN YL +H+ KYG KPH+IHKIDKNPEKSKHLETATTKLF VEVDFVNLR
Sbjct: 88  VMSGEQFATGLNEYLQQHYAKYGAKPHNIHKIDKNPEKSKHLETATTKLFGVEVDFVNLR 147

Query: 132 SEEYTEDSRIPTTQFGTPEEDALRRDATLNALFYNIQQDAVEDFTKRGWQDLQDGVLRTP 191
           SE+YTE SRIP   FGTPEEDALRRDATLNALFYNI +  VEDFTKRG QDL+DGVLRTP
Sbjct: 148 SEKYTELSRIPKVCFGTPEEDALRRDATLNALFYNIHKGEVEDFTKRGLQDLKDGVLRTP 207

Query: 192 LPARQTFLDDPLRVLRLIRFASRFNFNIEAGVLKEMHDPEINEAFNNKISRERIGVEMEK 251
           LPA+QTFLDDPLRVLRLIRFASRFNF I+  V+ EM DP+IN AFN+KISRER+GVEMEK
Sbjct: 208 LPAKQTFLDDPLRVLRLIRFASRFNFTIDPEVMAEMGDPQINVAFNSKISRERVGVEMEK 267

Query: 252 ILVGPNPILGLKLIQRTHLENVIFLWHGDQSVIEYNRKNWPQTKDVEDIYKKGIFNHHLK 311
           ILVGP P+L L+LIQR HLENVIF WH D SV+++N +N      +  +Y   I N HLK
Sbjct: 268 ILVGPTPLLALQLIQRAHLENVIFFWHNDSSVVKFNEENCQDMDKINHVYNDNILNSHLK 327

Query: 312 NFIHHYKDFLSRYLKLRQAIETKDKSFQQNFLLASILIPMADLKIIALPKKKLNNTLPVS 371
           +FI  Y  FL +   LR+ I  +   FQQNF+L++IL PMA+L+II  PKKK+NN + V+
Sbjct: 328 SFIELYPMFLEKLPILREKI-GRSPGFQQNFILSAILSPMANLQIIGNPKKKINNLVSVT 386

Query: 372 ESIVREGLKFNKASSIVVARCVENIAAYNSMVEKYLQSGDLKRSEVGTFLRELRGDWEIV 431
           ESIV+EGLK +K  + V+A+ V++I +Y  ++ K+     LK+SE+G FLR   G+WE  
Sbjct: 387 ESIVKEGLKLSKNDAAVIAKTVDSICSYEEILAKFADRSQLKKSEIGIFLRNFNGEWETA 446

Query: 432 HYVSLMDQYLKYISRKDNVVNII-DKYDRFWNYIQEQNLQDSDKMVPIIDGKRMVKILET 490
           H+ SL D +LK    +   + ++   Y+ F++YI + NL +  ++ PI+DGK+M K+L+ 
Sbjct: 447 HFASLSDAFLKIPKLETKKIELLFQNYNEFYSYIFDNNLNNCHELKPIVDGKQMAKLLQM 506

Query: 491 KPGPWLGKINDEVILWQFDHPQGTEQELISFIK 523
           KPGPWLGKIN+E I WQFD+P GT+QELI+ +K
Sbjct: 507 KPGPWLGKINNEAIRWQFDNPTGTDQELITHLK 539

>Scas_681.20
          Length = 543

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/518 (61%), Positives = 409/518 (78%), Gaps = 5/518 (0%)

Query: 10  TMIPRIQLTEKETRICNLLKDYTAHYNSLHYG-QEPLTLRITGGWVRDKLLGQGSHDLDI 68
           T+ P I+LT  E  IC LL DYT HYN  H   +EPLTLRITGGWVRDKLLGQGSHDLDI
Sbjct: 21  TLPPIIKLTPIEKDICKLLNDYTLHYNQTHLDIKEPLTLRITGGWVRDKLLGQGSHDLDI 80

Query: 69  AINIMSGEEFATGLNGYLLEHFDKYGVKPHSIHKIDKNPEKSKHLETATTKLFDVEVDFV 128
           AINIMSGE FA GLN YL +H+ +YG+KPHSIHKIDKNPEKSKHLETATTKLFD+EVDFV
Sbjct: 81  AINIMSGESFARGLNEYLTKHYARYGIKPHSIHKIDKNPEKSKHLETATTKLFDIEVDFV 140

Query: 129 NLRSEEYTEDSRIPTTQFGTPEEDALRRDATLNALFYNIQQDAVEDFTKRGWQDLQDGVL 188
           NLR+EEYTE SRIP T+FGTPEEDALRRDATLNALFYNIQ++ +EDFT++G  DL++G+L
Sbjct: 141 NLRAEEYTELSRIPITKFGTPEEDALRRDATLNALFYNIQENQIEDFTRKGLTDLKNGIL 200

Query: 189 RTPLPARQTFLDDPLRVLRLIRFASRFNFNIEAGVLKEMHDPEINEAFNNKISRERIGVE 248
           RTPLPAR+TFLDDPLRVLRLIRFASRFNF IE  VLKEM +PEIN AF  KISRER+G E
Sbjct: 201 RTPLPARKTFLDDPLRVLRLIRFASRFNFTIEDNVLKEMSNPEINAAFITKISRERVGNE 260

Query: 249 MEKILVGPNPILGLKLIQRTHLENVIFLWHGDQSVIEYNR-KNWPQTKDVEDIYKKGIFN 307
           MEKIL+G NPILGL LIQ+ HLEN IF WH D S+IE N   N  Q + ++ IY++GI N
Sbjct: 261 MEKILIGNNPILGLSLIQQAHLENAIFFWHNDPSIIECNETSNKEQMQTIQKIYQEGILN 320

Query: 308 HHLKNFIHHYKDFLSRYLKLRQAIETKDKSFQQNFLLASILIPMADLKIIALPKKKLNNT 367
            HL   I +Y+  LSR   L+  I   + +F+QNF+LAS L+P A L+IIALPKKKLNNT
Sbjct: 321 KHLLKVIDNYQLLLSRSPILQSHI-LNNNTFKQNFILASSLLPFATLRIIALPKKKLNNT 379

Query: 368 LPVSESIVREGLKFNKASSIVVARCVENIAAYNSMVEKYLQ-SGDLKRSEVGTFLRELRG 426
             VSESI++EGLK NK  + +V++ VEN++ + +++++++Q S  L+RS++GT+LR   G
Sbjct: 380 CYVSESIIKEGLKMNKLDAKIVSQTVENVSKHKALIKEFVQNSNSLQRSKLGTYLRSYSG 439

Query: 427 DWEIVHYVSLMDQYLKYISRKDN-VVNIIDKYDRFWNYIQEQNLQDSDKMVPIIDGKRMV 485
            WEIVH+V+L+++++   S  D+  + +   Y+ F+++I +Q L++  +M P+IDGK+M+
Sbjct: 440 HWEIVHFVALLEEFINLQSNDDHTAIELFKDYNSFYSFILDQGLKNCHEMKPLIDGKKML 499

Query: 486 KILETKPGPWLGKINDEVILWQFDHPQGTEQELISFIK 523
           K+L  K GPW+ ++N+ +I+WQFD+P GTE +L+ +IK
Sbjct: 500 KVLNMKAGPWMSELNNNIIVWQFDNPNGTEAQLLEYIK 537

>Sklu_1964.2 YER168C, Contig c1964 2064-3623 reverse complement
          Length = 519

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/510 (56%), Positives = 377/510 (73%), Gaps = 16/510 (3%)

Query: 15  IQLTEKETRICNLLKDYTAHYNSLHY-GQEPLTLRITGGWVRDKLLGQGSHDLDIAINIM 73
           +QLT+ E  +C LLKDY AHYN+      EPLTLRITGGWVRDKLLG  SHDLDIA+N M
Sbjct: 18  LQLTKIEQDVCGLLKDYVAHYNATATKSSEPLTLRITGGWVRDKLLGHLSHDLDIAVNNM 77

Query: 74  SGEEFATGLNGYLLEHFDKYGVKPHSIHKIDKNPEKSKHLETATTKLFDVEVDFVNLRSE 133
           +GE+FATGLN YL EH+ KYG+KPHSIHKIDKNP KSKHLETATTKLF VEVDFVNLRSE
Sbjct: 78  TGEQFATGLNTYLTEHYSKYGIKPHSIHKIDKNPAKSKHLETATTKLFGVEVDFVNLRSE 137

Query: 134 EYTEDSRIPTTQFGTPEEDALRRDATLNALFYNIQQDAVEDFTKRGWQDLQDGVLRTPLP 193
           EYT +SRIP    GTP +DA+RRDATLNALFYNIQQ+ +ED+T RG +DL DGVLRTPLP
Sbjct: 138 EYTTESRIPIVACGTPAQDAMRRDATLNALFYNIQQEQIEDYTGRGLKDLHDGVLRTPLP 197

Query: 194 ARQTFLDDPLRVLRLIRFASRFNFNIEAGVLKEMHDPEINEAFNNKISRERIGVEMEKIL 253
            +QTFLDDPLRVLRLIRFASRFNF+I+    + M D EIN+AF  KISRER+GVE++KIL
Sbjct: 198 PKQTFLDDPLRVLRLIRFASRFNFSIDEETYEAMKDQEINQAFEVKISRERVGVELQKIL 257

Query: 254 VGPNPILGLKLIQRTHLENVIFLWHGDQSVIEYNRKNWPQTKDVEDIYKKGIFNHHLKNF 313
            GPNP+ GL LIQ   LENVIF WH D +VI+YN K+   + DVE +YK+   + H+   
Sbjct: 258 TGPNPLRGLHLIQGASLENVIFYWHNDLAVIDYNNKHTDMS-DVELVYKQ--LSSHIDVV 314

Query: 314 IHHYKDFLSRYLKLRQAIETKDKSFQQNFLLASILIPMADLKIIALPKKKLNNTLPVSES 373
           +H+    L     L++  ++ D  F+QNF+L   L P + L II+ P KK++N L V+ES
Sbjct: 315 LHNIPKLLQALPHLKEKYDS-DAVFKQNFILGVTLAPFSTLSIISNP-KKMHNRLSVTES 372

Query: 374 IVREGLKFNKASSIVVARCVENIAAYNSMVEKYLQSGDLKRSEVGTFLRELRGDWEIVHY 433
           I++EGLKF K  + VVA+CV+    +  +V+       +KRS+VGT LR   GDW++ HY
Sbjct: 373 IIKEGLKFGKNDAEVVAKCVDTKDQFQEIVKNI---DHVKRSQVGTLLRSYYGDWQLAHY 429

Query: 434 VSLMDQYLKYISRKDNVVNIIDKYDRFWNYIQEQNLQDSDKMVPIIDGKRMVKILETKPG 493
           ++L  +Y  Y S      N++ +Y+RF+ Y+ +Q+L++   + P++DGK++ K+L+ KPG
Sbjct: 430 INLSLEYF-YDS------NVLGRYERFYTYVVKQDLENCHILKPLVDGKKLSKLLQMKPG 482

Query: 494 PWLGKINDEVILWQFDHPQGTEQELISFIK 523
           PW+GK+N++++LWQ D+P   E+EL+ F+K
Sbjct: 483 PWMGKVNNQLLLWQLDNPGKGEEELLEFVK 512

>Kwal_56.23461
          Length = 519

 Score =  543 bits (1400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/512 (53%), Positives = 363/512 (70%), Gaps = 14/512 (2%)

Query: 11  MIPRIQLTEKETRICNLLKDYTAHYNSLHYGQEPLTLRITGGWVRDKLLGQGSHDLDIAI 70
           M  ++ LT+ E  IC LL+DY+  YN+ + G+EPL LRITGGWVRDK+LG  SHDLDIA+
Sbjct: 14  MATKLTLTKTEQDICGLLRDYSREYNAANAGKEPLMLRITGGWVRDKILGFDSHDLDIAV 73

Query: 71  NIMSGEEFATGLNGYLLEHFDKYGVKPHSIHKIDKNPEKSKHLETATTKLFDVEVDFVNL 130
           N M+GE+ A GL+ +L  +   YG+ PHSIHKIDKNPEKSKHLETATTKLF +EVDFVNL
Sbjct: 74  NTMTGEQLALGLSDFLTRNHQLYGITPHSIHKIDKNPEKSKHLETATTKLFGIEVDFVNL 133

Query: 131 RSEEYTEDSRIPTTQFGTPEEDALRRDATLNALFYNIQQDAVEDFTKRGWQDLQDGVLRT 190
           RSEEYT DSRIP   FGTP++DALRRDATLNALFYNIQ D +EDFT  G +DL+ GVLRT
Sbjct: 134 RSEEYTNDSRIPVVAFGTPKQDALRRDATLNALFYNIQCDKIEDFTGTGIEDLKRGVLRT 193

Query: 191 PLPARQTFLDDPLRVLRLIRFASRFNFNIEAGVLKEMHDPEINEAFNNKISRERIGVEME 250
           PLP RQTFLDDPLRVLRLIRFASRF F I+    + M DPEIN+AF  KISRER+G EM+
Sbjct: 194 PLPPRQTFLDDPLRVLRLIRFASRFGFIIDPETYQAMQDPEINKAFEIKISRERVGAEMQ 253

Query: 251 KILVGPNPILGLKLIQRTHLENVIFLWHGDQSVIEYNRKNWPQTKDVEDIYKKGIFNHHL 310
           KIL GPNP+LGLKLIQ  +L+NVIF WH D  +I YNR+N   T+ +E  Y+K  F+ H+
Sbjct: 254 KILQGPNPLLGLKLIQGANLQNVIFHWHSDPVIIAYNRENVDMTEALE-AYQK--FSKHI 310

Query: 311 KNFIHHYKDFLSRYLKLRQAIETKDKSFQQNFLLASILIPMADLKIIALPKKKLNNTLPV 370
              +      L+ + K++   +T+  +F+QNFLL+ IL P   +KI+  P+K LN   P+
Sbjct: 311 ALVLEKLPVLLNSFPKIQNDWDTQ-PTFKQNFLLSIILAPFRGIKIVWNPQKLLNREAPI 369

Query: 371 SESIVREGLKFNKASSIVVARCVENIAAYNSMVEKYLQSGDLKRSEVGTFLRELRGDWEI 430
           +ESIV++GLK  K  S ++++CVE+  AYN MV K+     L RSE+G  +R+ +GDWE+
Sbjct: 370 TESIVKDGLKLGKNDSELISKCVESHLAYNKMVLKF---ESLSRSEIGLVIRDFKGDWEL 426

Query: 431 VHYVSLMDQYLKYISRKDNVVNIIDKYDRFWNYIQEQNLQDSDKMVPIIDGKRMVKILET 490
            H  +L   Y    +        + +Y  F+ ++  +NL++S  + P+IDGK + K L+ 
Sbjct: 427 AHLANLALAYCFDETS-------LGQYQNFYKFVFNENLENSHLLKPLIDGKSLSKRLKI 479

Query: 491 KPGPWLGKINDEVILWQFDHPQGTEQELISFI 522
           KPG W+G +  E+I WQ D+P  TE+E++ F+
Sbjct: 480 KPGRWMGGVVSEMIKWQLDNPTATEEEVLEFV 511

>KLLA0C17688g complement(1565906..1567375)
           gi|9836828|gb|AAG00316.1|AF207744_1 Kluyveromyces lactis
           tRNA nucleotidyltransferase, start by similarity
          Length = 489

 Score =  435 bits (1118), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 232/513 (45%), Positives = 324/513 (63%), Gaps = 35/513 (6%)

Query: 8   VFTMIP-RIQLTEKETRICNLLKDYTAHYNSLHYGQEPLTLRITGGWVRDKLLGQGSHDL 66
           +F M+  +IQL + E+ IC L+K++ +HYN  +   EPL  RITGGWVRDKLLG  S+DL
Sbjct: 1   MFKMVASKIQLNKVESEICTLVKEFCSHYNKANAETEPLVARITGGWVRDKLLGNDSNDL 60

Query: 67  DIAINIMSGEEFATGLNGYLLEHFDKYGVKPHSIHKIDKNPEKSKHLETATTKLFDVEVD 126
           DIAIN M+GE+FA  L  +L +     G++ HS+H IDKNP KSKHLET TTKLFDV VD
Sbjct: 61  DIAINNMTGEQFAEKLCAFLQDR----GLETHSLHTIDKNPSKSKHLETCTTKLFDVPVD 116

Query: 127 FVNLRSEEYTEDSRIPTTQFGTPEEDALRRDATLNALFYNIQQDAVEDFTKRGWQDLQDG 186
           FVNLRSEEYT +SRIP  +FGTP +DA+RRDATLNA+FYNI +D +EDFTK+G+QDL DG
Sbjct: 117 FVNLRSEEYTMESRIPKVEFGTPYDDAMRRDATLNAMFYNITEDKIEDFTKKGFQDLNDG 176

Query: 187 VLRTPLPARQTFLDDPLRVLRLIRFASRFNFNIEAGVLKEMHDPEINEAFNNKISRERIG 246
           +LRTPLP RQTF+DDPLRVLRLIRFASRFNF I+    + M DP I+++FN+KIS+ R+ 
Sbjct: 177 ILRTPLPPRQTFIDDPLRVLRLIRFASRFNFQIDPQTYQAMRDPGIHQSFNHKISKGRVY 236

Query: 247 VEMEKILVGPNPILGLKLIQRTHLENVIFLWHGDQSVIEYNRKNWPQTKDVEDIYKKGIF 306
            EM K L   NP   L LIQ  HL  VIF  +               + ++E IY+    
Sbjct: 237 TEMHKTLTSANPFYALDLIQGAHLSRVIFTTN-------------ESSPEIESIYEN--L 281

Query: 307 NHHLKNFIHHYKDFLSRYLKLRQAIETKDKSFQQNFLLASILIPMADLKIIALPKKKLNN 366
           + HLK+ +    + + + LK      +     Q+  +L+ +L     LK     K K  N
Sbjct: 282 DQHLKSLV----ETIPKLLKSHTTFASVFPGMQEPLILSLVLSGFKGLKGPDPAKPK--N 335

Query: 367 TLPVSESIVREGLKFNKASSIVVARCVENIAAYNSMVEKYLQSGDLKRSEVGTFLRELRG 426
           ++P++  I +EGL F       V  CVE+  +Y+++V+       +KRSE+G  LR+L  
Sbjct: 336 SIPLAGVITKEGLNFPNTQVDNVIACVESEDSYHNLVK---NGKSMKRSELGFALRKLGK 392

Query: 427 DWEIVHYVSLMDQYLKYISRKDNVVNIIDKYDRFWNYIQEQNLQDSDKMVPIIDGKRMVK 486
           +W++VH+ +L   YL++          I  YD F+ ++ +  L D   +  II+GK + K
Sbjct: 393 NWQMVHFYNLCLDYLRHGDEP------IPHYDEFYKHVHDCKLDDVYTLKHIINGKELAK 446

Query: 487 ILETKPGPWLGKINDEVILWQFDHPQGTEQELI 519
           +L+ KPG W+G+  D +++WQ D+P  +++  I
Sbjct: 447 LLDRKPGIWMGETLDRILIWQLDNPDISKETFI 479

>AGR118W [4429] [Homologous to ScYER168C (CCA1) - SH]
           complement(967217..968818) [1602 bp, 533 aa]
          Length = 533

 Score =  400 bits (1029), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 213/509 (41%), Positives = 301/509 (59%), Gaps = 33/509 (6%)

Query: 15  IQLTEKETRICNLLKDYTAHYNSLHYGQEPLTLRITGGWVRDKLLGQGSHDLDIAINIMS 74
           IQLT  E RIC++++DY A       G   L  RI GGWVRDKLLG  S DLDI +N ++
Sbjct: 50  IQLTALERRICDVIRDYCAQL-----GDAGLRPRIAGGWVRDKLLGLESEDLDIVLNNVT 104

Query: 75  GEEFATGLNGYLLEHFDKYGVKPHSIHKIDKNPEKSKHLETATTKLFDVEVDFVNLRSEE 134
           GE FA+GL    +E     G     +HKI +NP +SKHLET TT +  V VDFVNLRSE 
Sbjct: 105 GERFASGL----VEFLKAQGGSARGVHKIQRNPARSKHLETCTTTVLGVAVDFVNLRSET 160

Query: 135 YTEDSRIPTTQFGTPEEDALRRDATLNALFYNIQQDAVEDFTKRGWQDLQDGVLRTPLPA 194
           Y E+SR+PT +FGTP +DA+RRDATLNALFYNI +  VEDFT RG  DL  GVLRTP+PA
Sbjct: 161 YAEESRVPTVEFGTPLQDAMRRDATLNALFYNILEGVVEDFTGRGLADLAAGVLRTPMPA 220

Query: 195 RQTFLDDPLRVLRLIRFASRFNFNIEAGVLKEMHDPEINEAFNNKISRERIGVEMEKILV 254
           RQTFLDDPLRVLRL+RFA+RF F ++    + M   +I+ A   KISRER+G E+ K+L 
Sbjct: 221 RQTFLDDPLRVLRLVRFAARFGFELDNEAREGMAYRDIHAALVRKISRERVGTELHKMLT 280

Query: 255 GPNPILGLKLIQRTHLENVIFLWHGDQSVIEYNRKNWPQTKDVEDIYKKGIFNHHLKNFI 314
             +P+ GL+L+    L   +FL          +    P+  +   +      ++ ++   
Sbjct: 281 SADPLYGLRLLCEAGLLPAVFL----------SPDGLPRGAEQHVLG----MDYQVEALC 326

Query: 315 HHYKDFLSRYLKLRQAIETKDKSFQQNFLLASILIPMADLKIIALPKKKLNNTLPVSESI 374
            H      R      A+E  D++F++ FLL+++L     +   +  K+ +   +    SI
Sbjct: 327 AHLSALKERCPGFAAALE--DEAFRERFLLSTVLARFRGVHATSTKKQPVEAVV----SI 380

Query: 375 VREGLKFNKASSIVVARCVENIAAYNSMVEKYLQSGDLKRSEVGTFLRELRGDWEIVHYV 434
           VREGLK  +A+   V   V +I  Y+ MVE Y   G   R+ VG  LR L   W   HY 
Sbjct: 381 VREGLKLGRATVSAVQMAVRSIDDYHEMVENY---GSWSRARVGLQLRGLEDHWRQCHYT 437

Query: 435 SLMDQYLKYISRKDNVVNIIDKYDRFWNYIQEQNLQDSDKMVPIIDGKRMVKILETKPGP 494
           ++  QY    + +D  + +I  Y RF  +++E+ L+D+ K+ P+IDG ++VK+L TK GP
Sbjct: 438 AMACQYF-LAANEDARLALIGLYGRFEQHVREEGLEDAHKLRPMIDGNQLVKLLGTKGGP 496

Query: 495 WLGKINDEVILWQFDHPQGTEQELISFIK 523
           W+ +    ++ WQ +HP GT ++L  +++
Sbjct: 497 WMSRAMSMMVEWQLEHPHGTSEQLADWLQ 525

>Kwal_23.4111
          Length = 1108

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/93 (22%), Positives = 43/93 (46%), Gaps = 3/93 (3%)

Query: 239 KISRERIGVEMEKILVGPNPILGLKLIQRTHLENVIFLWHGDQSVIEYNRKNWPQTKDVE 298
           KI +  +     K+L  P   +  +LIQ    E +IF   GD+ +++ N +NWP    + 
Sbjct: 178 KIGKIGVCAMDAKVLSKPCRHILNRLIQNGEFETIIF---GDKVILDENNENWPTCDFLI 234

Query: 299 DIYKKGIFNHHLKNFIHHYKDFLSRYLKLRQAI 331
             +  G       ++++  K F    L++++ +
Sbjct: 235 SFFSSGFPLSKAIDYVNLRKPFFINDLEMQKVL 267

>YGR128C (UTP8) [2085] chr7 complement(747953..750094) Protein
           component of U3 snoRNP (also called small subunit
           processome), which is required for 18S rRNA biogenesis
           [2142 bp, 713 aa]
          Length = 713

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 2/62 (3%)

Query: 199 LDDPLRVLRLIRFASRFNFNIEAGVLKEMHDPEINEAFNNKISRERIGVEMEKILVGPNP 258
           L  P R+  L + AS  NF+++A  + ++ D   NE+ NN I+    G  + + ++ P P
Sbjct: 4   LSQPFRLATLPKIASLSNFSLQADYV-QVADGTFNESTNN-ITLGISGSSISQYIINPTP 61

Query: 259 IL 260
            L
Sbjct: 62  KL 63

>Kwal_14.1097
          Length = 942

 Score = 29.6 bits (65), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 18/28 (64%)

Query: 390 ARCVENIAAYNSMVEKYLQSGDLKRSEV 417
           A C + IA YN  +E Y+  GD ++S++
Sbjct: 500 APCEKEIAIYNKAIEAYMHMGDTRKSKM 527

>CAGL0K03839g 358323..359237 similar to sp|Q04223 Saccharomyces
           cerevisiae YMR130w, start by similarity
          Length = 304

 Score = 28.9 bits (63), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 38/81 (46%), Gaps = 13/81 (16%)

Query: 64  HDLDIAINIMSGEEFATGLNGYLLEHFDKYGVKPHS---------IHKIDKNPEKSKHL- 113
           H  D  IN M G    TGL G L++  +KYG    S         +HKID N  +S  + 
Sbjct: 214 HIGDEKINDMEGPA-KTGLVGILIDRVNKYGYFDGSFADIKHDLDMHKIDNNSLESWEIG 272

Query: 114 --ETATTKLFDVEVDFVNLRS 132
             +T T ++ D E    NLR+
Sbjct: 273 IKQTDTFQVSDREYVISNLRT 293

>YLR197W (SIK1) [3600] chr12 (546099..547613) Nucleolar protein
           component of box C/D snoRNPs, which are necessary for
           2'-O-methylation of ribosomal RNAs, component of U3
           snoRNP (also called small subunit processome), which is
           required for 18S rRNA biogenesis [1515 bp, 504 aa]
          Length = 504

 Score = 29.3 bits (64), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 55/117 (47%), Gaps = 14/117 (11%)

Query: 343 LLASILIPMADLKIIALPKKKLNNTLPVSE-----SIVREGLKFNKASSIVVARCVENIA 397
           L++  L  + DL +     KK N TL +S+     SI  E    +  S+ +    +  + 
Sbjct: 73  LVSESLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEEFPYVDCISNELAQDLIRGVR 132

Query: 398 AYNSMVEKYLQSGDLKRSEVG---TFLRE------LRGDWEIVHYVSLMDQYLKYIS 445
            +   + K LQSGDL+R+++G    + R        + D  I+  ++L+DQ  K I+
Sbjct: 133 LHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQLDKDIN 189

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.138    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,233,163
Number of extensions: 856818
Number of successful extensions: 2522
Number of sequences better than 10.0: 32
Number of HSP's gapped: 2553
Number of HSP's successfully gapped: 33
Length of query: 523
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 417
Effective length of database: 12,926,601
Effective search space: 5390392617
Effective search space used: 5390392617
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)