Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0L11836g84783538480.0
YER167W (BCK2)8517374249e-43
Scas_681.218464082188e-18
Kwal_56.234626951372001e-15
AGR119C8011561633e-11
KLLA0C17666g7901461518e-10
Scas_636.16d620146800.22
Scas_683.3047824702.9
CAGL0J06732g989102678.3
YLR030W26358659.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L11836g
         (835 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L11836g 1267563..1270106 weakly similar to sp|P33306 Saccha...  1486   0.0  
YER167W (BCK2) [1595] chr5 (518211..520766) Protein involved in ...   167   9e-43
Scas_681.21                                                            89   8e-18
Kwal_56.23462                                                          82   1e-15
AGR119C [4430] [Homologous to ScYER167W (BCK2) - SH] (969101..97...    67   3e-11
KLLA0C17666g 1562996..1565368 some similarities with sp|P33306 S...    63   8e-10
Scas_636.16d                                                           35   0.22 
Scas_683.30                                                            32   2.9  
CAGL0J06732g complement(643534..646503) similar to sp|Q03758 Sac...    30   8.3  
YLR030W (YLR030W) [3448] chr12 (203291..204082) Protein of unkno...    30   9.3  

>CAGL0L11836g 1267563..1270106 weakly similar to sp|P33306
           Saccharomyces cerevisiae YER167w suppressor of mutations
           in protein kinase C pathway components, hypothetical
           start
          Length = 847

 Score = 1486 bits (3848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 738/835 (88%), Positives = 738/835 (88%)

Query: 1   MVSLXXXXXXXXXXDSVNKWRIPHYYKRGKSVGSTPVSEVVNSPLRAVQNEPSVSSPKKI 60
           MVSL          DSVNKWRIPHYYKRGKSVGSTPVSEVVNSPLRAVQNEPSVSSPKKI
Sbjct: 1   MVSLSGSGGKAKSADSVNKWRIPHYYKRGKSVGSTPVSEVVNSPLRAVQNEPSVSSPKKI 60

Query: 61  LLEERNRATPRSRKSSKKGQMVFVNYTXXXXXXXXXXXXXXXXXXXXXXXPKTSAVTQAA 120
           LLEERNRATPRSRKSSKKGQMVFVNYT                       PKTSAVTQAA
Sbjct: 61  LLEERNRATPRSRKSSKKGQMVFVNYTVQDDDETGDKVDDDKADDVADVVPKTSAVTQAA 120

Query: 121 ILDNKHVLTXXXXXXXXXMLKIFGSSKEQVIPLEPESHQDAQKDLAARLIENSAEXXXXX 180
           ILDNKHVLT         MLKIFGSSKEQVIPLEPESHQDAQKDLAARLIENSAE     
Sbjct: 121 ILDNKHVLTSKRKSSRRRMLKIFGSSKEQVIPLEPESHQDAQKDLAARLIENSAESSSNT 180

Query: 181 XXXXXXXXXXXXQGRSYGSFLKYNKFCSGSDRSKNNNASTDFNAMLINNQNKMSNHLALN 240
                       QGRSYGSFLKYNKFCSGSDRSKNNNASTDFNAMLINNQNKMSNHLALN
Sbjct: 181 SNTSSSSSTPNSQGRSYGSFLKYNKFCSGSDRSKNNNASTDFNAMLINNQNKMSNHLALN 240

Query: 241 YSAAKSAEGLLNHFAEDEMVPKSLPDPNLAKPAIRVGPTDRKRSVSSSAIPMKAASSTSL 300
           YSAAKSAEGLLNHFAEDEMVPKSLPDPNLAKPAIRVGPTDRKRSVSSSAIPMKAASSTSL
Sbjct: 241 YSAAKSAEGLLNHFAEDEMVPKSLPDPNLAKPAIRVGPTDRKRSVSSSAIPMKAASSTSL 300

Query: 301 TSKVTKPARKMSTTTTLSNPSSHNTPFTEFENSNLTDSYQYSDPYISRNSNMSNASITSF 360
           TSKVTKPARKMSTTTTLSNPSSHNTPFTEFENSNLTDSYQYSDPYISRNSNMSNASITSF
Sbjct: 301 TSKVTKPARKMSTTTTLSNPSSHNTPFTEFENSNLTDSYQYSDPYISRNSNMSNASITSF 360

Query: 361 ISSMNVGNSTNITPLTESTKVDTNDNFNALMKGHISEPGEENDASVAFTKLFHRKRAXXX 420
           ISSMNVGNSTNITPLTESTKVDTNDNFNALMKGHISEPGEENDASVAFTKLFHRKRA   
Sbjct: 361 ISSMNVGNSTNITPLTESTKVDTNDNFNALMKGHISEPGEENDASVAFTKLFHRKRANTG 420

Query: 421 XXXXXXXXXXXXXXXXXXITKSGVSKISAHRTTSLNSLASIANRFSPIRTASPVRPRSNT 480
                             ITKSGVSKISAHRTTSLNSLASIANRFSPIRTASPVRPRSNT
Sbjct: 421 GSTSSSNSNTTFQNSTQNITKSGVSKISAHRTTSLNSLASIANRFSPIRTASPVRPRSNT 480

Query: 481 RSSSTCRHSRDLSGLVPLTTPEYLGPSTGTEVYLDTQSKRTVNHKKKQESISELSKFQNT 540
           RSSSTCRHSRDLSGLVPLTTPEYLGPSTGTEVYLDTQSKRTVNHKKKQESISELSKFQNT
Sbjct: 481 RSSSTCRHSRDLSGLVPLTTPEYLGPSTGTEVYLDTQSKRTVNHKKKQESISELSKFQNT 540

Query: 541 PTSNNHHTANLATTPSSFLGTSYFANHPGQQTSYSNTSTPAATDINSLSTTYFSGKTAVG 600
           PTSNNHHTANLATTPSSFLGTSYFANHPGQQTSYSNTSTPAATDINSLSTTYFSGKTAVG
Sbjct: 541 PTSNNHHTANLATTPSSFLGTSYFANHPGQQTSYSNTSTPAATDINSLSTTYFSGKTAVG 600

Query: 601 NSRQTSDISYMTEKEFHTDSEPFDTNDVPTPIEGVSSMRGISNNAIQELDEEERPNEDCS 660
           NSRQTSDISYMTEKEFHTDSEPFDTNDVPTPIEGVSSMRGISNNAIQELDEEERPNEDCS
Sbjct: 601 NSRQTSDISYMTEKEFHTDSEPFDTNDVPTPIEGVSSMRGISNNAIQELDEEERPNEDCS 660

Query: 661 DTRKSEIDLMRLLDTNISDRKLAVNNNTKHFDDNDFNRSANSGGTRSNTAMDSFMTNFLY 720
           DTRKSEIDLMRLLDTNISDRKLAVNNNTKHFDDNDFNRSANSGGTRSNTAMDSFMTNFLY
Sbjct: 661 DTRKSEIDLMRLLDTNISDRKLAVNNNTKHFDDNDFNRSANSGGTRSNTAMDSFMTNFLY 720

Query: 721 XXXXXXXXXXXXXXXXXSIFEDFDYKSLGLDNMAPNNRQILNDDCEMETKGTQGQLSSNF 780
                            SIFEDFDYKSLGLDNMAPNNRQILNDDCEMETKGTQGQLSSNF
Sbjct: 721 ETQIDDTNETQQNNNDNSIFEDFDYKSLGLDNMAPNNRQILNDDCEMETKGTQGQLSSNF 780

Query: 781 DFNFDTDLPIGHEFLPDSLASGQNPDQNHAAYGSRGYQIPDHQVMNNQNAQTDTT 835
           DFNFDTDLPIGHEFLPDSLASGQNPDQNHAAYGSRGYQIPDHQVMNNQNAQTDTT
Sbjct: 781 DFNFDTDLPIGHEFLPDSLASGQNPDQNHAAYGSRGYQIPDHQVMNNQNAQTDTT 835

>YER167W (BCK2) [1595] chr5 (518211..520766) Protein involved in the
           SIT4 pathway for CLN activation and in suppression of
           lethality due to mutations in the protein kinase C
           pathway [2556 bp, 851 aa]
          Length = 851

 Score =  167 bits (424), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 215/737 (29%), Positives = 318/737 (43%), Gaps = 138/737 (18%)

Query: 15  DSVNKWRIPHYYKRGKSVGSTPVSEVVNS-------PLRAVQNEPSVSSPKKILLEE--R 65
           +S NKW+IPHYY+R  S GST  S   NS       P+    N   +SSPKK+LLE+   
Sbjct: 22  ESTNKWKIPHYYRRSAS-GSTQASPDRNSSTGSCSTPVLPTMN--VMSSPKKVLLEDPRD 78

Query: 66  NRATPRSRKSSKKGQMVFVNYTXXXXXXXXXXXXXXXXXXXXXXXPKTSAVTQAAILDNK 125
           N    +     K G+MVFVNYT                         T   TQ   +   
Sbjct: 79  NHTKAKKSSRKKSGEMVFVNYTVQDTANEN----------------DTDLQTQPVSVPAP 122

Query: 126 HVLTXXXXXXXXXMLKIFGSSK----EQVIPLEPESHQ-DAQ-KDLAARLIENSAEXXXX 179
                        MLKIFGSSK    E ++  +P   Q D++ K L+   I  S      
Sbjct: 123 -KAKLKKKSSKRRMLKIFGSSKNEHIEDIVEEQPMVLQMDSESKPLSGTPISESG----- 176

Query: 180 XXXXXXXXXXXXXQGRSYGSFLKYNKFCSGSDRSKNNNASTDFNAML-INNQNKMSNHLA 238
                          RSY SFLK+N+           N  T F+  L   + N M N   
Sbjct: 177 ------IDASSLTTKRSYNSFLKHNRL----------NGKTPFSGNLSFPSLNMMGNTTD 220

Query: 239 LNYSAAKSAEGLLNHFA-EDEMVPKSLPDPNLAKPAIRVGPTDRKRSVSSSAIPMKAASS 297
           L            N F  E E+VPKS  DP+LAKP  R   ++   + + S+IP+    +
Sbjct: 221 LPIDN--------NDFCSEKEVVPKSTHDPSLAKPPSRFTESETNSTPNLSSIPLMNTKN 272

Query: 298 TSLTSKVTKPA---RKMSTTTTLSNPSSHNTPFTEFENSNLTDSYQYSD-------PYIS 347
           T L      P    R+ S  + L     H+T    F++ N +++            P+ +
Sbjct: 273 TRLKYNKVAPQSSDRQKSQESGLY----HSTESFNFKDQNYSNNKSSLSLNSDLSTPHFA 328

Query: 348 RNSNMSNASITSFISSMNVGNSTNITPLTESTKVDTNDNFNALMKGHISEPGEENDASVA 407
           ++S  S  +  SF    N G+S +   L E                       ENDAS+A
Sbjct: 329 KHSPDSPRTSRSF----NCGDSQSKVKLPE-----------------------ENDASIA 361

Query: 408 FTKLFHRKRAXXXXXXXXXXXXXXXXXXXXXITKSGVSKISAHRTTSLNSLASIANRFSP 467
           F+K+F RKRA                       K  V+K+   RTTS+ SL+S++NR+SP
Sbjct: 362 FSKMFTRKRANTGGSTCSLASPTIAQTIQQSNIK--VNKLPTQRTTSVGSLSSMSNRYSP 419

Query: 468 IRTASPVRPRSNTRSSSTCRHSRDLSGLVPLT-TPEYLGPSTGTEVYLDTQSKRTV---- 522
           IR ASP R RS TR SS  R SRDL+ L  +T  PE    +   E++LD Q +       
Sbjct: 420 IRVASPGRARSATRGSSLYRLSRDLNSLPSVTDLPEMDSTTPVNEIFLDGQPQHKSGSVK 479

Query: 523 -NHKKKQESISELSKFQNTPTSNNHHTANLATTPSSFLGT-SYFANHPGQQTSYSNTSTP 580
             H+KKQESIS+  + Q        H+ +  TTPSS L T  Y+       +S S +STP
Sbjct: 480 GGHRKKQESISDAQRIQ--------HSNSYITTPSSSLVTPPYYMTGYTLPSSASASSTP 531

Query: 581 AATDINSLSTTYFSGKTAVGNSRQTSDISYMTEKEFHTDSEPFDTNDVPTPIEGVSSMRG 640
              + ++++  +    + V + R +S+ S   ++  + +    + +   TP+E + +++G
Sbjct: 532 NVLETHNMN--FVPSTSTVTSYRPSSNFSSFDKEYSNENDASGEFSAFNTPMENIPALKG 589

Query: 641 ISNNAIQELDEEERPNEDCSDTRKSEIDLMRLLDTNISDRKLAVNNNTKHFDDNDFNRSA 700
           I  + ++E +EE+   +D  +T   +   +  +DT+  D  L            DFN   
Sbjct: 590 IPRSTLEENEEEDVLVQDIPNTAHFQRRDIMGMDTHRKDDSL------------DFNSLM 637

Query: 701 NSGGTRSNTAMDSFMTN 717
             G T S++ +DS MTN
Sbjct: 638 PHGSTTSSSIVDSVMTN 654

>Scas_681.21
          Length = 846

 Score = 88.6 bits (218), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 121/408 (29%), Positives = 172/408 (42%), Gaps = 86/408 (21%)

Query: 257 DEMVPKSLPDPNLAKPAIR-VGPTDRKRSVSSSAIPMKAASSTSLTSKVTKPARKMSTTT 315
           +E+VPKS+P+  LAKP     G   R +S +S    +   ++ +  + +TK   K+    
Sbjct: 229 NEVVPKSVPNSILAKPPSNPTGSNGRSKSFTSKVANIPLFNTRNYRNTMTKNDSKLL--- 285

Query: 316 TLSNPSSHNTPFTEFENSNLTDSYQYSDPYISRNSNMSNASITSFISSMNVGNSTNITPL 375
                   + P  + E     D +     Y   N+N+   S ++   + N+  S N    
Sbjct: 286 -------KDEPMNDLE----IDHHYLDGSYYMDNNNIIPESNSTPNLNYNLTQSGNTLHK 334

Query: 376 TESTKVDTNDNFNALMKGHISEPGEENDASVAFTKLFHRKR------------------- 416
             ST   T   F  +         EENDAS+AF+K+F RKR                   
Sbjct: 335 VNSTSATTKK-FTKM---------EENDASIAFSKMFTRKRANTAGSMNSLRYTSNSNSN 384

Query: 417 ---------------AXXXXXXXXXXXXXXXXXXXXXITKSGVSKISAHRTTSLNSLASI 461
                          A                     I +S  S   A RT S+ SL+S+
Sbjct: 385 SNANANANANANANQAQLQNIYQSVQHPSNQSQPNLKINRSSSSTTLAQRTMSVASLSSL 444

Query: 462 ANRFSPIRTASPVRPRSNTRSSSTCRHSRDLSGLVP--LTTPEYLGPSTGTEVYLDTQ-- 517
           +NR+SP R  SP RPRS  +S+S  R SR+L+ L    L  PE  GP    E YLD Q  
Sbjct: 445 SNRYSPNRMISPARPRS-AKSTSNYRLSRELNSLYTNVLEIPELTGP----ESYLDVQYM 499

Query: 518 --------SKRTV-NHKKKQESISELSKFQNTPTSNNHHTANLATTPSSFLGT-SYFANH 567
                    K TV  H+KKQESIS+L +         H T  +ATTP+SFL T  YF  +
Sbjct: 500 QKSNSVSSDKATVLGHRKKQESISDLHRV--------HTTTTVATTPTSFLVTPPYFTTN 551

Query: 568 PGQQTSYSNTSTPAATDINSLSTTYFSGKTAVGNSRQTSDISYMTEKE 615
               TS SN STP+  ++  ++    S  +    SRQT + S   E++
Sbjct: 552 FTIPTSTSNISTPSCGEVTQINNITNSNPSLKITSRQTGNFSSFLERD 599

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 15  DSVNKWRIPHYYKRGKSVGSTPVSE----VVNSPLRAVQNEPSVSSPKKILLEE-RNRAT 69
           +++NKW+IPHYY+R     STP +E      N       N   ++SPKK+LLEE +    
Sbjct: 36  ETLNKWKIPHYYRRSNIGLSTPQTESSMSFANPSANLSPNINVMTSPKKLLLEEPKKSKN 95

Query: 70  PRSRKSSKKGQMVFVNYT 87
              +   KKG MVFVNYT
Sbjct: 96  GSKKSQKKKGGMVFVNYT 113

>Kwal_56.23462
          Length = 695

 Score = 81.6 bits (200), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 80/137 (58%), Gaps = 17/137 (12%)

Query: 399 GEENDASVAFTKLFHRKRAXXXXXXXXXXXXXXXXXXXXXITKSGVSKI-SAHRTTSLNS 457
           G+ENDAS+AF+K+F RKRA                     ++ +  + + + HR  S +S
Sbjct: 297 GDENDASIAFSKMFTRKRANTGGSMSSL------------VSSTASNNLPTLHRNMSTHS 344

Query: 458 LASIANRFSPIRTASPVRPRSNTRSSSTCRHSRDLSGLVPLTTPEYLGPSTGTEVYLDTQ 517
           ++S++NR+SPIR  SP R  S  RS+S  R+SRD + L    +  Y   + G E+YLD+Q
Sbjct: 345 ISSMSNRYSPIRAGSPARNNSILRSNSN-RYSRDCTLLQ--GSSNYADLTGGMEIYLDSQ 401

Query: 518 SK-RTVNHKKKQESISE 533
           +K R   HKKKQ+SIS+
Sbjct: 402 TKQRHTTHKKKQDSISD 418

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 53/81 (65%), Gaps = 11/81 (13%)

Query: 15 DSVNKWRIPHYYKRGKSVGSTPVSEVV--NSPLRAVQNEPS-----VSSPKKILLEERNR 67
          +SV+KW+IPHYY+  KS G+ PV + +  N+ L++  N  +     +++PK + L+E   
Sbjct: 22 ESVSKWKIPHYYR--KSTGA-PVRQELGSNTSLKSESNRANGNINIMTTPKHVQLDESGG 78

Query: 68 ATPRSRKS-SKKGQMVFVNYT 87
           + R  KS +KKG+MVFVNYT
Sbjct: 79 GSKRGSKSKAKKGEMVFVNYT 99

>AGR119C [4430] [Homologous to ScYER167W (BCK2) - SH]
           (969101..971506) [2406 bp, 801 aa]
          Length = 801

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 53/156 (33%), Positives = 71/156 (45%), Gaps = 28/156 (17%)

Query: 400 EENDASVAFTKLFHRKRAXXXXXXXXXXXXXXXXXXXXXITKSGVSKISAHRTTSLNSLA 459
           +ENDAS+AF+K+F RKRA                        S    IS +      S  
Sbjct: 392 DENDASIAFSKMFTRKRANTGGSLSSFV--------------SNTQTISPYNIPGNISTH 437

Query: 460 SI-ANRFSPIRTASPVRPRSNTRSSSTCRHSRDL----------SGLVPLTTPEYLGPS- 507
           SI + R+SPIR+ SP RPRSNTR S T R++RDL          SGL   +      PS 
Sbjct: 438 SIPSQRYSPIRSHSPGRPRSNTRGSLTHRNTRDLSSAYLSANNVSGLSSQSGAALFNPSE 497

Query: 508 --TGTEVYLDTQSKRTVNHKKKQESISELSKFQNTP 541
              G + ++D+Q K     KKK + + +  K    P
Sbjct: 498 PVVGMDTFIDSQYKSRYGQKKKHDGVCDTRKPYQAP 533

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 50/92 (54%), Gaps = 21/92 (22%)

Query: 15  DSVNKWRIPHYYKRGKSVGSTPVSEV--VNSPLRAVQNEPSVS------------SPKKI 60
           +S +KW+IPHYYK+  SV  T +S++    S  +     P+++            +P  +
Sbjct: 20  ESTSKWKIPHYYKKASSVTQTVISDLNPATSSQQCATYSPTMALNGGNNRINIMNTPVAV 79

Query: 61  LLEERNRATPRSR-----KSSKKGQMVFVNYT 87
            LE+ ++  P++R     K+ K G+MVFVN+T
Sbjct: 80  QLEDPDQ--PKTRKGQKAKAKKNGEMVFVNFT 109

>KLLA0C17666g 1562996..1565368 some similarities with sp|P33306
           Saccharomyces cerevisiae YER167w BCK2 suppressor of
           mutations in protein kinase C pathway components
           singleton, hypothetical start
          Length = 790

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 55/146 (37%), Positives = 76/146 (52%), Gaps = 23/146 (15%)

Query: 400 EENDASVAFTKLFHRKRAXXXXXXXXXXXXXXXXXXXXXITKSGVSKISAHR-TTSLNSL 458
           +ENDASVAF+KLF RKR                       T+  +  +  H+ +TS+ S 
Sbjct: 415 DENDASVAFSKLFTRKRTNTGGSISSLLSLSA--------TQPSIPALDRHQSSTSVTS- 465

Query: 459 ASIANRFSPIRTASPVRPRSNTRSSSTCRHSRDLSGL-----VPLTTPEYLGPSTGTEVY 513
              + R+SPIR+ S  R RSNTR+S+  R SRDL+ L     +  T    L    G E Y
Sbjct: 466 ---SMRYSPIRSGSQNRTRSNTRTSN-HRLSRDLTSLQTSMKISNTDSSEL---PGMESY 518

Query: 514 LDTQSK-RTVNHKKKQESISELSKFQ 538
           LDT +K     H+KKQESIS++++  
Sbjct: 519 LDTHNKGNKPTHRKKQESISDMARLH 544

>Scas_636.16d
          Length = 620

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 64/146 (43%), Gaps = 12/146 (8%)

Query: 400 EENDASVAFTKLFH------RKRAXXXXXXXXXXXXXXXXXXXXXITKSGVSKISAHRTT 453
           EENDA++AF ++         +R                        KS + K      T
Sbjct: 234 EENDAAIAFNRIHSAEPFPIEERMDAIRAFSKITNKRSQSLSQVPTMKSNIQKNRNMSVT 293

Query: 454 SLNSLASIANRFSPIRTASPVRPRSNTRSSSTCRHSRDLSGLVPLTTPEYLGPSTGTEVY 513
           S++S  S  +++SP+ T +P R RS+ +  S  R S++   L  +   +++  +   E +
Sbjct: 294 SVSSNMSNLSKYSPLGTVTPGRRRSSVQRHSFYRSSKEWLSLYNIH--DHVE-TQQDETF 350

Query: 514 LDTQSKRTVN---HKKKQESISELSK 536
           LDT   R       KK+  SISEL+K
Sbjct: 351 LDTSLPRDTKICIRKKQPGSISELNK 376

>Scas_683.30
          Length = 478

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 15/24 (62%)

Query: 549 ANLATTPSSFLGTSYFANHPGQQT 572
           AN +  PS    TSYFA HP QQT
Sbjct: 78  ANYSNVPSRLPSTSYFAQHPQQQT 101

>CAGL0J06732g complement(643534..646503) similar to sp|Q03758
           Saccharomyces cerevisiae YML111w BUL2 or sp|P48524
           Saccharomyces cerevisiae YMR275c BUL1, hypothetical
           start
          Length = 989

 Score = 30.4 bits (67), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 44/102 (43%), Gaps = 21/102 (20%)

Query: 588 LSTTYFSGKTAVGNSRQTSDISYMTEKEFHTDSEPFDTNDVPTPIEG-------VSSMRG 640
           LS  Y      VG  ++TS ++ M E+E++    PF  N  P+P++        +  ++ 
Sbjct: 474 LSINYTIDAKIVGKEKKTSKLNIMREREYNLRVVPFGFN-TPSPVQSNLRSKSQLKELKR 532

Query: 641 ISNNAIQELD---EEERPNE----------DCSDTRKSEIDL 669
           + N  I  L+   E  + NE          D S T  SE DL
Sbjct: 533 LLNERIAALERVFERLKKNEPIQNADIYGTDISGTIDSETDL 574

>YLR030W (YLR030W) [3448] chr12 (203291..204082) Protein of unknown
           function [792 bp, 263 aa]
          Length = 263

 Score = 29.6 bits (65), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 4/58 (6%)

Query: 636 SSMRGISNNAIQELDEEERPNEDCSDTRKSEIDLMRLLDTNISDRKLAVNNNTKHFDD 693
           S+ R   N A Q L  EE PNE+C ++    + L++ + T    R L+  N+ K   D
Sbjct: 67  STQRYSGNVAQQRLSFEEHPNEECQNS----VGLIKRVSTFFKKRPLSRKNSIKSIGD 120

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.308    0.123    0.340 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 25,655,198
Number of extensions: 1117964
Number of successful extensions: 6619
Number of sequences better than 10.0: 335
Number of HSP's gapped: 6210
Number of HSP's successfully gapped: 567
Length of query: 835
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 725
Effective length of database: 12,788,129
Effective search space: 9271393525
Effective search space used: 9271393525
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 66 (30.0 bits)